[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL03110.1

[Show Plain Result]


## Summary of Sequence Search
    1::125
  227::354     5e-12  38%  479 aa  OPRJ_PSEAE RecName: Full=Outer membrane protein oprJ;Flags:
  247::355     3e-10  36%  485 aa  OPRM_PSEAE RecName: Full=Outer membrane protein oprM;Flags:
  273::354     1e-08  37%  484 aa  TTGC_PSEPK RecName: Full=Probable efflux pump outer membrane
  273::354     1e-08  37%  484 aa  MEPC_PSEPU RecName: Full=Multidrug/solvent efflux pump outer
  273::354     1e-08  37%  484 aa  ARPC_PSEPU RecName: Full=Antibiotic efflux pump outer membrane
  273::354     2e-08  37%  484 aa  TTGC_PSEPU RecName: Full=Toluene efflux pump outer membrane protein
  275::357     3e-08  35%  480 aa  TTGF_PSEPU RecName: Full=Toluene efflux pump outer membrane protein
  275::357     3e-08  35%  480 aa  SEPC_PSEP1 RecName: Full=Probable efflux pump outer membrane
  249::354     9e-08  30%  470 aa  SRPC_PSEPU RecName: Full=Solvent efflux pump outer membrane protein
  244::365     9e-08  33%  478 aa  MDTQ_SHIFL RecName: Full=Putative multidrug resistance outer
  244::365     1e-07  32%  478 aa  MDTQ_ECOLI RecName: Full=Putative multidrug resistance outer
  244::365     2e-07  32%  478 aa  MDTQ_ECO57 RecName: Full=Multidrug resistance outer membrane
  278::365     3e-07  35%  478 aa  MDTQ_ECOL6 RecName: Full=Multidrug resistance outer membrane
  249::354     8e-07  30%  470 aa  TTGI_PSEPU RecName: Full=Toluene efflux pump outer membrane protein
  252::368     1e-06  26%  488 aa  MDTP_ECOL6 RecName: Full=Multidrug resistance outer membrane
  252::368     1e-06  26%  488 aa  MDTP_ECO57 RecName: Full=Multidrug resistance outer membrane
  289::368     1e-06  28%  488 aa  MDTP_ECOLI RecName: Full=Multidrug resistance outer membrane
  252::368     2e-06  25%  488 aa  MDTP_SHIFL RecName: Full=Multidrug resistance outer membrane
  285::366     4e-06  32%  530 aa  FUSA_BURCE RecName: Full=Fusaric acid resistance protein
  273::347     5e-05  25%  467 aa  NODT_RHILT RecName: Full=Nodulation protein T;Flags: Precursor;
  268::347     5e-05  31%  460 aa  CUSC_ECOL6 RecName: Full=Cation efflux system protein cusC;Flags:
  269::324     9e-05  30%  454 aa  Y1462_HAEIN RecName: Full=Uncharacterized protein HI1462;
  256::311     9e-05  30%  441 aa  Y1340_HAEIN RecName: Full=Uncharacterized protein HI1340;
  270::310     5e-04  37%  482 aa  NODT_RHILV RecName: Full=Nodulation protein T;Flags: Precursor;
  268::347     5e-04  30%  457 aa  CUSC_ECOLI RecName: Full=Cation efflux system protein cusC;Flags:
  268::347     5e-04  30%  460 aa  CUSC_ECO57 RecName: Full=Cation efflux system protein cusC;Flags:
    1::125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLKQQRHEQETTLKILVGRIPENIVNGLIYRNKPIDYFPALPVLPKILPSELLEQRPDIKAAEQNLLA
OPRJ_PSEAE      ---VEQARAEQERNL-----RQKQQAFNALVLLLGSDDAAQAIPQRPKLLPSELIERRPDILAAEHRLXX
OPRM_PSEAE      ---------DQNALVLLLGSGIPANLPQGL-----GLDQ-TLLTEVPAGLPSDLLQRRPDILEAEHQLMX
TTGC_PSEPK      ------------------------------------------LAEVPAGLPSDILQRRPDIQEAEHLLKX
MEPC_PSEPU      ------------------------------------------LAEVPAGLPSDILQRRPDIQEAEHLLKX
ARPC_PSEPU      ------------------------------------------LAEVPAGLPSDILQRRPDIQEAEHLLKX
TTGC_PSEPU      ------------------------------------------LAEVPAGLPSDILQRRPDIQEAEHLLKX
TTGF_PSEPU      ------------------------------------------LAALSTGLPADLLLHRPDIRAAEHXXXX
SEPC_PSEP1      ------------------------------------------LAALSTGLPADLLLHRPDIRAAEHXXXX
SRPC_PSEPU      --------------LELLLGKIPTDLP-----KNSPLA-MSALGKVPAGLPADLLLNRPDIRSAEHQLMX
MDTQ_SHIFL      ----RQQLNDVAGKMKIIEARL-----NALTHQTKSLKLKPALPKVASQLPDELLARRADLQAAHWYVES
MDTQ_ECOLI      ----RQQLNDVAGKMKIIEARLSALTNN----QTKSLKLKPALPKVASQLPDELLARRADLQAAHWYVES
MDTQ_ECO57      ----RQQLNDVAGKMKIIEARLIA-LTN---HQTKSLTLKPALPKVASQLPDELLARRADLQAAHWYVES
MDTQ_ECOL6      -----------------------------------------ALPKVASQLPDELLARRADLQAAHWYVES
TTGI_PSEPU      --------------LELLLGKIPTDLP-----KNSPLA-MSALGKVPAGLPADLLLNRPRIRSAEHQLMX
MDTP_ECOL6      ---VKGQITETRESLRALIGAGASDMPE-----IKPVALPRVQTGIPATLSYELLARRPDLQAMRWYVQA
MDTP_ECO57      ---VKGQITETRESLRALIGAGASDMPE-----IKPVALPRVQTGIPATLSYELLARRPDLQAMRWYVQA
MDTP_ECOLI      ---------------------------------------------IPATLSYELLARRPDLQAMRWYVQA
MDTP_SHIFL      ---VKGQITETRESLRALIGAGASDMPE-----IKPVALPRVQTGIPATLSYELLARRPDLQAMRWYVQA
FUSA_BURCE      ---------------------------------------------LPSAMPADLLGRRPDVVAARWTVDA
NODT_RHILT      -------------------------------------------------IPADIIRNRPDIRKAERDLAD
CUSC_ECOL6      ---------------------------------------------LPAGLPSQILLQRPDIMEAEHXXXX
Y1462_HAEIN     -------------------------------------------------VPVSVIANRPDVKAAQFRLSS
Y1340_HAEIN     -------------------------------------------------VPVSVIANRPDVKAAQFRLSS
NODT_RHILV      -------------------------------------------------IPADLIRNRFDIRQAERDLAA
CUSC_ECOLI      ---------------------------------------------LPAGLSSQILLQRPDIMEAEHXXXX
CUSC_ECO57      ---------------------------------------------LPAGLSSQILLQRPDIMEAEHXXXX


                         .         .         *         .         .         .         .:140
query           ADVNLKTIKATYFPQISLTGLLGFGSNKLNTLFTNSAETWQVDGNIAGPIFDFGK
OPRJ_PSEAE      XXXXXXXXXXXFFPRISLTGSFGTSSAEMSGLFDGGSRSWSFLPTLTLPIFDGGR
OPRM_PSEAE      XXXXXXXXXXXFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAG-
TTGC_PSEPK      XXXXXXXXXXXFFPSISLTANAGSLSPDMGHLFSGGQGTWLFQPQINLPIFNAG-
MEPC_PSEPU      XXXXXXXXXXXFFPSISLTANAGSLSPDMGHLFSGGQGTWLFQPQINLPIFNAG-
ARPC_PSEPU      XXXXXXXXXXXFFPSISLTANAGSLSPDMGHLFSGGQGTWLFQPQINLPIFNAG-
TTGC_PSEPU      XXXXXXXXXXXFFPSISLTANAGSLSPDMGHLFAGGQGTWLFQPQINLPIFNAG-
TTGF_PSEPU      XXXXXXXXXXXFFPSITLTAAAGTASHELDGLFEGGSGLWAFMPRINLPIFTAGR
SEPC_PSEP1      XXXXXXXXXXXFFPSITLTAAAGTASHELDGLFEGGSGLWAFMPRINLPIFTAGR
SRPC_PSEPU      XXXXXXXXXXXFFPRIXXXXXXXXXXXXXXXXFNSGSDSWSFAPQISVPIFNAGK
MDTQ_SHIFL      SLSTIDAAKAAFYPDINLMAFLQQDALHLSDLFRHSAQQMGVTAGLTLPIFDSGR
MDTQ_ECOLI      SLSTIDAAKAAFYPDINLMAFLQQDALHLSDLFRHSAQQMGVTAGLTLPIFDSGR
MDTQ_ECO57      SLSTIDAAKAAFYPDINLMAFLQQDALHLSDLFRHSAQQMGVTAGLTLPIFDSGR
MDTQ_ECOL6      SLSTIDAAKAAFYPDINLMAFLQQDALHLSDLFRHSAQQMGVTAGLTLPIFDSGR
TTGI_PSEPU      XXXXXXXXXXXFFPRIXXXXXXXXXXXXXXXXFNSGSDSWSFAPQISVPIFNAGK
MDTP_ECOL6      SLDQVDSARALFYPSFDIKAFFGLDSIHLDTLFKKTSRQFNFIPGLKLPLFDGGR
MDTP_ECO57      SLDQVDSARALFYPSFDIKAFFGLDSIHLDTLFKKTSRQFNFIPGLKLPLFDGGR
MDTP_ECOLI      SLDQVDSARALFYPSFDIKAFFGLDSIHLHTLFKKTSRQFNFIPGLKLPLFDGGR
MDTP_SHIFL      SLDQVDSARALFYPSFDIKAFFGLDAIHLDTLFKKTSRQFNFIPGLKLPLFDGGR
FUSA_BURCE      QARGIDVAKASFYPNIDLLATVGFGVTAPFTDFLRAMNGWTAGPALSLPIFEGGR
NODT_RHILT      STAQIGVAEAKLFPSITLSGSISPSGGINERGVYGNLTPWSFGPKLKLPILDGG-
CUSC_ECOL6      XXXXXXXXXXXFFPSISLTSGISTXXXXXXXXXXXXXGMWNFIPKIEIPIFNAGR
Y1462_HAEIN     AFKNAKATQKSWFPEVNLGASLSSTASTVGTALHN--------------------
Y1340_HAEIN     AFKNAKATQKSWFPEVNLGASLSSTASTVGTALHN--------------------
NODT_RHILV      ATAQIGVAEAQLYPAITLSG-----------------------------------
CUSC_ECOLI      XXXXXXXXXXXFFPSISLTSGISTXXXXXXXXXXXXXGMWNFIPKIEIPIFNAGR
CUSC_ECO57      XXXXXXXXXXXFFPSISLTSGISTXXXXXXXXXXXXXGMWNFIPKIEIPIFNAGR