[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL03216.1

[Show Plain Result]


## Summary of Sequence Search
    1::231
    1::231     e-126  91%  231 aa  Y493_RICPR RecName: Full=Putative aldolase class 2 protein RP493;
   23::228     3e-34  36%  257 aa  Y1201_CAUCR RecName: Full=Putative aldolase class 2 protein
  361::539     6e-34  40%  611 aa  ADD2_CAEEL RecName: Full=Adducin-related protein 2;
  145::328     5e-33  38%  735 aa  ADDA_MOUSE RecName: Full=Alpha-adducin;AltName: Full=Erythrocyte
  145::328     7e-33  36%  737 aa  ADDA_PONAB RecName: Full=Alpha-adducin;AltName: Full=Erythrocyte
  145::328     7e-33  36%  737 aa  ADDA_HUMAN RecName: Full=Alpha-adducin;AltName: Full=Erythrocyte
  145::328     1e-32  38%  735 aa  ADDA_RAT RecName: Full=Alpha-adducin;AltName: Full=Erythrocyte
   23::216     2e-31  34%  259 aa  Y3430_PSEAE RecName: Full=Putative aldolase class 2 protein PA3430;
   79::289     2e-30  34%  324 aa  ADDH_SCHPO RecName: Full=Adducin-related protein C1289.14;
  141::320     2e-27  35%  706 aa  ADDG_HUMAN RecName: Full=Gamma-adducin;AltName: Full=Adducin-like
  141::320     2e-27  37%  706 aa  ADDG_MOUSE RecName: Full=Gamma-adducin;AltName: Full=Adducin-like
  141::320     2e-26  36%  705 aa  ADDG_RAT RecName: Full=Gamma-adducin;AltName: Full=Adducin-like
  133::316     3e-26  35%  725 aa  ADDB_RAT RecName: Full=Beta-adducin;AltName: Full=Erythrocyte
  133::316     3e-26  35%  725 aa  ADDB_MOUSE RecName: Full=Beta-adducin;AltName: Full=Erythrocyte
  133::316     2e-25  35%  726 aa  ADDB_PONAB RecName: Full=Beta-adducin;AltName: Full=Erythrocyte
  133::316     2e-25  35%  726 aa  ADDB_HUMAN RecName: Full=Beta-adducin;AltName: Full=Erythrocyte
  119::304     2e-25  36% 1156 aa  HTS_DROME RecName: Full=Protein hu-li tai shao;AltName:
  127::359     2e-24  29%  732 aa  ADD1_CAEEL RecName: Full=Adducin-related protein 1;
   23::207     1e-19  27%  257 aa  MUG14_SCHPO RecName: Full=Meiotically up-regulated gene 14 protein;
   17::187     3e-13  31%  216 aa  FUCA_HAEIN RecName: Full=L-fuculose phosphate aldolase;       
   25::180     9e-12  31%  180 aa  FUCA_METMP RecName: Full=L-fuculose phosphate aldolase;       
   29::181     4e-11  32%  181 aa  FUCA_METM5 RecName: Full=L-fuculose phosphate aldolase;       
   25::180     8e-10  31%  180 aa  FUCA_METM7 RecName: Full=L-fuculose phosphate aldolase;       
   25::178     4e-09  28%  181 aa  FUCA_METVS RecName: Full=L-fuculose phosphate aldolase;       
   17::175     4e-09  29%  215 aa  FUCA_ECOL6 RecName: Full=L-fuculose phosphate aldolase;       
   17::175     5e-09  29%  215 aa  FUCA_ECO57 RecName: Full=L-fuculose phosphate aldolase;       
   17::175     7e-09  27%  215 aa  FUCA_SHIFL RecName: Full=L-fuculose phosphate aldolase;       
   17::175     7e-09  27%  215 aa  FUCA_ECOLI RecName: Full=L-fuculose phosphate aldolase;       
   35::175     1e-08  26%  181 aa  FUCA_METJA RecName: Full=L-fuculose phosphate aldolase;       
   36::179     1e-08  25%  180 aa  FUCA_META3 RecName: Full=L-fuculose phosphate aldolase;       
   56::194     1e-07  27%  208 aa  MTNB_AQUAE RecName: Full=Methylthioribulose-1-phosphate
   48::189     2e-07  28%  212 aa  YGBL_ECOLI RecName: Full=Putative aldolase class 2 protein ygbL;
   10::185     6e-07  26%  229 aa  ARAD_BACSU RecName: Full=L-ribulose-5-phosphate 4-epimerase;       
   24::202     2e-06  21%  228 aa  ULAF_ECO24 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   41::193     2e-06  31%  210 aa  Y1012_HAEIN RecName: Full=Putative aldolase class 2 protein HI1012;
   24::202     2e-06  24%  228 aa  ULAF_SHIB3 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
    4::202     4e-06  23%  228 aa  ULAF_ECOL5 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     7e-06  23%  228 aa  ULAF_SHISS RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     7e-06  24%  228 aa  ULAF_SHIFL RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     7e-06  24%  228 aa  ULAF_SHIF8 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     7e-06  24%  228 aa  ULAF_SHIDS RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     7e-06  24%  228 aa  ULAF_ECOL6 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     7e-06  24%  228 aa  ULAF_ECOHS RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     7e-06  24%  228 aa  ULAF_ECO5E RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     7e-06  24%  228 aa  ULAF_ECO57 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     7e-06  24%  228 aa  ULAF_ECO55 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     9e-06  24%  228 aa  ULAF_ECO81 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     9e-06  24%  228 aa  ULAF_ECO7I RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     1e-05  24%  228 aa  ULAF_ECOK1 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     1e-05  24%  228 aa  ULAF_ECO45 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     2e-05  24%  228 aa  ULAF_ECOSM RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     2e-05  24%  228 aa  ULAF_ECOLC RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::202     2e-05  23%  228 aa  ULAF_SHIBS RecName: Full=Putative L-ribulose-5-phosphate
   24::191     2e-05  24%  228 aa  ULAF_ESCF3 RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::191     2e-05  24%  228 aa  ULAF_ECOSE RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   57::203     2e-05  25%  204 aa  MTNB_METCA RecName: Full=Methylthioribulose-1-phosphate
   24::191     5e-05  24%  228 aa  ULAF_ECOLI RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::191     5e-05  24%  228 aa  ULAF_ECODH RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   24::191     5e-05  24%  228 aa  ULAF_ECOBW RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
    4::192     5e-05  26%  231 aa  ARAD_ECOLI RecName: Full=L-ribulose-5-phosphate 4-epimerase;       
   24::191     6e-05  24%  228 aa  ULAF_ECOLU RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   19::192     6e-05  26%  228 aa  ARAD_BACST RecName: Full=L-ribulose-5-phosphate 4-epimerase;       
   24::191     1e-04  24%  228 aa  ULAF_ECO8A RecName: Full=L-ribulose-5-phosphate 4-epimerase ulaF;  
   55::184     1e-04  26%  205 aa  MTNB_GLUDA RecName: Full=Methylthioribulose-1-phosphate
   34::189     2e-04  28%  204 aa  MTNB_ENT38 RecName: Full=Methylthioribulose-1-phosphate
   29::189     2e-04  28%  204 aa  MTNB_CITK8 RecName: Full=Methylthioribulose-1-phosphate
   67::194     7e-04  24%  218 aa  MTNB_XYLFT RecName: Full=Methylthioribulose-1-phosphate
   64::194     7e-04  23%  218 aa  MTNB_XYLFA RecName: Full=Methylthioribulose-1-phosphate
   67::194     7e-04  24%  218 aa  MTNB_XYLF2 RecName: Full=Methylthioribulose-1-phosphate
   56::205     7e-04  27%  208 aa  MTNB_PSEPF RecName: Full=Methylthioribulose-1-phosphate
   50::180     7e-04  28%  202 aa  MTNB_KLEP7 RecName: Full=Methylthioribulose-1-phosphate
   50::180     7e-04  28%  202 aa  MTNB_KLEP3 RecName: Full=Methylthioribulose-1-phosphate
   67::194     9e-04  24%  218 aa  MTNB_XYLFM RecName: Full=Methylthioribulose-1-phosphate
    1::231

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLDGQILEGEEYQ
Y493_RICPR      MDIKYNLAAAYKIMAYLSLDDHTYTHLSARSKNADFYYIYPFGLRFEEVTTENLLKVSLDGKILEGEEYQ
Y1201_CAUCR     ---RVDLAALYRLVALHGWDDMIFTHISARPGPEHHFLINPYGMFFGEITASSLVKVDLEGNVIDKTPYY
ADD2_CAEEL      ------LASLYRLVDLFRWSQGIYNHITVRVSDPDEILINAFGQLYSEVSASSLIKVDLDGTVIDGGSTN
ADDA_MOUSE      --LRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFIVPFGLLYSEVTASSLVKVNLQGDIVDSTNLG
ADDA_PONAB      --LRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFIVPFGLLYSEVTASSLVKINLQGDIVDSTNLG
ADDA_HUMAN      --LRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFIVPFGLLYSEVTASSLVKINLQGDIVDSTNLG
ADDA_RAT        --LRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFIVPFGLLYSEVTASSLVKVNLQGDIVDSTNLG
Y3430_PSEAE     ---RVDLAACYRLVALHGWDDLIFTHISAKVPGTEDFLINPFGLMFHEITASSLVKVDASGKKLMDSPYE
ADDH_SCHPO      ---RIELAAAYRLFGLEHWNENILNHLTAKPDGTASFLINPYGLRYGEITASSLIKVDEDGNIVTGDVFG
ADDG_HUMAN      ------LASLYRLVDLFGWAHLANTYISVRSKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDSTNLK
ADDG_MOUSE      ------LASLYRLADLFGWAHLANTYISVRSKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDSTDLK
ADDG_RAT        ------LASLYRLADLFGWAHLANTYISVRSKEQDHIIIIPRGLPFSEATASALVKVNIIGEVVDSTNLK
ADDB_RAT        --MRCKISSVYRLLDLYGWAQLSDTYVTLRSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSFP
ADDB_MOUSE      --MRCKISSVYRLLDLYGWAQLSDTYVTLRSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSFP
ADDB_PONAB      --MRCKISSVYRLLDLYGWAQLSDTYVTLRSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSFP
ADDB_HUMAN      --MRCKISSVYRLLDLYGWAQLSDTYVTLRSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSFP
HTS_DROME       --LRCKLAATFRLLDLYGWTQGLGAQITARLKDQEYFLVNPYGLLYHEITASALNKVDMQGQIVEQGTTN
ADD1_CAEEL      ------LACLFRLADLFQWSQGIHNEISYRTNDEDNTFLMPFGLLYHEITAATIVKIDENGKILDCGTLK
MUG14_SCHPO     -----HMAAAFRMFGRNGYNEGTAGHVTVRPIDENTFWINPLEVPFSLMKPSDLVHINSDGEIIGGSKMK
FUCA_HAEIN      -------------MTKLGLNQGTAGNVSVRYKDGML--ITPTGMPYHLMKTENIVYVDGNGK---HEENK
FUCA_METMP      -------------------------NVSIRDGNLI--YITPTGLSLGFLTKEDICIADLNGNIIKGKP--
FUCA_METM5      -------------------------------KNKNLIYITPTGSILGFLNEEDICVADIEGNILKGKP--
FUCA_METM7      -------------------------NVSIRDGNHI--YITPTGSILGFLNEEDVCIVDLNGNIIKGKP--
FUCA_METVS      -------------------------NVSLKKDNLV--YITPTGSILGFLNEEDICVVDIAGKIIKGKP--
FUCA_ECOL6      -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
FUCA_ECO57      -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
FUCA_SHIFL      -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
FUCA_ECOLI      -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
FUCA_METJA      -------------------------------------YLTPTGSILGFLKEDDIAEMDLDGNVIKGKPTS
FUCA_META3      -------------------------------------YVTPTDSLLGFINEEDIAVVDMDGNIIKGAP--
MTNB_AQUAE      -----------------------------------------------KLTPEDILLIDYEGRPVGGGKPS
YGBL_ECOLI      ----------------------------------------PTGSCLGNLDPQRLSKVAADGEWLSGDKPS
ARAD_BACSU      ------------LAANLKLQEHTWGNVSGIDREKERIVIKPSGVEYSDLTADDLVVLNLDGEVVEGSLKP
ULAF_ECO24      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
Y1012_HAEIN     --------------------------------------VTPTGSSLGRLSVERLSVLDMEGNLLGGDKP-
ULAF_SHIB3      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGKYRP
ULAF_ECOL5      --LKQQVFEANMDLPHYGLVTFTWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGNVVEGEYRP
ULAF_SHISS      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
ULAF_SHIFL      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
ULAF_SHIF8      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
ULAF_SHIDS      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
ULAF_ECOL6      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
ULAF_ECOHS      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
ULAF_ECO5E      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
ULAF_ECO57      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
ULAF_ECO55      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
ULAF_ECO81      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGNVVEGEYRP
ULAF_ECO7I      ----------------------TWGNVSAIDRERGLVVIKPSGIAYESMKAADMVVVDMSGKVVEGEYRP
ULAF_ECOK1      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGNVVEGEYRP
ULAF_ECO45      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGNVVEGEYRP
ULAF_ECOSM      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKAADMVVVDMSGKVVEGEYRP
ULAF_ECOLC      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKAADMVVVDMSGKVVEGEYRP
ULAF_SHIBS      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGKYRP
ULAF_ESCF3      ----------------------TWGNVSAIDRERGLVVIKPSGIAYESMKANDMVVVDMSGKVVEGEYRP
ULAF_ECOSE      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
MTNB_METCA      ---------------------------------------------------EDIMLVDAAGRSLDGRKPS
ULAF_ECOLI      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKAADMVVVDMSGKVVEGEYRP
ULAF_ECODH      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKAADMVVVDMSGKVVEGEYRP
ULAF_ECOBW      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKAADMVVVDMSGKVVEGEYRP
ARAD_ECOLI      -DLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSGVDYSVMTADDMVVVSIEGEVVEGTKKP
ULAF_ECOLU      ----------------------TWGNVSTIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRP
ARAD_BACST      ----------YRLVTF------TWGNVSGIDRERGLVVIKPSGVAYDKLTIDDMVVVDLTGNVVEGDLKP
ULAF_ECO8A      ----------------------TWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGAYRP
MTNB_GLUDA      ------------------------------------------------LTADGVIEVTADGRAVRAGDRP
MTNB_ENT38      -------------------------------QNDAFCWLSESGKDKGSLTIDDFLQVDIASNRAPSGRKP
MTNB_CITK8      -------------------------NMSVRQDDA-FCWLSESGKDKGNLTTDDFLQVEIATSHAPSGRKP
MTNB_XYLFT      ---------------------------------------------------EDIMAVDLDGNAVGHPHTP
MTNB_XYLFA      ------------------------------------------------LTEEDIMAVDLEGNAVGHPHTP
MTNB_XYLF2      ---------------------------------------------------EDIMAVDLDGNAVGHPHTP
MTNB_PSEPF      ---------------------------------------------------DDVLATDLSGNSLEPGKKP
MTNB_KLEP7      ------------------------------------------------LTTEDFLQVEIATNQAPSGRKP
MTNB_KLEP3      ------------------------------------------------LTTEDFLQVEIATNQAPSGRKP
MTNB_XYLFM      ---------------------------------------------------EDIIAVDLDGNAVGHPHTP


                         .         .         *         .         .         .         .:140
query           YNKTGYFIHGSIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHFYDRISYHNYNSLVLDADKQS
Y493_RICPR      YNKTGYFIHGNIYKARPDVLAIFHYHTPASTAVSALKCGLLPISQWALHFYDRISYHDYNSLVLDADKQS
Y1201_CAUCR     INPAGFTIHSAVHAAREDAHYVMHLHSDQGVAVSAHKEGLLPLTQHSLIVLPQLAYHDYEGIALNLEER-
ADD2_CAEEL      FNQAGYVLHSAIHNGRPEVKCVVHLHHPSVVAVSAQKCGLLPISQESMIVGD-VGYHEYRGILID-EAER
ADDA_MOUSE      VNQAGFTLHSAVYAARPDAKCIVHIHTPAGAAVSAMKCGLLPISPEALSLGD-VAYHDYHGILVDEEEKI
ADDA_PONAB      VNQAGFTLHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSL-GEVAYHDYHGILVDEEEKV
ADDA_HUMAN      VNQAGFTLHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSL-GEVAYHDYHGILVDEEEKV
ADDA_RAT        VNQAGFTLHSAIYAARPDAKCIVHIHTPAGAAVSAMKCGLLPISPEALSL-GEVAYHDYHGILVDEEEKI
Y3430_PSEAE     INPAGYTIHSAVHEVRHDVECVLHTHTAAGIAVSCQKQGXXXXXXXXXXXXXXXXYHAYEGVALN-HEEK
ADDH_SCHPO      INRAGYVIHSAIHRARPDVKSIMHNHYPYAAGVSCVKHGFLELAQTS-HQSGPVTYHDYHGIVVDKGEQK
ADDG_HUMAN      IDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLLLGD-VAYYDYQGSLEEQEERI
ADDG_MOUSE      IDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLILGD-VAYYDYQG-SLDEEEER
ADDG_RAT        IDHSGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLILGD-VAYYDYQG-SLDEEEER
ADDB_RAT        VDTTGFSLHSAIYAARPDVRCAIHLHTPATAAVSAMKCGLLPVSHNALLVGD-MAYYDFNG---EMEQEA
ADDB_MOUSE      VDTTGFSLHSAIYAARPDVRCAIHLHTPATAAVSAMKCGLLPVSHNALLVGD-MAYYDFNG---EMEQEA
ADDB_PONAB      VDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNALLVGD-MAYYDFNG---EMEQEA
ADDB_HUMAN      VDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNALLVGD-MAYYDFNG---EMEQEA
HTS_DROME       FNKSHFVLHSVVHAARPDIRCAIYIGCSPVVAISSLKTGLLPLTKDAC-VLGEITTHAYTGLF--DEEER
ADD1_CAEEL      VNQPAFLLHSAIYKAHPMVRCILHMHTAIVAAVASMKCGLLPLCKEAM-VLGPVGYHDYQD-IGDDDIQF
MUG14_SCHPO     YNTSGFAIHYEMHKVRPEVICVCHVHSIYGKAFSALGKPLDMLNTDCCVFYNNHGIYFDMDDVISMPEEG
FUCA_HAEIN      LPSSEWQFHLSVYHTRPEANAVVHNHSIHCAGLSILE---KPIP--AIHYMVAVSGTDHIPCVFGSHKLA
FUCA_METMP      --TSELNMHLKIYQNKDSINAVVHTHSMYCTAFSALDKKLKLVTPEAEMVVKKIAYVDYFPCSLELAENV
FUCA_METM5      --TSELNMHLKIYQNKESINAIVHTHSMYCTAFSALDKKLELLTPEAEIFIKKIAYVDYFPCSLELAENV
FUCA_METM7      --TSELNMHLKIYQNKDCVNAIVHTHSMYCTAFSALDKKLELFTPEAEIVVKKIAYVDYSPCSLELAENV
FUCA_METVS      --TSELNMHLEIYRNKPHVNAVVHTHSMYCTAFSVLDKKLELYTPEAEIFLKKIGYVDYCPC---GTLEL
FUCA_ECOL6      LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILN---RPIP--AIHY--MIAAAGGNSITFGTRELS
FUCA_ECO57      LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILN---RPIP--AIHY--MIAAAGGNSITFGTRELS
FUCA_SHIFL      LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
FUCA_ECOLI      LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
FUCA_METJA      EKN----LHLMIYRKRNDINAIIHTHSLISTFLSTINKEIELLTPEGKIFLKKIGYVDY----YEAGSLK
FUCA_META3      --TSELYMHLNIYKKRNGVNAIVHTHSLYSTALPMADKEIKLLTPESRIFLKKIGYVDY------FEARS
MTNB_AQUAE      AET---LLHTTVYKLFPEVNAVVHTHSPNATVISIVKKDFVELEDYELAFPDIHTHEVKIKIPIFPNEQN
YGBL_ECOLI      KE---VLFHLALYRNNPRCKAVVHLHSTWSTALSCLQ-GLRPFTPYVVMRMGNVPLVPYYR---PGDKRI
ARAD_BACSU      SSDTP--THVYLYKAFPNIGGIVHTHSQWATSWAQSGRDIPPLGTTHADYFDREMYD--EEIIHDYELNT
ULAF_ECO24      SSDTA--THLELYRRYPSLGGIVHTHSTHATAWAQAGLAIPALTTHADYFFGDIPYTSEEEVQGEYELNT
Y1012_HAEIN     -SKEAVF-HLAMYKKNPECKAIVHLHSTYLTALSCLD-NLDPIEPFTPYYVMRIPYYRPGSPKI-AEELS
ULAF_SHIB3      SSDTA--THLELYRRYPSLGGIVHTHSPAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGDA
ULAF_ECOL5      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGDA
ULAF_SHISS      SSDTATYL--ELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGDA
ULAF_SHIFL      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_SHIF8      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_SHIDS      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_ECOL6      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGDA
ULAF_ECOHS      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_ECO5E      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_ECO57      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_ECO55      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_ECO81      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGDA
ULAF_ECO7I      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_ECOK1      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSKEEVQGEYENTGKVIIETLGDA
ULAF_ECO45      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSKEEVQGEYENTGKVIIETLGDA
ULAF_ECOSM      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGDA
ULAF_ECOLC      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_SHIBS      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGDA
ULAF_ESCF3      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGDA
ULAF_ECOSE      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
MTNB_METCA      AET---LLHTGIYRRYPEAHAVLHPHSPASTLLSRLVSGAVILEDYLLKALAGIDTHATRIVVFPNDQDI
ULAF_ECOLI      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_ECODH      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ULAF_ECOBW      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ARAD_ECOLI      SSDTP--THRLLYQAFPSIGGIVHTHSHATIWAQAGQSIPATGTTHADYFYGTIEWETGNVIVETFEKQG
ULAF_ECOLU      SSDTA--THLELYRRYPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
ARAD_BACST      SSDTP--THLWLYKQFPGIGGIVHTHSTWATVWAQAGKGIPALTTHADYFYGEITRPMTNEEIQGAELET
ULAF_ECO8A      SSDTA--THLELYRRCPSLGGIVHTHSQAGLAIPALGTGDIPCTRGLSEEEVQGEYENTGKVIIETLGNA
MTNB_GLUDA      SAET--LLHCHVYEASPDVGAVLHGHSVASTVLSMMEQGILLSGYEVLKVFEGQQTHDVRLPVFDNDQDI
MTNB_ENT38      SAETG--LHTLIYRLFPEANAVLHVHTVNATVLSRLKETELRISGFEMQHLDTVTIPVFDN-DQDIDALA
MTNB_CITK8      SAETG--LHTLIYHLFPQANAVLHVHTANATVLSRIKTPELYISGFEMQHLDTVCVPVFDN-DQDIDALA
MTNB_XYLFT      SAET--LLHTQLYRRFPEIGCVLHTHSLTQTVASRVYAGAGHISLKDYELLKAFAGHSTHETTLDCNTQN
MTNB_XYLFA      SAET--LLHTQLYRRFPEIGCVLHTHSLTQTVASRVYAGAGHISLKDYELLKAFEGHSTHETTLDCNTQN
MTNB_XYLF2      SAET--LLHTQLYRRFPEIGCVLHTHSLTQTVASRVYAGAGHISLKDYELLKAFAGHSTHETTLDCNTQN
MTNB_PSEPF      SAET--LLHTQLYSWRPEIGAVLHTHSVNATVLSRLPQDFIEFEDYELQAFSGVSTHESRVRVFDNDQDI
MTNB_KLEP7      SAETG--LHTLVYRLFPEANVVLHVHTVNATVLSRIKSDTLALQGYEMQKTLSGQHSHLDTVIFDNDQDI
MTNB_KLEP3      SAETG--LHTLVYRLFPEANVVLHVHTVNATVLSRIKSDTLALQGYEMQKTLSGQHSHLDTVIFDNDQDI
MTNB_XYLFM      SAET--LLHTQLYRRFPEIGCVLHTHSLTQTVASRVYAGAGHISLKDYELLKAFEGHSTHETTLDCNTQN


                         +         .         .         .         .         *         .:210
query           SRLVTDLKQNYVMLLRNHGAITCGKTIHEAMFYTYHLEQACKTQCLLNSTKEQELIIPSVEICKQTVKDL
Y493_RICPR      TKFVNDLKQNYVMLLRNHGAITCGKTIHEAMFYTYHLEQACKTQCLLNSTIQQELIIPSVEICKKTVKDL
Y1201_CAUCR     ERIVADLGQKKLLMLRNHGTLSVGATAAECWLGMFFLERACAQQVMLSIGRDNVLLAPEAEVRKQ-----
ADD2_CAEEL      ALLVRDLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQ--------------------------
ADDA_MOUSE      LIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQ--------------------------
ADDA_PONAB      LIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQ--------------------------
ADDA_HUMAN      LIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQ--------------------------
ADDA_RAT        LIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQ--------------------------
Y3430_PSEAE     ARLQADLGASNFLILPNHGLLTCGGSIADTFLMMFTLQRACEVQVMAQSGGAELIHIP------------
ADDH_SCHPO      S-LAEDIANKDILILRNHGIITAAESVGAAYYLMYQFLAATEIQTHASANDMNNLFIPNNKLVEKT----
ADDG_HUMAN      QLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYIFNVQLACEIQ--------------------------
ADDG_MOUSE      IELQKVLGPSKVLVLRNHGMVALGETLEEAFHYIFNVQMACEIQ--------------------------
ADDG_RAT        IELQKVLGPSKVLVLRNHGVVALGETLEEAFHYIFNVQMACEIQ--------------------------
ADDB_RAT        DRI--NLQKCLILVLRNHGMVALGDTVEEAFYKVFHLQAACEVQ--------------------------
ADDB_MOUSE      DRI--NLQKCLILVLRNHGMVALGDTVEEAFYKVFHLQAACEVQ--------------------------
ADDB_PONAB      DRI--NLQKCLILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQ--------------------------
ADDB_HUMAN      DRI--NLQKCLILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQ--------------------------
HTS_DROME       NRLVRSLGPNSVILLTNHGALCCGETIEEAFFAACHIVQACETQLKL-----------------------
ADD1_CAEEL      DEIIANLGDKNVLFLRNQGFLVVGDTIEHATFLANNTVIACETQVRAARAGLDNLIIPEEKAIQRSLKRN
MUG14_SCHPO     RRTAKGLADYKAVLVQNHGIMTVGTTVDEAAYLLSLMERSCQIQLLIDS---------------------
FUCA_HAEIN      SYVATGIKESKAILLAHHGLITCGENLDKALWLAQEVEVLASWYLKLLST--------------------
FUCA_METMP      SECIEDS-----IILKNHGIVTLGKDITEAYIKTEVLEEVAQLNYIMNNLK-------------------
FUCA_METM5      SACVEDS-----IILKNHGIVTLGKDITEAYVKTEVLEEIAQLNYIMNNLGE------------------
FUCA_METM7      SSCVEDS-----IILKNHGIVTVGKDITEAYVKTEVLEEIAQLNYIINNLK-------------------
FUCA_METVS      AECVSSCNED-VLILKKHGIVTLGSTLTEAYIKTEVLEEIAKLNHIVMS---------------------
FUCA_ECOL6      EHVALALKNRKATLLQHHGLIACEANLEKALWLAHEVE--------------------------------
FUCA_ECO57      EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
FUCA_SHIFL      EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
FUCA_ECOLI      EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
FUCA_METJA      LAEETAKRDEDVIILKNHGVVCLGKDLIDAYIKVEVLEEQAKLTLL------------------------
FUCA_META3      MELANEVKDEDVIVLKNHGIVCVGKNLMDAYLKTEVMEEISQLNYIIHS---------------------
MTNB_AQUAE      IPLLAKEVENYFFLIRGHGLYTWGRSMEEALIHTEALE--------------------------------
YGBL_ECOLI      AQDLAELADNQAFLLANHGPVVCGESLQEAANNMEELEETAK----------------------------
ARAD_BACSU      GKVIAETFQHHGVLVNNHGPFCWGNAIHNAV---------------------------------------
ULAF_ECO24      GKVIIETLGNAEIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
Y1012_HAEIN     NRALT----GKAFLLANHGVVVTGSDLLDAADNTEELEETAKLFFTLQGQK-------------------
ULAF_SHIB3      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECOL5      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_SHISS      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_SHIFL      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_SHIF8      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_SHIDS      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECOL6      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECOHS      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECO5E      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECO57      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECO55      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECO81      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECO7I      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECOK1      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECO45      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECOSM      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ECOLC      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_SHIBS      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQ-----------------
ULAF_ESCF3      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAK----------------------------
ULAF_ECOSE      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAK----------------------------
MTNB_METCA      PRLALKIEEYLVYIIAGHGFYTWGKSVADALRHVEALEYLFDLETRMHGVK-------------------
ULAF_ECOLI      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAK----------------------------
ULAF_ECODH      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAK----------------------------
ULAF_ECOBW      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAK----------------------------
ARAD_ECOLI      ----IDAAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEE-------------------------------
ULAF_ECOLU      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAK----------------------------
ARAD_BACST      GKVITDPLQMPGVLVHGHGPFAWGKDPANAVHNAVVLEEVAK----------------------------
ULAF_ECO8A      EPLHTP-----GIVVYQHGPFAWGKDAHDAVHNAVVMEEVAK----------------------------
MTNB_GLUDA      ARLLGRMPAGYV--IRGHGVYVWGGTMDVAL---------------------------------------
MTNB_ENT38      SRIAHYAQENYGFLLRGHGLTCWGRDVAEARRHLEGLE--------------------------------
MTNB_CITK8      SRIAHYAQENYGFLLRGHGLTCWGRSVEEARRHLEGLE--------------------------------
MTNB_XYLFT      MNILADKQRMWGYLINGHGMYTWGNTLADA----------------------------------------
MTNB_XYLFA      MNILADKQRMWGYLINGHGMYTWGNTLADA----------------------------------------
MTNB_XYLF2      MNILADKQRMWGYLINGHGMYTWGNTLADA----------------------------------------
MTNB_PSEPF      ARLAAKVQDCVGYLIRGHGLYTWGAQMSDALAFEFLFECELKTRSVMN----------------------
MTNB_KLEP7      DALIADYAQRYGFLLRGHGLTCWGKDIQEA----------------------------------------
MTNB_KLEP3      DALIADYAQRYGFLLRGHGLTCWGKDIQEA----------------------------------------
MTNB_XYLFM      MNILADKQRMWGYLINGHGMYTWGNTLADA----------------------------------------


                         .         .         .         +         .         .         .:280
query           LSFEEDLGKRDWAAWLRLVKM
Y493_RICPR      LSFEEDLGKRDWEAWLRLINM
Y1201_CAUCR     ---------------------
ADD2_CAEEL      ---------------------
ADDA_MOUSE      ---------------------
ADDA_PONAB      ---------------------
ADDA_HUMAN      ---------------------
ADDA_RAT        ---------------------
Y3430_PSEAE     ---------------------
ADDH_SCHPO      ---------------------
ADDG_HUMAN      ---------------------
ADDG_MOUSE      ---------------------
ADDG_RAT        ---------------------
ADDB_RAT        ---------------------
ADDB_MOUSE      ---------------------
ADDB_PONAB      ---------------------
ADDB_HUMAN      ---------------------
HTS_DROME       ---------------------
ADD1_CAEEL      GTVDWRVGELEWESWMRVL--
MUG14_SCHPO     ---------------------
FUCA_HAEIN      ---------------------
FUCA_METMP      ---------------------
FUCA_METM5      ---------------------
FUCA_METM7      ---------------------
FUCA_METVS      ---------------------
FUCA_ECOL6      ---------------------
FUCA_ECO57      ---------------------
FUCA_SHIFL      ---------------------
FUCA_ECOLI      ---------------------
FUCA_METJA      ---------------------
FUCA_META3      ---------------------
MTNB_AQUAE      ---------------------
YGBL_ECOLI      ---------------------
ARAD_BACSU      ---------------------
ULAF_ECO24      ---------------------
Y1012_HAEIN     ---------------------
ULAF_SHIB3      ---------------------
ULAF_ECOL5      ---------------------
ULAF_SHISS      ---------------------
ULAF_SHIFL      ---------------------
ULAF_SHIF8      ---------------------
ULAF_SHIDS      ---------------------
ULAF_ECOL6      ---------------------
ULAF_ECOHS      ---------------------
ULAF_ECO5E      ---------------------
ULAF_ECO57      ---------------------
ULAF_ECO55      ---------------------
ULAF_ECO81      ---------------------
ULAF_ECO7I      ---------------------
ULAF_ECOK1      ---------------------
ULAF_ECO45      ---------------------
ULAF_ECOSM      ---------------------
ULAF_ECOLC      ---------------------
ULAF_SHIBS      ---------------------
ULAF_ESCF3      ---------------------
ULAF_ECOSE      ---------------------
MTNB_METCA      ---------------------
ULAF_ECOLI      ---------------------
ULAF_ECODH      ---------------------
ULAF_ECOBW      ---------------------
ARAD_ECOLI      ---------------------
ULAF_ECOLU      ---------------------
ARAD_BACST      ---------------------
ULAF_ECO8A      ---------------------
MTNB_GLUDA      ---------------------
MTNB_ENT38      ---------------------
MTNB_CITK8      ---------------------
MTNB_XYLFT      ---------------------
MTNB_XYLFA      ---------------------
MTNB_XYLF2      ---------------------
MTNB_PSEPF      ---------------------
MTNB_KLEP7      ---------------------
MTNB_KLEP3      ---------------------
MTNB_XYLFM      ---------------------