[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL03659.1

[Show Plain Result]


## Summary of Sequence Search
    1::82
  150::204     9e-07  45%  670 aa  LRC45_CHICK RecName: Full=Leucine-rich repeat-containing protein
  150::204     2e-06  42%  670 aa  LRC45_MOUSE RecName: Full=Leucine-rich repeat-containing protein
  150::202     4e-06  40%  670 aa  LRC45_HUMAN RecName: Full=Leucine-rich repeat-containing protein
  920::975     6e-06  41% 1064 aa  NLRC3_MOUSE RecName: Full=Protein NLRC3;
  673::728     7e-06  43% 1065 aa  NLRC3_HUMAN RecName: Full=Protein NLRC3;AltName:
   21::71      5e-05  35%  456 aa  RINI_PIG RecName: Full=Ribonuclease inhibitor;AltName:
  843::898     1e-04  36%  953 aa  NOD1_MOUSE RecName: Full=Nucleotide-binding oligomerization
  847::892     3e-04  43% 1062 aa  NALP2_HUMAN RecName: Full=NACHT, LRR and PYD domains-containing
  825::870     5e-04  41%  980 aa  NALP7_HUMAN RecName: Full=NACHT, LRR and PYD domains-containing
  841::896     9e-04  33% 2800 aa  ROCO5_DICDI RecName: Full=Probable serine/threonine-protein kinase
  211::266     9e-04  47%  559 aa  CA092_HUMAN RecName: Full=Leucine-rich repeat-containing protein
    1::82

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxNWHKILSESTTSDLSNKNITDEQAKDLAAALKANRSLTSLYLPWNNIGEATFKIINEYLYR
LRC45_CHICK     ---------------------DLRNNQINHHGAGELAMALKRNASLQELDLRWNNIGLLGGRALLNCLQS
LRC45_MOUSE     ---------------------DLRNNQISHKGAEELALALKGNTTLQQLDLRWNNIGLLGGRALVNCLPS
LRC45_HUMAN     ---------------------DLRNNQISHKGAEELALALKGNTTLQQLDLRWNNVGLLGGRALMNCLPS
NLRC3_MOUSE     ------------------TTLDLQENAIGDEGASSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTV
NLRC3_HUMAN     ----------------------LAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKI
RINI_PIG        -------------LLQQYEVVRLDDCGLTEEHCKDIGSALRANPSLTELCLRTNELGDAGVHLV------
NOD1_MOUSE      ------------------TTLSLAFNGISPEGGKSLAQALKQNTTLTVIWLTKNELNDESAECFAEMLRV
NALP2_HUMAN     ----------------------LENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGL--
NALP7_HUMAN     ----------------------LENCRLTEASCKDLAAVLVVSKKLTHLCLAKNPIGDTGVKFLCEGL--
ROCO5_DICDI     ----------------------LTQNQITDTGAKHISKLLKFNQTLNALFLEDNNITQSMAEIIDQWVSC
CA092_HUMAN     ---------SYHKLMADSTIAHLSNNNIDDRGAQLLGQALSTNRTLVSLNLGFNHIGD------------


                         .         .         *         .         .         .         .:140
query           NKTITKKSxxxx
LRC45_CHICK     NKTLKK------
LRC45_MOUSE     NRTLWK------
LRC45_HUMAN     NRTL--------
NLRC3_MOUSE     NRTL--------
NLRC3_HUMAN     NRTLTSLS----
RINI_PIG        ------------
NOD1_MOUSE      NQTL--------
NALP2_HUMAN     ------------
NALP7_HUMAN     ------------
ROCO5_DICDI     HSTVLSR-----
CA092_HUMAN     ------------