[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL03713.1

[Show Plain Result]


## Summary of Sequence Search
    1::445
    1::445       0.0 100%  445 aa  MNME_RICCN RecName: Full=tRNA modification GTPase mnmE;       
    1::445       0.0 100%  445 aa  MNME_RICRS RecName: Full=tRNA modification GTPase mnmE;       
    1::445       0.0 100%  445 aa  MNME_RICRO RecName: Full=tRNA modification GTPase mnmE;       
    1::445       0.0  98%  445 aa  MNME_RICM5 RecName: Full=tRNA modification GTPase mnmE;       
    1::445       0.0  87%  445 aa  MNME_RICAH RecName: Full=tRNA modification GTPase mnmE;       
    1::480       0.0  92%  480 aa  MNME_RICFE RecName: Full=tRNA modification GTPase mnmE;       
    1::445       0.0  88%  445 aa  MNME_RICCK RecName: Full=tRNA modification GTPase mnmE;       
    1::445       0.0  84%  445 aa  MNME_RICPR RecName: Full=tRNA modification GTPase mnmE;       
    1::445       0.0  86%  445 aa  MNME_RICTY RecName: Full=tRNA modification GTPase mnmE;       
    1::445       0.0  81%  445 aa  MNME_RICBR RecName: Full=tRNA modification GTPase mnmE;       
    1::445       0.0  81%  445 aa  MNME_RICB8 RecName: Full=tRNA modification GTPase mnmE;       
    4::447     e-124  54%  447 aa  MNME_ORITB RecName: Full=tRNA modification GTPase mnmE;       
    6::442     e-107  51%  442 aa  MNME_WOLWR RecName: Full=tRNA modification GTPase mnmE;       
    6::442     e-105  50%  442 aa  MNME_WOLPP RecName: Full=tRNA modification GTPase mnmE;       
    6::442     e-103  49%  442 aa  MNME_WOLTR RecName: Full=tRNA modification GTPase mnmE;       
    7::445     5e-96  46%  445 aa  MNME_ANAPZ RecName: Full=tRNA modification GTPase mnmE;       
    2::443     8e-96  44%  443 aa  MNME_PELUB RecName: Full=tRNA modification GTPase mnmE;       
    1::439     4e-95  46%  439 aa  MNME_EHRRG RecName: Full=tRNA modification GTPase mnmE;       
    5::443     3e-94  45%  443 aa  MNME_ANAMM RecName: Full=tRNA modification GTPase mnmE;       
    1::439     1e-93  48%  439 aa  MNME_EHRRW RecName: Full=tRNA modification GTPase mnmE;       
    1::439     4e-93  45%  439 aa  MNME_EHRCR RecName: Full=tRNA modification GTPase mnmE;       
    3::441     1e-92  45%  441 aa  MNME_EHRCJ RecName: Full=tRNA modification GTPase mnmE;       
    6::508     3e-85  53%  508 aa  MNME_WOLPM RecName: Full=tRNA modification GTPase mnmE;       
    6::442     1e-84  41%  442 aa  MNME_AGRT5 RecName: Full=tRNA modification GTPase mnmE;       
    1::438     9e-84  41%  438 aa  MNME_PARL1 RecName: Full=tRNA modification GTPase mnmE;       
    1::550     1e-82  48%  550 aa  MNME_NEOSM RecName: Full=tRNA modification GTPase mnmE;       
    9::442     8e-80  41%  442 aa  MNME_OCHA4 RecName: Full=tRNA modification GTPase mnmE;       
   35::500     7e-79  41%  500 aa  GTPB3_DANRE RecName: Full=tRNA modification GTPase GTPBP3,
    3::441     2e-77  39%  441 aa  MNME_MAGSA RecName: Full=tRNA modification GTPase mnmE;       
    9::442     2e-75  41%  442 aa  MNME_BRUC2 RecName: Full=tRNA modification GTPase mnmE;       
    5::459     5e-75  40%  459 aa  MNME_CLOAB RecName: Full=tRNA modification GTPase mnmE;       
    9::442     5e-75  41%  442 aa  MNME_BRUSU RecName: Full=tRNA modification GTPase mnmE;       
    9::442     5e-75  41%  442 aa  MNME_BRUO2 RecName: Full=tRNA modification GTPase mnmE;       
    9::442     5e-75  41%  442 aa  MNME_BRUME RecName: Full=tRNA modification GTPase mnmE;       
   18::451     6e-75  39%  451 aa  MNME_BEII9 RecName: Full=tRNA modification GTPase mnmE;       
    9::442     1e-74  41%  442 aa  MNME_BRUAB RecName: Full=tRNA modification GTPase mnmE;       
    9::442     1e-74  41%  442 aa  MNME_BRUA2 RecName: Full=tRNA modification GTPase mnmE;       
    1::435     1e-74  40%  435 aa  MNME_BART1 RecName: Full=tRNA modification GTPase mnmE;       
    4::437     2e-74  41%  437 aa  MNME_RHIEC RecName: Full=tRNA modification GTPase mnmE;       
    9::442     2e-74  41%  442 aa  MNME_BRUSI RecName: Full=tRNA modification GTPase mnmE;       
    7::457     3e-74  40%  457 aa  MNME_STRR6 RecName: Full=tRNA modification GTPase mnmE;       
    7::457     3e-74  40%  457 aa  MNME_STRP2 RecName: Full=tRNA modification GTPase mnmE;       
    7::457     4e-74  39%  457 aa  MNME_STRPN RecName: Full=tRNA modification GTPase mnmE;       
    7::457     7e-74  40%  457 aa  MNME_STRPI RecName: Full=tRNA modification GTPase mnmE;       
    6::449     3e-73  38%  449 aa  MNME_RHOPB RecName: Full=tRNA modification GTPase mnmE;       
    4::438     3e-73  40%  438 aa  MNME_MARMM RecName: Full=tRNA modification GTPase mnmE;       
    7::457     4e-73  37%  457 aa  MNME_STRGC RecName: Full=tRNA modification GTPase mnmE;       
    1::435     4e-73  39%  435 aa  MNME_BARHE RecName: Full=tRNA modification GTPase mnmE;       
    5::459     2e-72  37%  459 aa  MNME_CLONN RecName: Full=tRNA modification GTPase mnmE;       
    9::442     3e-72  39%  442 aa  MNME_MESSB RecName: Full=tRNA modification GTPase mnmE;       
    1::436     4e-72  38%  436 aa  MNME_BARQU RecName: Full=tRNA modification GTPase mnmE;       
    7::457     6e-72  37%  457 aa  MNME_STRSV RecName: Full=tRNA modification GTPase mnmE;       
   26::512     2e-71  43%  512 aa  GTPB3_DICDI RecName: Full=tRNA modification GTPase gtpbp3,
    5::459     3e-71  40%  459 aa  MNME_CLOTH RecName: Full=tRNA modification GTPase mnmE;       
    5::439     9e-71  38%  439 aa  MNME_RHIME RecName: Full=tRNA modification GTPase mnmE;       
    1::429     1e-70  42%  429 aa  MNME_DINSH RecName: Full=tRNA modification GTPase mnmE;       
    4::461     2e-70  38%  461 aa  MNME_CARHZ RecName: Full=tRNA modification GTPase mnmE;       
    3::452     3e-70  35%  452 aa  MNME_HAEDU RecName: Full=tRNA modification GTPase mnmE;       
    8::458     6e-70  38%  458 aa  MNME_STRP1 RecName: Full=tRNA modification GTPase mnmE;       
    8::458     8e-70  38%  458 aa  MNME_STRPD RecName: Full=tRNA modification GTPase mnmE;       
    8::458     8e-70  38%  458 aa  MNME_STRP8 RecName: Full=tRNA modification GTPase mnmE;       
   15::437     8e-70  41%  437 aa  MNME_GLUOX RecName: Full=tRNA modification GTPase mnmE;       
    8::458     1e-69  38%  458 aa  MNME_STRPG RecName: Full=tRNA modification GTPase mnmE;       
    6::439     1e-69  38%  439 aa  MNME_RHIE6 RecName: Full=tRNA modification GTPase mnmE;       
    1::428     1e-69  42%  428 aa  MNME_ROSDO RecName: Full=tRNA modification GTPase mnmE;       
    3::452     1e-69  36%  452 aa  MNME_HAEIG RecName: Full=tRNA modification GTPase mnmE;       
    8::458     2e-69  37%  458 aa  MNME_STRP6 RecName: Full=tRNA modification GTPase mnmE;       
    4::458     2e-69  39%  458 aa  MNME_NATTJ RecName: Full=tRNA modification GTPase mnmE;       
    8::458     2e-69  37%  458 aa  MNME_STRP3 RecName: Full=tRNA modification GTPase mnmE;       
    3::452     2e-69  35%  452 aa  MNME_ACTPJ RecName: Full=tRNA modification GTPase mnmE;       
    1::428     3e-69  39%  428 aa  MNME_RHOS4 RecName: Full=tRNA modification GTPase mnmE;       
    3::452     3e-69  36%  452 aa  MNME_HAEIE RecName: Full=tRNA modification GTPase mnmE;       
   35::492     4e-69  42%  492 aa  GTPB3_HUMAN RecName: Full=tRNA modification GTPase GTPBP3,
    7::457     5e-69  36%  457 aa  MNME_STRSY RecName: Full=tRNA modification GTPase mnmE;       
    7::457     5e-69  36%  457 aa  MNME_STRS2 RecName: Full=tRNA modification GTPase mnmE;       
    3::452     5e-69  35%  452 aa  MNME_ACTP2 RecName: Full=tRNA modification GTPase mnmE;       
    6::441     7e-69  39%  441 aa  MNME_RHOPT RecName: Full=tRNA modification GTPase mnmE;       
    6::441     7e-69  39%  441 aa  MNME_RHOPA RecName: Full=tRNA modification GTPase mnmE;       
    8::458     9e-69  38%  458 aa  MNME_STRPM RecName: Full=tRNA modification GTPase mnmE;       
    1::428     9e-69  39%  428 aa  MNME_RHOS1 RecName: Full=tRNA modification GTPase mnmE;       
    8::458     1e-68  38%  458 aa  MNME_STRPC RecName: Full=tRNA modification GTPase mnmE;       
    8::458     1e-68  38%  458 aa  MNME_STRPF RecName: Full=tRNA modification GTPase mnmE;       
    3::448     1e-68  37%  448 aa  MNME_AQUAE RecName: Full=tRNA modification GTPase mnmE;       
    1::435     2e-68  37%  435 aa  MNME_BARBK RecName: Full=tRNA modification GTPase mnmE;       
    4::460     3e-68  36%  460 aa  MNME_THETN RecName: Full=tRNA modification GTPase mnmE;       
    4::460     3e-68  35%  460 aa  MNME_THEP3 RecName: Full=tRNA modification GTPase mnmE;       
    3::452     3e-68  35%  452 aa  MNME_HAEI8 RecName: Full=tRNA modification GTPase mnmE;       
    3::452     6e-68  35%  452 aa  MNME_HAEIN RecName: Full=tRNA modification GTPase mnmE;       
    3::452     7e-68  36%  452 aa  MNME_PASMU RecName: Full=tRNA modification GTPase mnmE;       
    1::426     7e-68  39%  426 aa  MNME_JANSC RecName: Full=tRNA modification GTPase mnmE;       
    4::460     9e-68  35%  460 aa  MNME_THEPX RecName: Full=tRNA modification GTPase mnmE;       
    5::440     1e-67  37%  440 aa  MNME_SINMW RecName: Full=tRNA modification GTPase mnmE;       
   59::441     5e-67  40%  441 aa  MNME_HYPNA RecName: Full=tRNA modification GTPase mnmE;       
    6::460     6e-67  40%  460 aa  MNME_RHOPS RecName: Full=tRNA modification GTPase mnmE;       
   60::439     6e-67  40%  439 aa  MNME_RHIL3 RecName: Full=tRNA modification GTPase mnmE;       
    4::458     6e-67  35%  458 aa  MNME_BACCN RecName: Full=tRNA modification GTPase mnmE;       
    5::454     8e-67  35%  454 aa  MNME_MANSM RecName: Full=tRNA modification GTPase mnmE;       
   56::440     1e-66  39%  440 aa  MNME_GRABC RecName: Full=tRNA modification GTPase mnmE;       
   15::461     1e-66  39%  461 aa  MNME_ALKOO RecName: Full=tRNA modification GTPase mnmE;       
    7::447     1e-66  35%  447 aa  MNME_RUTMC RecName: Full=tRNA modification GTPase mnmE;       
    8::458     2e-66  37%  458 aa  MNME_STRA5 RecName: Full=tRNA modification GTPase mnmE;       
    8::458     2e-66  37%  458 aa  MNME_STRA3 RecName: Full=tRNA modification GTPase mnmE;       
    8::458     2e-66  37%  458 aa  MNME_STRA1 RecName: Full=tRNA modification GTPase mnmE;       
    3::452     3e-66  36%  452 aa  MNME_FINM2 RecName: Full=tRNA modification GTPase mnmE;       
    4::461     4e-66  39%  461 aa  MNME_DESRM RecName: Full=tRNA modification GTPase mnmE;       
    7::447     5e-66  36%  447 aa  MNME_VESOH RecName: Full=tRNA modification GTPase mnmE;       
    4::452     5e-66  34%  452 aa  MNME_HAES1 RecName: Full=tRNA modification GTPase mnmE;       
   63::435     5e-66  40%  435 aa  MNME_GLUDA RecName: Full=tRNA modification GTPase mnmE;       
   35::492     5e-66  41%  492 aa  GTPB3_RAT RecName: Full=tRNA modification GTPase GTPBP3,
   38::526     7e-66  38%  526 aa  MSS1_YEAST RecName: Full=tRNA modification GTPase MSS1,
    1::428     9e-66  39%  428 aa  MNME_SILST RecName: Full=tRNA modification GTPase mnmE;       
   28::461     9e-66  38%  461 aa  MNME_CLOBK RecName: Full=tRNA modification GTPase mnmE;       
   28::461     9e-66  38%  461 aa  MNME_CLOBH RecName: Full=tRNA modification GTPase mnmE;       
   28::461     9e-66  38%  461 aa  MNME_CLOB1 RecName: Full=tRNA modification GTPase mnmE;       
    4::452     2e-65  34%  452 aa  MNME_HAES2 RecName: Full=tRNA modification GTPase mnmE;       
    6::453     2e-65  35%  453 aa  MNME_RHOP5 RecName: Full=tRNA modification GTPase mnmE;       
    7::455     3e-65  37%  455 aa  MNME_STRMU RecName: Full=tRNA modification GTPase mnmE;       
    5::456     3e-65  36%  456 aa  MNME_GEOSL RecName: Full=tRNA modification GTPase mnmE;       
    4::457     4e-65  37%  457 aa  MNME_LISW6 RecName: Full=tRNA modification GTPase mnmE;       
    5::446     6e-65  41%  446 aa  MNME_ARCB4 RecName: Full=tRNA modification GTPase mnmE;       
   17::462     6e-65  36%  462 aa  MNME_ACIAD RecName: Full=tRNA modification GTPase mnmE;       
   28::461     8e-65  38%  461 aa  MNME_CLOBL RecName: Full=tRNA modification GTPase mnmE;       
    5::454     1e-64  36%  454 aa  MNME_PROMH RecName: Full=tRNA modification GTPase mnmE;       
    4::458     1e-64  36%  458 aa  MNME_BACWK RecName: Full=tRNA modification GTPase mnmE;       
    4::458     1e-64  34%  458 aa  MNME_BACAH RecName: Full=tRNA modification GTPase mnmE;       
    1::428     2e-64  39%  428 aa  MNME_SILPO RecName: Full=tRNA modification GTPase mnmE;       
    4::457     2e-64  37%  457 aa  MNME_LISMO RecName: Full=tRNA modification GTPase mnmE;       
    4::457     2e-64  37%  457 aa  MNME_LISMF RecName: Full=tRNA modification GTPase mnmE;       
    9::464     2e-64  36%  464 aa  MNME_LACBA RecName: Full=tRNA modification GTPase mnmE;       
    5::459     2e-64  38%  459 aa  MNME_CLOTE RecName: Full=tRNA modification GTPase mnmE;       
    6::457     3e-64  37%  457 aa  MNME_NITHX RecName: Full=tRNA modification GTPase mnmE;       
    4::457     3e-64  37%  457 aa  MNME_LISIN RecName: Full=tRNA modification GTPase mnmE;       
    4::458     3e-64  34%  458 aa  MNME_BACHK RecName: Full=tRNA modification GTPase mnmE;       
    4::458     3e-64  34%  458 aa  MNME_BACCZ RecName: Full=tRNA modification GTPase mnmE;       
    4::458     3e-64  34%  458 aa  MNME_BACAN RecName: Full=tRNA modification GTPase mnmE;       
    9::454     3e-64  36%  454 aa  MNME_ACIBY RecName: Full=tRNA modification GTPase mnmE;       
    9::454     3e-64  36%  454 aa  MNME_ACIBT RecName: Full=tRNA modification GTPase mnmE;       
   10::464     4e-64  37%  464 aa  MNME_LACS1 RecName: Full=tRNA modification GTPase mnmE;       
    5::450     4e-64  37%  450 aa  MNME_FRAP2 RecName: Full=tRNA modification GTPase mnmE;       
    4::458     4e-64  34%  458 aa  MNME_BACCR RecName: Full=tRNA modification GTPase mnmE;       
    8::456     5e-64  36%  456 aa  MNME_STRTD RecName: Full=tRNA modification GTPase mnmE;       
    8::456     5e-64  36%  456 aa  MNME_STRT1 RecName: Full=tRNA modification GTPase mnmE;       
    8::456     6e-64  36%  456 aa  MNME_STRT2 RecName: Full=tRNA modification GTPase mnmE;       
    3::452     8e-64  33%  452 aa  MNME_ACTSZ RecName: Full=tRNA modification GTPase mnmE;       
   56::453     1e-63  35%  453 aa  MNME_SHESR RecName: Full=tRNA modification GTPase mnmE;       
    4::453     1e-63  34%  453 aa  MNME_SHEPC RecName: Full=tRNA modification GTPase mnmE;       
    4::453     1e-63  34%  453 aa  MNME_SHESW RecName: Full=tRNA modification GTPase mnmE;       
    6::455     1e-63  34%  455 aa  MNME_PHOPR RecName: Full=tRNA modification GTPase mnmE;       
    4::458     1e-63  34%  458 aa  MNME_BACC1 RecName: Full=tRNA modification GTPase mnmE;       
   56::446     2e-63  38%  446 aa  MNME_CAUCR RecName: Full=tRNA modification GTPase mnmE;       
   56::446     2e-63  38%  446 aa  MNME_CAUCN RecName: Full=tRNA modification GTPase mnmE;       
    6::445     2e-63  35%  445 aa  MNME_BRASB RecName: Full=tRNA modification GTPase mnmE;       
    1::459     2e-63  35%  459 aa  MNME_BACSU RecName: Full=tRNA modification GTPase mnmE;       
    1::459     2e-63  35%  459 aa  MNME_BACP2 RecName: Full=tRNA modification GTPase mnmE;       
   56::453     2e-63  35%  453 aa  MNME_SHESM RecName: Full=tRNA modification GTPase mnmE;       
   56::453     2e-63  35%  453 aa  MNME_SHESA RecName: Full=tRNA modification GTPase mnmE;       
    6::456     2e-63  37%  456 aa  MNME_NITWN RecName: Full=tRNA modification GTPase mnmE;       
    8::455     2e-63  40%  455 aa  MNME_LACLA RecName: Full=tRNA modification GTPase mnmE;       
    6::460     3e-63  36%  460 aa  MNME_RHOP2 RecName: Full=tRNA modification GTPase mnmE;       
    7::452     4e-63  37%  452 aa  MNME_COXBU RecName: Full=tRNA modification GTPase mnmE;       
    7::452     4e-63  37%  452 aa  MNME_COXBR RecName: Full=tRNA modification GTPase mnmE;       
    7::452     4e-63  37%  452 aa  MNME_COXBN RecName: Full=tRNA modification GTPase mnmE;       
   35::492     5e-63  40%  492 aa  GTPB3_MOUSE RecName: Full=tRNA modification GTPase GTPBP3,
    3::441     7e-63  33%  441 aa  MNME_THEM4 RecName: Full=tRNA modification GTPase mnmE;       
    9::462     7e-63  35%  462 aa  MNME_LACC3 RecName: Full=tRNA modification GTPase mnmE;       
    4::458     7e-63  34%  458 aa  MNME_BACHD RecName: Full=tRNA modification GTPase mnmE;       
    8::450     2e-62  35%  450 aa  MNME_SULNB RecName: Full=tRNA modification GTPase mnmE;       
    4::453     2e-62  32%  453 aa  MNME_SHEAM RecName: Full=tRNA modification GTPase mnmE;       
    8::455     3e-62  40%  455 aa  MNME_LACLM RecName: Full=tRNA modification GTPase mnmE;       
    4::453     3e-62  33%  453 aa  MNME_VIBC3 RecName: Full=tRNA modification GTPase mnmE;       
   56::453     3e-62  35%  453 aa  MNME_SHEON RecName: Full=tRNA modification GTPase mnmE;       
   15::459     3e-62  36%  459 aa  MNME_CLOD6 RecName: Full=tRNA modification GTPase mnmE;       
    3::459     6e-62  33%  459 aa  MNME_STAAT RecName: Full=tRNA modification GTPase mnmE;       
    3::459     6e-62  33%  459 aa  MNME_STAAE RecName: Full=tRNA modification GTPase mnmE;       
    3::459     6e-62  33%  459 aa  MNME_STAAC RecName: Full=tRNA modification GTPase mnmE;       
    3::459     6e-62  33%  459 aa  MNME_STAA3 RecName: Full=tRNA modification GTPase mnmE;       
    8::455     6e-62  39%  455 aa  MNME_LACLS RecName: Full=tRNA modification GTPase mnmE;       
    5::457     6e-62  33%  457 aa  MNME_GEOMG RecName: Full=tRNA modification GTPase mnmE;       
    1::459     6e-62  37%  459 aa  MNME_BACA2 RecName: Full=tRNA modification GTPase mnmE;       
    9::462     8e-62  37%  462 aa  MNME_LACSS RecName: Full=tRNA modification GTPase mnmE;       
   57::454     1e-61  35%  454 aa  MNME_PSEHT RecName: Full=tRNA modification GTPase mnmE;       
    6::444     1e-61  36%  444 aa  MNME_BRASO RecName: Full=tRNA modification GTPase mnmE;       
    8::462     1e-61  37%  462 aa  MNME_STRAG RecName: Full=tRNA modification GTPase mnmE;       
    9::461     1e-61  34%  461 aa  MNME_LACAC RecName: Full=tRNA modification GTPase mnmE;       
    4::453     2e-61  32%  453 aa  MNME_SHESH RecName: Full=tRNA modification GTPase mnmE;       
   16::456     2e-61  36%  456 aa  MNME_MARAV RecName: Full=tRNA modification GTPase mnmE;       
    9::465     2e-61  35%  465 aa  MNME_ENTFA RecName: Full=tRNA modification GTPase mnmE;       
    5::458     2e-61  36%  458 aa  MNME_CLOPS RecName: Full=tRNA modification GTPase mnmE;       
    1::459     2e-61  34%  459 aa  MNME_BACLD RecName: Full=tRNA modification GTPase mnmE;       
    4::453     2e-61  33%  453 aa  MNME_VIBPA RecName: Full=tRNA modification GTPase mnmE;       
    5::474     2e-61  35%  474 aa  MNME_GRAFK RecName: Full=tRNA modification GTPase mnmE;       
    4::453     3e-61  33%  453 aa  MNME_VIBVY RecName: Full=tRNA modification GTPase mnmE;       
    4::453     3e-61  33%  453 aa  MNME_VIBVU RecName: Full=tRNA modification GTPase mnmE;       
    5::458     3e-61  36%  458 aa  MNME_CLOPE RecName: Full=tRNA modification GTPase mnmE;       
    5::458     3e-61  36%  458 aa  MNME_CLOP1 RecName: Full=tRNA modification GTPase mnmE;       
   70::461     4e-61  38%  461 aa  MNME_CLOBM RecName: Full=tRNA modification GTPase mnmE;       
    4::461     5e-61  35%  461 aa  MNME_LYSSC RecName: Full=tRNA modification GTPase mnmE;       
    4::459     7e-61  33%  459 aa  MNME_STAHJ RecName: Full=tRNA modification GTPase mnmE;       
    4::453     7e-61  32%  453 aa  MNME_SHEWM RecName: Full=tRNA modification GTPase mnmE;       
   12::458     7e-61  36%  458 aa  MNME_PARUW RecName: Full=tRNA modification GTPase mnmE;       
    3::446     7e-61  35%  446 aa  MNME_LEGPA RecName: Full=tRNA modification GTPase mnmE;       
    5::454     7e-61  33%  454 aa  MNME_ERWT9 RecName: Full=tRNA modification GTPase mnmE;       
    4::459     9e-61  33%  459 aa  MNME_STAES RecName: Full=tRNA modification GTPase mnmE;       
    4::459     9e-61  33%  459 aa  MNME_STAEQ RecName: Full=tRNA modification GTPase mnmE;       
    5::462     9e-61  35%  462 aa  MNME_GEOTN RecName: Full=tRNA modification GTPase mnmE;       
    4::453     1e-60  33%  453 aa  MNME_VIBHB RecName: Full=tRNA modification GTPase mnmE;       
    6::469     1e-60  36%  469 aa  MNME_THEEB RecName: Full=tRNA modification GTPase mnmE;       
    6::469     1e-60  36%  469 aa  MNME_SYNEL RecName: Full=tRNA modification GTPase mnmE;       
    8::448     1e-60  34%  448 aa  MNME_NITSB RecName: Full=tRNA modification GTPase mnmE;       
   21::459     1e-60  35%  459 aa  MNME_MARMS RecName: Full=tRNA modification GTPase mnmE;       
    5::462     1e-60  38%  462 aa  MNME_CLOB8 RecName: Full=tRNA modification GTPase mnmE;       
    5::454     1e-60  34%  454 aa  MNME_PHOLL RecName: Full=tRNA modification GTPase mnmE;       
    3::446     1e-60  35%  446 aa  MNME_LEGPL RecName: Full=tRNA modification GTPase mnmE;       
    5::466     1e-60  37%  466 aa  MNME_FLAJ1 RecName: Full=tRNA modification GTPase mnmE;       
    5::456     2e-60  36%  456 aa  MNME_PELCD RecName: Full=tRNA modification GTPase mnmE;       
    6::456     2e-60  34%  456 aa  MNME_PSEPG RecName: Full=tRNA modification GTPase mnmE;       
   54::451     2e-60  40%  451 aa  MNME_NITEC RecName: Full=tRNA modification GTPase mnmE;       
    3::446     2e-60  35%  446 aa  MNME_LEGPC RecName: Full=tRNA modification GTPase mnmE;       
   13::460     2e-60  34%  460 aa  MNME_CYTH3 RecName: Full=tRNA modification GTPase mnmE;       
    6::435     2e-60  34%  435 aa  MNME_AZOC5 RecName: Full=tRNA modification GTPase mnmE;       
    6::456     3e-60  34%  456 aa  MNME_PSEPW RecName: Full=tRNA modification GTPase mnmE;       
    6::456     4e-60  34%  456 aa  MNME_PSEPU RecName: Full=tRNA modification GTPase mnmE;       
    6::456     4e-60  34%  456 aa  MNME_PSEPK RecName: Full=tRNA modification GTPase mnmE;       
    6::456     4e-60  34%  456 aa  MNME_PSEP1 RecName: Full=tRNA modification GTPase mnmE;       
    5::455     6e-60  32%  455 aa  MNME_PSYIN RecName: Full=tRNA modification GTPase mnmE;       
    3::446     6e-60  35%  446 aa  MNME_LEGPH RecName: Full=tRNA modification GTPase mnmE;       
   29::450     6e-60  36%  450 aa  MNME_FRATO RecName: Full=tRNA modification GTPase mnmE;       
   29::450     6e-60  36%  450 aa  MNME_FRATH RecName: Full=tRNA modification GTPase mnmE;       
   29::450     6e-60  36%  450 aa  MNME_FRATF RecName: Full=tRNA modification GTPase mnmE;       
    4::453     7e-60  32%  453 aa  MNME_SHEHH RecName: Full=tRNA modification GTPase mnmE;       
   29::450     7e-60  36%  450 aa  MNME_FRATN RecName: Full=tRNA modification GTPase mnmE;       
    5::462     7e-60  33%  462 aa  MNME_FLAPJ RecName: Full=tRNA modification GTPase mnmE;       
   28::455     7e-60  37%  455 aa  MNME_CALS8 RecName: Full=tRNA modification GTPase mnmE;       
   42::454     7e-60  38%  454 aa  MNME_BUCCC RecName: Full=tRNA modification GTPase mnmE;       
    7::456     7e-60  35%  456 aa  MNME_ALCBS RecName: Full=tRNA modification GTPase mnmE;       
    4::453     9e-60  32%  453 aa  MNME_VIBCH RecName: Full=tRNA modification GTPase mnmE;       
    7::448     1e-59  34%  448 aa  MNME_NEIMA RecName: Full=tRNA modification GTPase mnmE;       
    9::467     1e-59  37%  467 aa  MNME_DESPS RecName: Full=tRNA modification GTPase mnmE;       
    3::458     1e-59  34%  458 aa  MNME_BACSK RecName: Full=tRNA modification GTPase mnmE;       
    4::453     2e-59  32%  453 aa  MNME_SHEPA RecName: Full=tRNA modification GTPase mnmE;       
   36::463     2e-59  35%  463 aa  MNME_LACPL RecName: Full=tRNA modification GTPase mnmE;       
    5::450     2e-59  35%  450 aa  MNME_DICNV RecName: Full=tRNA modification GTPase mnmE;       
   29::450     3e-59  36%  450 aa  MNME_FRATW RecName: Full=tRNA modification GTPase mnmE;       
    3::459     3e-59  35%  459 aa  MNME_DESHY RecName: Full=tRNA modification GTPase mnmE;       
   18::459     3e-59  36%  459 aa  MNME_ANASP RecName: Full=tRNA modification GTPase mnmE;       
    4::466     4e-59  33%  466 aa  MNME_HELMI RecName: Full=tRNA modification GTPase mnmE;       
   29::450     4e-59  36%  450 aa  MNME_FRATT RecName: Full=tRNA modification GTPase mnmE;       
   29::450     4e-59  36%  450 aa  MNME_FRAT1 RecName: Full=tRNA modification GTPase mnmE;       
    5::454     5e-59  36%  454 aa  MNME_SERP5 RecName: Full=tRNA modification GTPase mnmE;       
    6::455     6e-59  33%  455 aa  MNME_VIBF1 RecName: Full=tRNA modification GTPase mnmE;       
    7::448     8e-59  33%  448 aa  MNME_NEIMF RecName: Full=tRNA modification GTPase mnmE;       
    7::448     8e-59  33%  448 aa  MNME_NEIMB RecName: Full=tRNA modification GTPase mnmE;       
   60::458     8e-59  34%  458 aa  MNME_IDILO RecName: Full=tRNA modification GTPase mnmE;       
    7::448     1e-58  33%  448 aa  MNME_NEIM0 RecName: Full=tRNA modification GTPase mnmE;       
    5::454     1e-58  33%  454 aa  MNME_ENTS8 RecName: Full=tRNA modification GTPase mnmE;       
    5::454     1e-58  35%  454 aa  MNME_YERE8 RecName: Full=tRNA modification GTPase mnmE;       
    5::454     2e-58  33%  454 aa  MNME_YERPS RecName: Full=tRNA modification GTPase mnmE;       
    5::454     2e-58  33%  454 aa  MNME_YERPB RecName: Full=tRNA modification GTPase mnmE;       
    5::454     2e-58  33%  454 aa  MNME_YERP3 RecName: Full=tRNA modification GTPase mnmE;       
    5::443     2e-58  33%  443 aa  MNME_RHILO RecName: Full=tRNA modification GTPase mnmE;       
   22::463     2e-58  36%  463 aa  MNME_ANAVT RecName: Full=tRNA modification GTPase mnmE;       
    5::454     2e-58  33%  454 aa  MNME_YERPY RecName: Full=tRNA modification GTPase mnmE;       
    5::454     2e-58  33%  454 aa  MNME_YERPP RecName: Full=tRNA modification GTPase mnmE;       
    5::454     2e-58  33%  454 aa  MNME_YERPN RecName: Full=tRNA modification GTPase mnmE;       
    5::454     2e-58  33%  454 aa  MNME_YERPG RecName: Full=tRNA modification GTPase mnmE;       
    5::454     2e-58  33%  454 aa  MNME_YERPA RecName: Full=tRNA modification GTPase mnmE;       
    7::456     2e-58  35%  456 aa  MNME_SACD2 RecName: Full=tRNA modification GTPase mnmE;       
   12::459     2e-58  35%  459 aa  MNME_FERNB RecName: Full=tRNA modification GTPase mnmE;       
   23::467     3e-58  36%  467 aa  MNME_TRIEI RecName: Full=tRNA modification GTPase mnmE;       
   22::449     3e-58  38%  449 aa  MNME_AKKM8 RecName: Full=tRNA modification GTPase mnmE;       
    1::434     4e-58  35%  434 aa  MNME_ZYMMO RecName: Full=tRNA modification GTPase mnmE;       
    3::450     5e-58  35%  450 aa  MNME_THELT RecName: Full=tRNA modification GTPase mnmE;       
    7::448     5e-58  33%  448 aa  MNME_NEIG2 RecName: Full=tRNA modification GTPase mnmE;       
    7::448     5e-58  33%  448 aa  MNME_NEIG1 RecName: Full=tRNA modification GTPase mnmE;       
    9::461     7e-58  33%  461 aa  MNME_LACH4 RecName: Full=tRNA modification GTPase mnmE;       
    4::446     9e-58  35%  446 aa  MNME_SULDN RecName: Full=tRNA modification GTPase mnmE;       
    4::453     9e-58  32%  453 aa  MNME_SHELP RecName: Full=tRNA modification GTPase mnmE;       
    3::450     9e-58  35%  450 aa  MNME_HELAH RecName: Full=tRNA modification GTPase mnmE;       
    1::461     1e-57  34%  461 aa  MNME_PARD8 RecName: Full=tRNA modification GTPase mnmE;       
    5::460     1e-57  32%  460 aa  MNME_EXIS2 RecName: Full=tRNA modification GTPase mnmE;       
    5::454     2e-57  32%  454 aa  MNME_YERPE RecName: Full=tRNA modification GTPase mnmE;       
    5::454     2e-57  33%  454 aa  MNME_SODGM RecName: Full=tRNA modification GTPase mnmE;       
    4::459     2e-57  36%  459 aa  MNME_PELTS RecName: Full=tRNA modification GTPase mnmE;       
    7::456     2e-57  38%  456 aa  MNME_UNCTG RecName: Full=tRNA modification GTPase mnmE;       
    5::455     2e-57  34%  455 aa  MNME_GEOUR RecName: Full=tRNA modification GTPase mnmE;       
   47::459     2e-57  34%  459 aa  MNME_CLOK5 RecName: Full=tRNA modification GTPase mnmE;       
   33::450     2e-57  33%  450 aa  MNME_CHRVO RecName: Full=tRNA modification GTPase mnmE;       
    5::454     3e-57  34%  454 aa  MNME_SALPK RecName: Full=tRNA modification GTPase mnmE;       
   40::461     3e-57  37%  461 aa  MNME_DESAP RecName: Full=tRNA modification GTPase mnmE;       
    6::460     3e-57  35%  460 aa  MNME_CYAP4 RecName: Full=tRNA modification GTPase mnmE;       
    9::461     3e-57  39%  461 aa  MNME_LACGA RecName: Full=tRNA modification GTPase mnmE;       
    5::454     3e-57  34%  454 aa  MNME_ENT38 RecName: Full=tRNA modification GTPase mnmE;       
    6::450     4e-57  33%  450 aa  MNME_LARHH RecName: Full=tRNA modification GTPase mnmE;       
    6::456     6e-57  36%  456 aa  MNME_PSEF5 RecName: Full=tRNA modification GTPase mnmE;       
   51::464     6e-57  38%  464 aa  MNME_PEDPA RecName: Full=tRNA modification GTPase mnmE;       
    5::454     8e-57  34%  454 aa  MNME_SALPA RecName: Full=tRNA modification GTPase mnmE;       
    5::459     8e-57  33%  459 aa  MNME_OCEIH RecName: Full=tRNA modification GTPase mnmE;       
   54::452     8e-57  35%  452 aa  MNME_NITMU RecName: Full=tRNA modification GTPase mnmE;       
    3::459     1e-56  32%  459 aa  MNME_STAAB RecName: Full=tRNA modification GTPase mnmE;       
    5::454     1e-56  34%  454 aa  MNME_SALTI RecName: Full=tRNA modification GTPase mnmE;       
   15::455     1e-56  35%  455 aa  MNME_PROMA RecName: Full=tRNA modification GTPase mnmE;       
    3::459     1e-56  32%  459 aa  MNME_STAAW RecName: Full=tRNA modification GTPase mnmE;       
    3::459     1e-56  32%  459 aa  MNME_STAAR RecName: Full=tRNA modification GTPase mnmE;       
    3::459     1e-56  32%  459 aa  MNME_STAAN RecName: Full=tRNA modification GTPase mnmE;       
    3::459     1e-56  32%  459 aa  MNME_STAA9 RecName: Full=tRNA modification GTPase mnmE;       
    3::459     1e-56  32%  459 aa  MNME_STAA8 RecName: Full=tRNA modification GTPase mnmE;       
    3::459     1e-56  32%  459 aa  MNME_STAA2 RecName: Full=tRNA modification GTPase mnmE;       
    4::453     1e-56  31%  453 aa  MNME_SHEB9 RecName: Full=tRNA modification GTPase mnmE;       
    4::453     1e-56  31%  453 aa  MNME_SHEB8 RecName: Full=tRNA modification GTPase mnmE;       
    5::454     1e-56  33%  454 aa  MNME_KLEP3 RecName: Full=tRNA modification GTPase mnmE;       
    6::456     2e-56  34%  456 aa  MNME_PSEPF RecName: Full=tRNA modification GTPase mnmE;       
    4::445     2e-56  34%  445 aa  MNME_MYCAP RecName: Full=tRNA modification GTPase mnmE;       
   61::460     2e-56  36%  460 aa  MNME_PSEA6 RecName: Full=tRNA modification GTPase mnmE;       
    5::462     2e-56  34%  462 aa  MNME_GEOKA RecName: Full=tRNA modification GTPase mnmE;       
    3::466     2e-56  37%  466 aa  MNME_CAMHC RecName: Full=tRNA modification GTPase mnmE;       
   60::454     3e-56  38%  454 aa  MNME_SULMW RecName: Full=tRNA modification GTPase mnmE;       
   56::453     3e-56  32%  453 aa  MNME_SHEB5 RecName: Full=tRNA modification GTPase mnmE;       
    3::304     3e-56  41%  450 aa  MNME_HELPS RecName: Full=tRNA modification GTPase mnmE;       
   57::453     4e-56  34%  453 aa  MNME_SHEDO RecName: Full=tRNA modification GTPase mnmE;       
    9::461     4e-56  39%  461 aa  MNME_LACJO RecName: Full=tRNA modification GTPase mnmE;       
   56::447     4e-56  35%  447 aa  MNME_CAUSK RecName: Full=tRNA modification GTPase mnmE;       
    6::455     4e-56  34%  455 aa  MNME_AMOA5 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_SHISS RecName: Full=tRNA modification GTPase mnmE;       
   10::474     5e-56  35%  474 aa  MNME_PORGI RecName: Full=tRNA modification GTPase mnmE;       
    8::457     5e-56  35%  457 aa  MNME_POLSQ RecName: Full=tRNA modification GTPase mnmE;       
    4::452     5e-56  35%  452 aa  MNME_PETMO RecName: Full=tRNA modification GTPase mnmE;       
    5::454     5e-56  33%  454 aa  MNME_KLEP7 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_ESCF3 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_ECOUT RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_ECOSM RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_ECOL6 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_ECOL5 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_ECOK1 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_ECO81 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_ECO7I RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_ECO45 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-56  40%  454 aa  MNME_ECO27 RecName: Full=tRNA modification GTPase mnmE;       
    3::459     6e-56  32%  459 aa  MNME_STAAS RecName: Full=tRNA modification GTPase mnmE;       
    3::459     6e-56  32%  459 aa  MNME_STAAM RecName: Full=tRNA modification GTPase mnmE;       
    3::459     6e-56  32%  459 aa  MNME_STAA1 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_SHIDS RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_SHIBS RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_SHIB3 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_ECOSE RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_ECOLI RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_ECOLC RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_ECOHS RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_ECODH RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_ECOBW RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_ECO8A RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_ECO5E RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_ECO57 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     6e-56  40%  454 aa  MNME_ECO55 RecName: Full=tRNA modification GTPase mnmE;       
    6::452     6e-56  34%  452 aa  MNME_BRAJA RecName: Full=tRNA modification GTPase mnmE;       
    1::450     8e-56  33%  450 aa  MNME_THEP1 RecName: Full=tRNA modification GTPase mnmE;       
   48::471     8e-56  32%  471 aa  MNME_COLP3 RecName: Full=tRNA modification GTPase mnmE;       
    4::458     8e-56  33%  458 aa  MNME_CLOPH RecName: Full=tRNA modification GTPase mnmE;       
    8::464     8e-56  32%  464 aa  MNME_BRAHW RecName: Full=tRNA modification GTPase mnmE;       
    5::310     1e-55  40%  454 aa  MNME_SHIFL RecName: Full=tRNA modification GTPase mnmE;       
    5::310     1e-55  40%  454 aa  MNME_SHIF8 RecName: Full=tRNA modification GTPase mnmE;       
    6::456     1e-55  32%  456 aa  MNME_PSEE4 RecName: Full=tRNA modification GTPase mnmE;       
   26::455     1e-55  35%  455 aa  MNME_PSEAB RecName: Full=tRNA modification GTPase mnmE;       
   55::454     2e-55  34%  454 aa  MNME_HAHCH RecName: Full=tRNA modification GTPase mnmE;       
   25::496     2e-55  35%  496 aa  MSS1_SCHPO RecName: Full=tRNA modification GTPase mss1,
   47::456     2e-55  34%  456 aa  MNME_PELPD RecName: Full=tRNA modification GTPase mnmE;       
    3::438     2e-55  34%  438 aa  MNME_CAMFF RecName: Full=tRNA modification GTPase mnmE;       
    5::461     2e-55  42%  461 aa  MNME_ALKMQ RecName: Full=tRNA modification GTPase mnmE;       
    4::453     2e-55  34%  453 aa  MNME_AERHH RecName: Full=tRNA modification GTPase mnmE;       
   19::457     3e-55  34%  457 aa  MNME_MICAN RecName: Full=tRNA modification GTPase mnmE;       
    5::310     3e-55  40%  454 aa  MNME_ECOLU RecName: Full=tRNA modification GTPase mnmE;       
    6::457     3e-55  32%  457 aa  MNME_BAUCH RecName: Full=tRNA modification GTPase mnmE;       
   56::453     4e-55  34%  453 aa  MNME_SHEFN RecName: Full=tRNA modification GTPase mnmE;       
    1::428     4e-55  34%  428 aa  MNME_RHOS5 RecName: Full=tRNA modification GTPase mnmE;       
    3::441     4e-55  34%  441 aa  MNME_CAMC1 RecName: Full=tRNA modification GTPase mnmE;       
    4::453     4e-55  32%  453 aa  MNME_AERS4 RecName: Full=tRNA modification GTPase mnmE;       
    9::478     5e-55  34%  478 aa  MNME_POLNA RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-55  40%  454 aa  MNME_ECO24 RecName: Full=tRNA modification GTPase mnmE;       
   54::451     7e-55  36%  451 aa  MNME_NITEU RecName: Full=tRNA modification GTPase mnmE;       
    3::456     7e-55  36%  456 aa  MNME_LEPBL RecName: Full=tRNA modification GTPase mnmE;       
    3::456     7e-55  36%  456 aa  MNME_LEPBJ RecName: Full=tRNA modification GTPase mnmE;       
   30::451     9e-55  36%  451 aa  MNME_THICR RecName: Full=tRNA modification GTPase mnmE;       
    5::310     9e-55  40%  454 aa  MNME_SALAR RecName: Full=tRNA modification GTPase mnmE;       
    4::465     9e-55  34%  465 aa  MNME_BACTN RecName: Full=tRNA modification GTPase mnmE;       
    6::456     1e-54  34%  456 aa  MNME_PSEU2 RecName: Full=tRNA modification GTPase mnmE;       
   58::446     1e-54  34%  446 aa  MNME_METFK RecName: Full=tRNA modification GTPase mnmE;       
    3::456     5e-54  33%  456 aa  MNME_LEPIN RecName: Full=tRNA modification GTPase mnmE;       
    3::456     5e-54  33%  456 aa  MNME_LEPIC RecName: Full=tRNA modification GTPase mnmE;       
    6::456     6e-54  34%  456 aa  MNME_PSE14 RecName: Full=tRNA modification GTPase mnmE;       
   14::458     6e-54  34%  458 aa  MNME_NITOC RecName: Full=tRNA modification GTPase mnmE;       
   17::455     6e-54  34%  455 aa  MNME_ACAM1 RecName: Full=tRNA modification GTPase mnmE;       
    4::462     8e-54  35%  462 aa  MNME_MOOTA RecName: Full=tRNA modification GTPase mnmE;       
    9::297     1e-53  41%  461 aa  MNME_LACDB RecName: Full=tRNA modification GTPase mnmE;       
    9::297     1e-53  41%  461 aa  MNME_LACDA RecName: Full=tRNA modification GTPase mnmE;       
    3::455     1e-53  30%  455 aa  MNME_FUSNN RecName: Full=tRNA modification GTPase mnmE;       
    4::460     1e-53  34%  460 aa  MNME_AYWBP RecName: Full=tRNA modification GTPase mnmE;       
   58::475     2e-53  33%  475 aa  MNME_RALEJ RecName: Full=tRNA modification GTPase mnmE;       
   47::464     2e-53  35%  464 aa  MNME_PROM1 RecName: Full=tRNA modification GTPase mnmE;       
    5::442     2e-53  35%  442 aa  MNME_CHLPN RecName: Full=tRNA modification GTPase mnmE;       
    4::465     2e-53  35%  465 aa  MNME_BACFN RecName: Full=tRNA modification GTPase mnmE;       
    5::310     3e-53  39%  454 aa  MNME_SALTY RecName: Full=tRNA modification GTPase mnmE;       
    5::310     3e-53  39%  454 aa  MNME_SALSV RecName: Full=tRNA modification GTPase mnmE;       
    5::310     3e-53  39%  454 aa  MNME_SALPC RecName: Full=tRNA modification GTPase mnmE;       
    5::310     3e-53  39%  454 aa  MNME_SALPB RecName: Full=tRNA modification GTPase mnmE;       
    5::310     3e-53  39%  454 aa  MNME_SALNS RecName: Full=tRNA modification GTPase mnmE;       
    5::310     3e-53  39%  454 aa  MNME_SALEP RecName: Full=tRNA modification GTPase mnmE;       
    5::310     3e-53  39%  454 aa  MNME_SALCH RecName: Full=tRNA modification GTPase mnmE;       
   10::458     3e-53  31%  458 aa  MNME_CHRSD RecName: Full=tRNA modification GTPase mnmE;       
    4::465     3e-53  35%  465 aa  MNME_BACFR RecName: Full=tRNA modification GTPase mnmE;       
   47::464     4e-53  35%  464 aa  MNME_PROMT RecName: Full=tRNA modification GTPase mnmE;       
   11::468     4e-53  34%  468 aa  MNME_MAGSM RecName: Full=tRNA modification GTPase mnmE;       
    5::310     4e-53  39%  454 aa  MNME_CITK8 RecName: Full=tRNA modification GTPase mnmE;       
    7::464     4e-53  32%  464 aa  MNME_BURXL RecName: Full=tRNA modification GTPase mnmE;       
    5::310     5e-53  39%  454 aa  MNME_SALG2 RecName: Full=tRNA modification GTPase mnmE;       
    1::450     7e-53  33%  450 aa  MNME_THEMA RecName: Full=tRNA modification GTPase mnmE;       
    3::459     7e-53  30%  459 aa  MNME_STAS1 RecName: Full=tRNA modification GTPase mnmE;       
    5::448     9e-53  33%  448 aa  MNME_MYCGA RecName: Full=tRNA modification GTPase mnmE;       
    6::459     9e-53  33%  459 aa  MNME_BUCBP RecName: Full=tRNA modification GTPase mnmE;       
   58::455     1e-52  34%  455 aa  MNME_PSEA7 RecName: Full=tRNA modification GTPase mnmE;       
   57::450     1e-52  35%  450 aa  MNME_BORPE RecName: Full=tRNA modification GTPase mnmE;       
    3::442     1e-52  33%  442 aa  MNME_CAMJJ RecName: Full=tRNA modification GTPase mnmE;       
    3::442     1e-52  33%  442 aa  MNME_CAMJE RecName: Full=tRNA modification GTPase mnmE;       
    4::448     2e-52  33%  448 aa  MNME_ACHLI RecName: Full=tRNA modification GTPase mnmE;       
   63::466     3e-52  35%  466 aa  MNME_HERAR RecName: Full=tRNA modification GTPase mnmE;       
   38::461     3e-52  34%  461 aa  MNME_HELPH RecName: Full=tRNA modification GTPase mnmE;       
    1::450     3e-52  33%  450 aa  MNME_THESQ RecName: Full=tRNA modification GTPase mnmE;       
    5::456     3e-52  34%  456 aa  MNME_SYNY3 RecName: Full=tRNA modification GTPase mnmE;       
    3::455     3e-52  32%  455 aa  MNME_RHORT RecName: Full=tRNA modification GTPase mnmE;       
   58::455     3e-52  34%  455 aa  MNME_PSEAE RecName: Full=tRNA modification GTPase mnmE;       
   57::450     3e-52  35%  450 aa  MNME_BORBR RecName: Full=tRNA modification GTPase mnmE;       
   22::457     4e-52  35%  457 aa  MNME_SYNAS RecName: Full=tRNA modification GTPase mnmE;       
   66::464     4e-52  34%  464 aa  MNME_BURS3 RecName: Full=tRNA modification GTPase mnmE;       
    7::301     6e-52  41%  433 aa  MNME_ACICJ RecName: Full=tRNA modification GTPase mnmE;       
    6::455     7e-52  32%  455 aa  MNME_PSEMY RecName: Full=tRNA modification GTPase mnmE;       
    5::454     7e-52  32%  454 aa  MNME_PECCP RecName: Full=tRNA modification GTPase mnmE;       
    3::442     7e-52  33%  442 aa  MNME_CAMJ8 RecName: Full=tRNA modification GTPase mnmE;       
   66::464     7e-52  34%  464 aa  MNME_BURCC RecName: Full=tRNA modification GTPase mnmE;       
    5::294     7e-52  38%  454 aa  MNME_ACIBL RecName: Full=tRNA modification GTPase mnmE;       
    7::467     1e-51  33%  467 aa  MNME_BURTA RecName: Full=tRNA modification GTPase mnmE;       
   66::464     1e-51  34%  464 aa  MNME_BURCH RecName: Full=tRNA modification GTPase mnmE;       
   66::464     1e-51  34%  464 aa  MNME_BURCA RecName: Full=tRNA modification GTPase mnmE;       
    3::301     1e-51  39%  437 aa  MNME_METS4 RecName: Full=tRNA modification GTPase mnmE;       
    3::442     1e-51  32%  442 aa  MNME_CAMJR RecName: Full=tRNA modification GTPase mnmE;       
    7::444     1e-51  33%  444 aa  MNME_CAMC5 RecName: Full=tRNA modification GTPase mnmE;       
    5::310     2e-51  38%  460 aa  MNME_SYNP2 RecName: Full=tRNA modification GTPase mnmE;       
   17::478     2e-51  33%  478 aa  MNME_PSYA2 RecName: Full=tRNA modification GTPase mnmE;       
   38::315     2e-51  42%  461 aa  MNME_HELPJ RecName: Full=tRNA modification GTPase mnmE;       
    3::442     2e-51  33%  442 aa  MNME_CAMJD RecName: Full=tRNA modification GTPase mnmE;       
    4::459     3e-51  36%  459 aa  MNME_SYNWW RecName: Full=tRNA modification GTPase mnmE;       
   17::478     4e-51  35%  478 aa  MNME_PSYCK RecName: Full=tRNA modification GTPase mnmE;       
   38::461     4e-51  34%  461 aa  MNME_HELPY RecName: Full=tRNA modification GTPase mnmE;       
    5::454     5e-51  32%  454 aa  MNME_ERWCT RecName: Full=tRNA modification GTPase mnmE;       
    2::461     6e-51  32%  461 aa  MNME_LEPBP RecName: Full=tRNA modification GTPase mnmE;       
    2::461     6e-51  32%  461 aa  MNME_LEPBA RecName: Full=tRNA modification GTPase mnmE;       
   66::464     6e-51  34%  464 aa  MNME_BURCM RecName: Full=tRNA modification GTPase mnmE;       
   66::464     6e-51  34%  464 aa  MNME_BURA4 RecName: Full=tRNA modification GTPase mnmE;       
    7::478     8e-51  32%  478 aa  MNME_POLSJ RecName: Full=tRNA modification GTPase mnmE;       
   66::464     1e-50  34%  464 aa  MNME_BURVG RecName: Full=tRNA modification GTPase mnmE;       
    7::466     1e-50  33%  466 aa  MNME_ACISJ RecName: Full=tRNA modification GTPase mnmE;       
   81::500     2e-50  36%  500 aa  MNME_BACV8 RecName: Full=tRNA modification GTPase mnmE;       
   62::465     2e-50  34%  465 aa  MNME_JANMA RecName: Full=tRNA modification GTPase mnmE;       
    5::441     3e-50  33%  441 aa  MNME_METRJ RecName: Full=tRNA modification GTPase mnmE;       
   25::461     4e-50  34%  461 aa  MNME_SALRD RecName: Full=tRNA modification GTPase mnmE;       
    6::456     5e-50  39%  456 aa  MNME_PSESM RecName: Full=tRNA modification GTPase mnmE;       
    4::460     5e-50  33%  460 aa  MNME_ONYPE RecName: Full=tRNA modification GTPase mnmE;       
   10::299     5e-50  38%  442 aa  MNME_MYCPU RecName: Full=tRNA modification GTPase mnmE;       
   57::445     7e-50  34%  445 aa  MNME_PHEZH RecName: Full=tRNA modification GTPase mnmE;       
    8::439     7e-50  33%  439 aa  MNME_DEIGD RecName: Full=tRNA modification GTPase mnmE;       
    5::456     7e-50  32%  456 aa  MNME_BUCAP RecName: Full=tRNA modification GTPase mnmE;       
   57::450     7e-50  34%  450 aa  MNME_BORPA RecName: Full=tRNA modification GTPase mnmE;       
   41::452     9e-50  33%  452 aa  MNME_BORPD RecName: Full=tRNA modification GTPase mnmE;       
   33::450     9e-50  35%  450 aa  MNME_BORA1 RecName: Full=tRNA modification GTPase mnmE;       
    3::297     2e-49  38%  442 aa  MNME_MYCMO RecName: Full=tRNA modification GTPase mnmE;       
    9::464     3e-49  31%  464 aa  MNME_BORDL RecName: Full=tRNA modification GTPase mnmE;       
    7::467     3e-49  33%  467 aa  MNME_BURPS RecName: Full=tRNA modification GTPase mnmE;       
    7::467     3e-49  33%  467 aa  MNME_BURP6 RecName: Full=tRNA modification GTPase mnmE;       
    7::467     3e-49  33%  467 aa  MNME_BURP0 RecName: Full=tRNA modification GTPase mnmE;       
    7::467     3e-49  33%  467 aa  MNME_BURMS RecName: Full=tRNA modification GTPase mnmE;       
    7::467     3e-49  33%  467 aa  MNME_BURMA RecName: Full=tRNA modification GTPase mnmE;       
    7::467     3e-49  33%  467 aa  MNME_BURM9 RecName: Full=tRNA modification GTPase mnmE;       
    7::467     3e-49  33%  467 aa  MNME_BURM7 RecName: Full=tRNA modification GTPase mnmE;       
    5::452     6e-49  31%  452 aa  MNME_MYCMS RecName: Full=tRNA modification GTPase mnmE;       
    9::464     6e-49  31%  464 aa  MNME_BORRA RecName: Full=tRNA modification GTPase mnmE;       
   11::456     8e-49  32%  456 aa  MNME_WOLSU RecName: Full=tRNA modification GTPase mnmE;       
    5::444     8e-49  34%  444 aa  MNME_CHLMU RecName: Full=tRNA modification GTPase mnmE;       
    5::452     1e-48  31%  452 aa  MNME_MYCCT RecName: Full=tRNA modification GTPase mnmE;       
   62::451     2e-48  33%  451 aa  MNME_XYLFA RecName: Full=tRNA modification GTPase mnmE;       
   22::457     2e-48  33%  457 aa  MNME_SYMTH RecName: Full=tRNA modification GTPase mnmE;       
    9::461     2e-48  31%  461 aa  MNME_PROM5 RecName: Full=tRNA modification GTPase mnmE;       
    5::453     3e-48  34%  453 aa  MNME_WIGBR RecName: Full=tRNA modification GTPase mnmE;       
    7::448     3e-48  31%  448 aa  MNME_METCA RecName: Full=tRNA modification GTPase mnmE;       
   58::297     4e-48  42%  455 aa  MNME_PSEU5 RecName: Full=tRNA modification GTPase mnmE;       
   62::451     5e-48  33%  451 aa  MNME_XYLFT RecName: Full=tRNA modification GTPase mnmE;       
   22::313     6e-48  39%  459 aa  MNME_SYNJB RecName: Full=tRNA modification GTPase mnmE;       
    5::458     6e-48  32%  458 aa  MNME_HAMD5 RecName: Full=tRNA modification GTPase mnmE;       
   15::473     8e-48  32%  473 aa  MNME_CHLTE RecName: Full=tRNA modification GTPase mnmE;       
   52::479     8e-48  33%  479 aa  MNME_BDEBA RecName: Full=tRNA modification GTPase mnmE;       
    4::442     1e-47  32%  442 aa  MNME_MYCHJ RecName: Full=tRNA modification GTPase mnmE;       
    4::442     1e-47  32%  442 aa  MNME_MYCH2 RecName: Full=tRNA modification GTPase mnmE;       
   13::443     1e-47  35%  443 aa  MNME_DEIRA RecName: Full=tRNA modification GTPase mnmE;       
    5::443     1e-47  33%  443 aa  MNME_CHLFF RecName: Full=tRNA modification GTPase mnmE;       
    4::442     1e-47  32%  442 aa  MNME_MYCH7 RecName: Full=tRNA modification GTPase mnmE;       
    7::312     2e-47  39%  462 aa  MNME_SYNE7 RecName: Full=tRNA modification GTPase mnmE;       
    4::453     2e-47  30%  453 aa  MNME_BUCMP RecName: Full=tRNA modification GTPase mnmE;       
    5::444     3e-47  31%  444 aa  MNME_SOLUE RecName: Full=tRNA modification GTPase mnmE;       
   29::460     3e-47  33%  460 aa  MNME_PROM9 RecName: Full=tRNA modification GTPase mnmE;       
   30::453     4e-47  39%  453 aa  MNME_SYNR3 RecName: Full=tRNA modification GTPase mnmE;       
    6::452     5e-47  31%  452 aa  MNME_OPITP RecName: Full=tRNA modification GTPase mnmE;       
   22::459     7e-47  35%  459 aa  MNME_SYNJA RecName: Full=tRNA modification GTPase mnmE;       
    7::312     9e-47  39%  462 aa  MNME_SYNP6 RecName: Full=tRNA modification GTPase mnmE;       
   14::314     9e-47  36%  467 aa  MNME_HELHP RecName: Full=tRNA modification GTPase mnmE;       
   21::298     1e-46  40%  460 aa  MNME_SYNPW RecName: Full=tRNA modification GTPase mnmE;       
   15::465     1e-46  32%  465 aa  MNME_PSYWF RecName: Full=tRNA modification GTPase mnmE;       
    6::452     1e-46  31%  452 aa  MNME_MESFL RecName: Full=tRNA modification GTPase mnmE;       
   77::474     2e-46  34%  474 aa  MNME_RALSO RecName: Full=tRNA modification GTPase mnmE;       
   58::448     2e-46  33%  448 aa  MNME_DECAR RecName: Full=tRNA modification GTPase mnmE;       
    7::467     2e-46  32%  467 aa  MNME_BURP1 RecName: Full=tRNA modification GTPase mnmE;       
   26::472     2e-46  32%  472 aa  MNME_TREDE RecName: Full=tRNA modification GTPase mnmE;       
    4::452     2e-46  31%  452 aa  MNME_BUCAI RecName: Full=tRNA modification GTPase mnmE;       
    8::469     4e-46  33%  469 aa  MNME_RHOFD RecName: Full=tRNA modification GTPase mnmE;       
   59::475     4e-46  39%  475 aa  MNME_RALME RecName: Full=tRNA modification GTPase mnmE;       
   58::475     5e-46  39%  475 aa  MNME_RALEH RecName: Full=tRNA modification GTPase mnmE;       
    5::442     6e-46  29%  442 aa  MNME_MYCPN RecName: Full=tRNA modification GTPase mnmE;       
    7::306     6e-46  35%  442 aa  MNME_MYCGE RecName: Full=tRNA modification GTPase mnmE;       
   60::474     8e-46  31%  474 aa  MNME_BLOFL RecName: Full=tRNA modification GTPase mnmE;       
   59::470     1e-45  35%  470 aa  MNME_BLOPB RecName: Full=tRNA modification GTPase mnmE;       
   22::463     1e-45  33%  463 aa  MNME_SYNS3 RecName: Full=tRNA modification GTPase mnmE;       
   64::451     1e-45  32%  451 aa  MNME_AZOSE RecName: Full=tRNA modification GTPase mnmE;       
    4::310     2e-45  36%  451 aa  MNME_SYNS9 RecName: Full=tRNA modification GTPase mnmE;       
    1::279     2e-45  37%  424 aa  MNME_ERYLH RecName: Full=tRNA modification GTPase mnmE;       
   22::300     7e-45  38%  470 aa  MNME_PROMM RecName: Full=tRNA modification GTPase mnmE;       
    8::471     9e-45  29%  471 aa  MNME_METPP RecName: Full=tRNA modification GTPase mnmE;       
   24::444     1e-44  36%  444 aa  MNME_MYCPE RecName: Full=tRNA modification GTPase mnmE;       
    7::479     1e-44  37%  479 aa  MNME_LEPCP RecName: Full=tRNA modification GTPase mnmE;       
    9::464     1e-44  30%  464 aa  MNME_BORT9 RecName: Full=tRNA modification GTPase mnmE;       
   12::473     3e-44  34%  473 aa  MNME_PROVI RecName: Full=tRNA modification GTPase mnmE;       
    5::305     4e-44  36%  432 aa  MNME_THET8 RecName: Full=tRNA modification GTPase mnmE;       
   17::450     4e-44  38%  450 aa  MNME_SYNSC RecName: Full=tRNA modification GTPase mnmE;       
    6::306     7e-44  35%  433 aa  MNME_THET2 RecName: Full=tRNA modification GTPase mnmE;       
    5::465     1e-43  32%  465 aa  MNME_CYACA RecName: Full=Probable tRNA modification GTPase mnmE;   
    5::444     2e-43  31%  444 aa  MNME_CHLTR RecName: Full=tRNA modification GTPase mnmE;       
    5::444     2e-43  31%  444 aa  MNME_CHLTB RecName: Full=tRNA modification GTPase mnmE;       
    5::444     2e-43  31%  444 aa  MNME_CHLT2 RecName: Full=tRNA modification GTPase mnmE;       
    5::443     2e-43  31%  443 aa  MNME_CHLCV RecName: Full=tRNA modification GTPase mnmE;       
   19::460     3e-43  29%  460 aa  MNME_PROMP RecName: Full=tRNA modification GTPase mnmE;       
    9::464     4e-43  30%  464 aa  MNME_BORGA RecName: Full=tRNA modification GTPase mnmE;       
    5::444     5e-43  31%  444 aa  MNME_CHLTA RecName: Full=tRNA modification GTPase mnmE;       
   55::464     6e-43  31%  464 aa  MNME_BORBZ RecName: Full=tRNA modification GTPase mnmE;       
   55::464     6e-43  31%  464 aa  MNME_BORBU RecName: Full=tRNA modification GTPase mnmE;       
   23::463     8e-43  35%  463 aa  MNME_MYCS5 RecName: Full=tRNA modification GTPase mnmE;       
   29::460     1e-42  34%  460 aa  MNME_PROM2 RecName: Full=tRNA modification GTPase mnmE;       
   22::300     2e-42  37%  465 aa  MNME_PROM3 RecName: Full=tRNA modification GTPase mnmE;       
   61::444     2e-42  32%  444 aa  MNME_METPB RecName: Full=tRNA modification GTPase mnmE;       
   55::464     7e-42  31%  464 aa  MNME_BORAP RecName: Full=tRNA modification GTPase mnmE;       
   16::440     1e-41  35%  440 aa  MNME_SPHWW RecName: Full=tRNA modification GTPase mnmE;       
   72::468     2e-41  31%  469 aa  MNME_HALHL RecName: Full=tRNA modification GTPase mnmE;       
   64::309     6e-41  37%  452 aa  MNME_AZOSB RecName: Full=tRNA modification GTPase mnmE;       
    3::453     1e-40  37%  453 aa  MNME_GLOVI RecName: Full=tRNA modification GTPase mnmE;       
    5::444     1e-40  37%  444 aa  MNME_ALHEH RecName: Full=tRNA modification GTPase mnmE;       
    5::450     2e-40  37%  450 aa  MNME_SYNPX RecName: Full=tRNA modification GTPase mnmE;       
   29::460     3e-40  33%  460 aa  MNME_PROMS RecName: Full=tRNA modification GTPase mnmE;       
   24::446     5e-40  31%  446 aa  MNME_XANCP RecName: Full=tRNA modification GTPase mnmE;       
   24::446     5e-40  31%  446 aa  MNME_XANCB RecName: Full=tRNA modification GTPase mnmE;       
   24::446     5e-40  31%  446 aa  MNME_XANC8 RecName: Full=tRNA modification GTPase mnmE;       
    1::295     8e-40  36%  419 aa  MNME_PARDP RecName: Full=tRNA modification GTPase mnmE;       
   10::446     8e-40  29%  446 aa  MNME_CYAME RecName: Full=Probable tRNA modification GTPase mnmE;   
   14::475     1e-39  31%  475 aa  MNME_CHLPD RecName: Full=tRNA modification GTPase mnmE;       
   29::460     2e-39  33%  460 aa  MNME_PROM0 RecName: Full=tRNA modification GTPase mnmE;       
    3::305     2e-39  35%  452 aa  MNME_CHLAA RecName: Full=tRNA modification GTPase mnmE;       
   64::293     3e-39  40%  446 aa  MNME_THIDA RecName: Full=tRNA modification GTPase mnmE;       
   51::470     3e-39  34%  470 aa  MNME_SYNFM RecName: Full=tRNA modification GTPase mnmE;       
   59::317     7e-39  38%  490 aa  MNME_VEREI RecName: Full=tRNA modification GTPase mnmE;       
   44::459     7e-39  30%  459 aa  MNME_LAWIP RecName: Full=tRNA modification GTPase mnmE;       
    8::297     7e-39  34%  468 aa  MNME_DESDG RecName: Full=tRNA modification GTPase mnmE;       
    1::438     9e-39  28%  438 aa  MNME_UREPA RecName: Full=tRNA modification GTPase mnmE;       
    1::438     9e-39  28%  438 aa  MNME_UREP2 RecName: Full=tRNA modification GTPase mnmE;       
   27::457     9e-39  32%  457 aa  MNME_DESVV RecName: Full=tRNA modification GTPase mnmE;       
   27::457     9e-39  32%  457 aa  MNME_DESVH RecName: Full=tRNA modification GTPase mnmE;       
    2::419     2e-38  30%  419 aa  MNME_SPHAL RecName: Full=tRNA modification GTPase mnmE;       
   59::319     3e-38  38%  482 aa  MNME_ACIAC RecName: Full=tRNA modification GTPase mnmE;       
   10::473     4e-38  30%  473 aa  MNME_CHLCH RecName: Full=tRNA modification GTPase mnmE;       
    3::437     1e-37  28%  437 aa  MNME_NOVAD RecName: Full=tRNA modification GTPase mnmE;       
    5::443     3e-37  30%  443 aa  MNME_CHLAB RecName: Full=tRNA modification GTPase mnmE;       
    5::461     9e-37  29%  461 aa  MNME_ROSS1 RecName: Full=tRNA modification GTPase mnmE;       
   14::473     1e-36  32%  473 aa  MNME_PELLD RecName: Full=tRNA modification GTPase mnmE;       
    5::289     6e-36  35%  464 aa  MNME_ROSCS RecName: Full=tRNA modification GTPase mnmE;       
   10::495     2e-35  30%  495 aa  MNME_TREPS RecName: Full=tRNA modification GTPase mnmE;       
   10::495     2e-35  30%  495 aa  MNME_TREPA RecName: Full=tRNA modification GTPase mnmE;       
   26::288     3e-35  35%  448 aa  MNME_XANAC RecName: Full=tRNA modification GTPase mnmE;       
   24::286     3e-34  35%  446 aa  MNME_XANC5 RecName: Full=tRNA modification GTPase mnmE;       
   24::286     4e-34  35%  446 aa  MNME_XANOP RecName: Full=tRNA modification GTPase mnmE;       
   24::286     1e-33  35%  446 aa  MNME_XANOR RecName: Full=tRNA modification GTPase mnmE;       
   24::286     1e-33  35%  446 aa  MNME_XANOM RecName: Full=tRNA modification GTPase mnmE;       
    7::465     3e-33  32%  465 aa  MNME_RHOBA RecName: Full=tRNA modification GTPase mnmE;       
   24::442     4e-28  26%  442 aa  MNME_MYXXD RecName: Full=tRNA modification GTPase mnmE;       
    1::269     6e-22  28%  438 aa  MNME_CARRP RecName: Full=tRNA modification GTPase mnmE;       
  156::267     2e-18  39%  440 aa  ENGA_CALS8 RecName: Full=GTP-binding protein engA;
  156::270     5e-18  40%  438 aa  ENGA_CLOPS RecName: Full=GTP-binding protein engA;
  156::270     5e-18  40%  438 aa  ENGA_CLOPE RecName: Full=GTP-binding protein engA;
  156::270     5e-18  40%  438 aa  ENGA_CLOP1 RecName: Full=GTP-binding protein engA;
  198::289     7e-18  44%  460 aa  ENGA_TREPS RecName: Full=GTP-binding protein engA;
  198::289     7e-18  44%  460 aa  ENGA_TREPA RecName: Full=GTP-binding protein engA;
  155::270     2e-17  42%  435 aa  ENGA_THELT RecName: Full=GTP-binding protein engA;
  162::276     2e-17  43%  455 aa  ENGA_HERA2 RecName: Full=GTP-binding protein engA;
  157::270     3e-17  40%  441 aa  ENGA_CLOCE RecName: Full=GTP-binding protein engA;
  157::269     1e-16  40%  441 aa  ENGA_EUBR3 RecName: Full=GTP-binding protein engA;
  175::265     1e-16  52%  433 aa  ENGA_AMOA5 RecName: Full=GTP-binding protein engA;
   98::274     2e-16  36%  442 aa  ENGA_KOSOT RecName: Full=GTP-binding protein engA;
  175::271     2e-16  42%  444 aa  ENGA_DESMR RecName: Full=GTP-binding protein engA;
  133::274     2e-16  37%  449 aa  ENGA_CHLSY RecName: Full=GTP-binding protein engA;
  133::274     2e-16  37%  449 aa  ENGA_CHLAA RecName: Full=GTP-binding protein engA;
  177::270     3e-16  47%  440 aa  ENGA_FUSNN RecName: Full=GTP-binding protein engA;
  152::262     3e-16  37%  438 aa  ENGA_DEIRA RecName: Full=GTP-binding protein engA;
  177::269     3e-16  46%  438 aa  ENGA_CLOBB RecName: Full=GTP-binding protein engA;
  177::269     3e-16  46%  438 aa  ENGA_CLOBA RecName: Full=GTP-binding protein engA;
  182::274     4e-16  44%  450 aa  ENGA_DESAD RecName: Full=GTP-binding protein engA;
  174::355     4e-16  36%  433 aa  ENGA_BORBU RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAHJ RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAAW RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAAT RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAAS RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAAR RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAAN RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAAM RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAAE RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAAC RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAA9 RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAA8 RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAA3 RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAA2 RecName: Full=GTP-binding protein engA;
  176::269     5e-16  41%  436 aa  ENGA_STAA1 RecName: Full=GTP-binding protein engA;
  173::265     5e-16  44%  436 aa  ENGA_MYCAP RecName: Full=GTP-binding protein engA;
  177::268     5e-16  47%  438 aa  ENGA_CLOB8 RecName: Full=GTP-binding protein engA;
    2::90      5e-16  44%  487 aa  ENGA_CHLPN RecName: Full=GTP-binding protein engA;
  177::270     5e-16  41%  440 aa  ENGA_CARHZ RecName: Full=GTP-binding protein engA;
  150::269     6e-16  38%  435 aa  ENGA_CYTH3 RecName: Full=GTP-binding protein engA;
  177::268     6e-16  46%  438 aa  ENGA_CLOK5 RecName: Full=GTP-binding protein engA;
  177::268     6e-16  46%  438 aa  ENGA_CLOK1 RecName: Full=GTP-binding protein engA;
  156::268     8e-16  40%  439 aa  ENGA_CLOBH RecName: Full=GTP-binding protein engA;
  156::268     8e-16  40%  439 aa  ENGA_CLOB1 RecName: Full=GTP-binding protein engA;
  174::355     8e-16  35%  433 aa  ENGA_BORAP RecName: Full=GTP-binding protein engA;
  177::270     8e-16  46%  440 aa  ENGA_ALKOO RecName: Full=GTP-binding protein engA;
  176::269     1e-15  40%  436 aa  ENGA_STAES RecName: Full=GTP-binding protein engA;
  176::269     1e-15  40%  436 aa  ENGA_STAEQ RecName: Full=GTP-binding protein engA;
  128::268     1e-15  36%  440 aa  ENGA_ALKMQ RecName: Full=GTP-binding protein engA;
  228::318     1e-15  45%  489 aa  ENGA_LEPIN RecName: Full=GTP-binding protein engA;
  228::318     1e-15  45%  489 aa  ENGA_LEPIC RecName: Full=GTP-binding protein engA;
  179::269     1e-15  46%  441 aa  ENGA_EUBE2 RecName: Full=GTP-binding protein engA;
  156::268     1e-15  40%  439 aa  ENGA_CLOBM RecName: Full=GTP-binding protein engA;
  156::268     1e-15  40%  439 aa  ENGA_CLOBL RecName: Full=GTP-binding protein engA;
  156::268     1e-15  40%  439 aa  ENGA_CLOBJ RecName: Full=GTP-binding protein engA;
  156::268     2e-15  34%  441 aa  ENGA_DESHY RecName: Full=GTP-binding protein engA;
  156::268     2e-15  34%  441 aa  ENGA_DESHD RecName: Full=GTP-binding protein engA;
  156::268     2e-15  40%  439 aa  ENGA_CLOBK RecName: Full=GTP-binding protein engA;
    6::213     2e-15  30%  290 aa  ERA_MYCAP RecName: Full=GTP-binding protein era homolog;
  177::273     2e-15  40%  439 aa  ENGA_THENN RecName: Full=GTP-binding protein engA;
  176::269     2e-15  41%  436 aa  ENGA_STACT RecName: Full=GTP-binding protein engA;
  144::268     2e-15  39%  435 aa  ENGA_MYCCT RecName: Full=GTP-binding protein engA;
  226::316     2e-15  43%  487 aa  ENGA_LEPBL RecName: Full=GTP-binding protein engA;
  226::316     2e-15  43%  487 aa  ENGA_LEPBJ RecName: Full=GTP-binding protein engA;
    2::90      2e-15  42%  474 aa  ENGA_CHLAB RecName: Full=GTP-binding protein engA;
  130::271     3e-15  33%  442 aa  ENGA_HELMI RecName: Full=GTP-binding protein engA;
  156::268     4e-15  37%  438 aa  ENGA_FINM2 RecName: Full=GTP-binding protein engA;
  177::268     4e-15  42%  438 aa  ENGA_CLONN RecName: Full=GTP-binding protein engA;
  155::273     5e-15  42%  439 aa  ENGA_THEP1 RecName: Full=GTP-binding protein engA;
  151::273     5e-15  37%  439 aa  ENGA_THEMA RecName: Full=GTP-binding protein engA;AltName:
  176::269     5e-15  40%  436 aa  ENGA_STAS1 RecName: Full=GTP-binding protein engA;
  175::266     5e-15  42%  439 aa  ENGA_DESRM RecName: Full=GTP-binding protein engA;
  176::266     7e-15  43%  438 aa  ENGA_MOOTA RecName: Full=GTP-binding protein engA;
  177::270     7e-15  45%  438 aa  ENGA_CLOTE RecName: Full=GTP-binding protein engA;
  151::273     9e-15  37%  439 aa  ENGA_THESQ RecName: Full=GTP-binding protein engA;
  176::269     9e-15  40%  436 aa  ENGA_LISW6 RecName: Full=GTP-binding protein engA;
  176::269     9e-15  40%  436 aa  ENGA_LISMO RecName: Full=GTP-binding protein engA;
  176::269     9e-15  40%  436 aa  ENGA_LISMH RecName: Full=GTP-binding protein engA;
  176::269     9e-15  40%  436 aa  ENGA_LISMF RecName: Full=GTP-binding protein engA;
  176::269     9e-15  40%  436 aa  ENGA_LISMC RecName: Full=GTP-binding protein engA;
  176::269     9e-15  40%  436 aa  ENGA_LISIN RecName: Full=GTP-binding protein engA;
  173::265     9e-15  40%  441 aa  ENGA_DEIGD RecName: Full=GTP-binding protein engA;
  157::271     9e-15  36%  440 aa  ENGA_CLOTH RecName: Full=GTP-binding protein engA;
  174::269     9e-15  40%  467 aa  ENGA_CHRSD RecName: Full=GTP-binding protein engA;
  187::281     1e-14  44%  453 aa  ENGA_LAWIP RecName: Full=GTP-binding protein engA;
  173::262     1e-14  41%  441 aa  ENGA_DEIDV RecName: Full=GTP-binding protein engA;
  133::274     1e-14  36%  449 aa  ENGA_CHLAD RecName: Full=GTP-binding protein engA;
  156::268     2e-14  38%  439 aa  ENGA_CLOB6 RecName: Full=GTP-binding protein engA;
    2::90      2e-14  40%  474 aa  ENGA_CHLCV RecName: Full=GTP-binding protein engA;
  180::274     2e-14  39%  447 aa  ENGA_RALME RecName: Full=GTP-binding protein engA;
  180::274     2e-14  40%  447 aa  ENGA_RALEJ RecName: Full=GTP-binding protein engA;
  183::274     2e-14  39%  459 aa  ENGA_MYXXD RecName: Full=GTP-binding protein engA;
  180::274     2e-14  40%  447 aa  ENGA_CUPTR RecName: Full=GTP-binding protein engA;
  171::273     2e-14  40%  445 aa  ENGA_BURXL RecName: Full=GTP-binding protein engA;
  177::269     2e-14  42%  437 aa  ENGA_BACV8 RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACHK RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACCZ RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACCR RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACCQ RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACC7 RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACC4 RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACC3 RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACC1 RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACC0 RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACAN RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACAH RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACAC RecName: Full=GTP-binding protein engA;
  176::269     2e-14  37%  436 aa  ENGA_BACAA RecName: Full=GTP-binding protein engA;
  177::268     2e-14  47%  453 aa  ENGA_ANAVT RecName: Full=GTP-binding protein engA;
  176::269     3e-14  41%  454 aa  ENGA_RHOBA RecName: Full=GTP-binding protein engA;
  144::268     3e-14  38%  435 aa  ENGA_MYCMS RecName: Full=GTP-binding protein engA;
  166::269     3e-14  35%  440 aa  ENGA_GEOBB RecName: Full=GTP-binding protein engA;
  179::271     3e-14  41%  437 aa  ENGA_FLAJ1 RecName: Full=GTP-binding protein engA;
  174::269     3e-14  44%  435 aa  ENGA_CHLPB RecName: Full=GTP-binding protein engA;
  177::269     3e-14  42%  437 aa  ENGA_BACTN RecName: Full=GTP-binding protein engA;
  176::269     3e-14  37%  436 aa  ENGA_BACCN RecName: Full=GTP-binding protein engA;
  177::268     3e-14  47%  453 aa  ENGA_ANASP RecName: Full=GTP-binding protein engA;
  156::255     4e-14  39%  440 aa  ENGA_PELTS RecName: Full=GTP-binding protein engA;
  179::273     4e-14  40%  445 aa  ENGA_BURPP RecName: Full=GTP-binding protein engA;
  177::270     5e-14  45%  452 aa  ENGA_SYNR3 RecName: Full=GTP-binding protein engA;
  183::351     5e-14  35%  447 aa  ENGA_PERMH RecName: Full=GTP-binding protein engA;
  176::269     5e-14  40%  458 aa  ENGA_DESOH RecName: Full=GTP-binding protein engA;
  155::270     6e-14  38%  437 aa  ENGA_PORGI RecName: Full=GTP-binding protein engA;
  100::271     6e-14  32%  440 aa  ENGA_NATTJ RecName: Full=GTP-binding protein engA;
  155::269     6e-14  32%  436 aa  ENGA_GEOTN RecName: Full=GTP-binding protein engA;
    2::90      6e-14  39%  475 aa  ENGA_CHLFF RecName: Full=GTP-binding protein engA;
  181::274     8e-14  38%  454 aa  ENGA_POLSQ RecName: Full=GTP-binding protein engA;
  181::274     8e-14  38%  454 aa  ENGA_POLNS RecName: Full=GTP-binding protein engA;
  179::268     8e-14  41%  436 aa  ENGA_OCEIH RecName: Full=GTP-binding protein engA;
  155::269     8e-14  32%  436 aa  ENGA_GEOSW RecName: Full=GTP-binding protein engA;
  176::269     8e-14  37%  436 aa  ENGA_BACWK RecName: Full=GTP-binding protein engA;
  176::269     8e-14  37%  436 aa  ENGA_BACC2 RecName: Full=GTP-binding protein engA;
    4::91      1e-13  43%  470 aa  ENGA_WOLSU RecName: Full=GTP-binding protein engA;
  168::268     1e-13  44%  453 aa  ENGA_TRIEI RecName: Full=GTP-binding protein engA;
  177::269     1e-13  36%  440 aa  ENGA_GEOSM RecName: Full=GTP-binding protein engA;
  174::265     1e-13  37%  445 aa  ENGA_DESAA RecName: Full=GTP-binding protein engA;
  157::269     1e-13  41%  455 aa  ENGA_SYNPW RecName: Full=GTP-binding protein engA;
  179::270     1e-13  46%  459 aa  ENGA_SYNJA RecName: Full=GTP-binding protein engA;
  179::270     1e-13  38%  446 aa  ENGA_SYNFM RecName: Full=GTP-binding protein engA;
    3::92      1e-13  47%  494 aa  ENGA_SULDN RecName: Full=GTP-binding protein engA;
  175::266     1e-13  41%  435 aa  ENGA_LACJO RecName: Full=GTP-binding protein engA;
  159::278     2e-13  41%  448 aa  ENGA_THEYD RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRZT RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRZP RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRZJ RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRR6 RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRPS RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRPN RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRPJ RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRPI RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRP7 RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRP4 RecName: Full=GTP-binding protein engA;
  175::269     2e-13  39%  436 aa  ENGA_STRP2 RecName: Full=GTP-binding protein engA;
  175::271     2e-13  38%  473 aa  ENGA_PSYWF RecName: Full=GTP-binding protein engA;
  177::269     2e-13  42%  437 aa  ENGA_PARD8 RecName: Full=GTP-binding protein engA;
  176::268     2e-13  38%  434 aa  ENGA_GRAFK RecName: Full=GTP-binding protein engA;
  176::269     2e-13  37%  436 aa  ENGA_GEOKA RecName: Full=GTP-binding protein engA;
    3::92      2e-13  44%  462 aa  ENGA_NITSB RecName: Full=GTP-binding protein engA;
  144::269     2e-13  35%  436 aa  ENGA_LACLS RecName: Full=GTP-binding protein engA;
  144::269     2e-13  35%  436 aa  ENGA_LACLM RecName: Full=GTP-binding protein engA;
  178::270     2e-13  38%  436 aa  ENGA_FLAPJ RecName: Full=GTP-binding protein engA;
  205::298     2e-13  36%  492 aa  ENGA_ENTS8 RecName: Full=GTP-binding protein engA;
  174::268     2e-13  44%  452 aa  ENGA_CYAA5 RecName: Full=GTP-binding protein engA;
  177::270     2e-13  37%  437 aa  ENGA_BREBN RecName: Full=GTP-binding protein engA;
  176::269     2e-13  37%  436 aa  ENGA_BACP2 RecName: Full=GTP-binding protein engA;
  199::291     3e-13  45%  461 aa  ENGA_NAUPA RecName: Full=GTP-binding protein engA;
  166::269     3e-13  37%  436 aa  ENGA_LACPL RecName: Full=GTP-binding protein engA;
  175::269     3e-13  40%  436 aa  ENGA_LACLA RecName: Full=GTP-binding protein engA;
   11::160     3e-13  31%  461 aa  ENGA_HELPH RecName: Full=GTP-binding protein engA;
  175::269     3e-13  39%  436 aa  ENGA_ENTFA RecName: Full=GTP-binding protein engA;
  179::271     3e-13  42%  438 aa  ENGA_CHLP8 RecName: Full=GTP-binding protein engA;
  179::273     3e-13  39%  445 aa  ENGA_BURVG RecName: Full=GTP-binding protein engA;
  179::273     3e-13  39%  445 aa  ENGA_BURS3 RecName: Full=GTP-binding protein engA;
  179::273     3e-13  39%  445 aa  ENGA_BURM1 RecName: Full=GTP-binding protein engA;
  179::273     3e-13  39%  445 aa  ENGA_BURCM RecName: Full=GTP-binding protein engA;
  179::273     3e-13  39%  445 aa  ENGA_BURCJ RecName: Full=GTP-binding protein engA;
  179::273     3e-13  39%  445 aa  ENGA_BURCH RecName: Full=GTP-binding protein engA;
  179::273     3e-13  39%  445 aa  ENGA_BURCC RecName: Full=GTP-binding protein engA;
  179::273     3e-13  39%  445 aa  ENGA_BURCA RecName: Full=GTP-binding protein engA;
  179::273     3e-13  39%  445 aa  ENGA_BURA4 RecName: Full=GTP-binding protein engA;
  177::267     4e-13  46%  453 aa  ENGA_SYNP2 RecName: Full=GTP-binding protein engA;
  175::269     4e-13  38%  436 aa  ENGA_STRPZ RecName: Full=GTP-binding protein engA;
  175::269     4e-13  38%  436 aa  ENGA_STRPM RecName: Full=GTP-binding protein engA;
  175::269     4e-13  38%  436 aa  ENGA_STRPF RecName: Full=GTP-binding protein engA;
  175::269     4e-13  38%  436 aa  ENGA_STRPD RecName: Full=GTP-binding protein engA;
  175::269     4e-13  38%  436 aa  ENGA_STRPC RecName: Full=GTP-binding protein engA;
  175::269     4e-13  38%  436 aa  ENGA_STRPB RecName: Full=GTP-binding protein engA;
  175::269     4e-13  38%  436 aa  ENGA_STRP8 RecName: Full=GTP-binding protein engA;
  175::269     4e-13  38%  436 aa  ENGA_STRP6 RecName: Full=GTP-binding protein engA;
  175::269     4e-13  38%  436 aa  ENGA_STRP3 RecName: Full=GTP-binding protein engA;
  175::269     4e-13  38%  436 aa  ENGA_STRP1 RecName: Full=GTP-binding protein engA;
  176::269     4e-13  36%  436 aa  ENGA_MACCJ RecName: Full=GTP-binding protein engA;
  175::268     4e-13  38%  435 aa  ENGA_LACBA RecName: Full=GTP-binding protein engA;
   11::165     4e-13  31%  462 aa  ENGA_HELPJ RecName: Full=GTP-binding protein engA;
  175::274     4e-13  38%  446 aa  ENGA_BURP8 RecName: Full=GTP-binding protein engA;
  177::269     4e-13  40%  437 aa  ENGA_BACFR RecName: Full=GTP-binding protein engA;
  177::269     4e-13  40%  437 aa  ENGA_BACFN RecName: Full=GTP-binding protein engA;
  174::268     4e-13  44%  433 aa  ENGA_AQUAE RecName: Full=GTP-binding protein engA;
  178::269     5e-13  46%  455 aa  ENGA_SYNPX RecName: Full=GTP-binding protein engA;
  179::270     5e-13  46%  459 aa  ENGA_SYNJB RecName: Full=GTP-binding protein engA;
  180::274     5e-13  37%  447 aa  ENGA_RALSO RecName: Full=GTP-binding protein engA;
  156::270     5e-13  36%  436 aa  ENGA_PROA2 RecName: Full=GTP-binding protein engA;
   11::165     5e-13  30%  460 aa  ENGA_HELPG RecName: Full=GTP-binding protein engA;
   11::165     5e-13  30%  462 aa  ENGA_HELP2 RecName: Full=GTP-binding protein engA;
  190::281     5e-13  39%  492 aa  ENGA_DESAH RecName: Full=GTP-binding protein engA;
  177::268     5e-13  46%  452 aa  ENGA_CYAP8 RecName: Full=GTP-binding protein engA;
  176::267     5e-13  40%  435 aa  ENGA_CHLT3 RecName: Full=GTP-binding protein engA;
    3::94      5e-13  41%  461 aa  ENGA_CAMC5 RecName: Full=GTP-binding protein engA;
  190::295     5e-13  38%  463 aa  ENGA_BIFLO RecName: Full=GTP-binding protein engA;
  190::280     5e-13  42%  464 aa  ENGA_AKKM8 RecName: Full=GTP-binding protein engA;
  180::272     7e-13  38%  437 aa  ENGA_THEM4 RecName: Full=GTP-binding protein engA;
  178::269     7e-13  44%  455 aa  ENGA_SYNS9 RecName: Full=GTP-binding protein engA;
  200::293     7e-13  37%  491 aa  ENGA_SHEDO RecName: Full=GTP-binding protein engA;
  180::274     7e-13  37%  447 aa  ENGA_RALPJ RecName: Full=GTP-binding protein engA;
  168::271     7e-13  36%  473 aa  ENGA_PSYA2 RecName: Full=GTP-binding protein engA;
  181::274     7e-13  39%  447 aa  ENGA_JANMA RecName: Full=GTP-binding protein engA;
  178::269     7e-13  41%  437 aa  ENGA_CHLTE RecName: Full=GTP-binding protein engA;
  179::273     7e-13  39%  445 aa  ENGA_BURPS RecName: Full=GTP-binding protein engA;
  179::273     7e-13  39%  445 aa  ENGA_BURP6 RecName: Full=GTP-binding protein engA;
  179::273     7e-13  39%  445 aa  ENGA_BURP0 RecName: Full=GTP-binding protein engA;
  179::273     7e-13  39%  445 aa  ENGA_BURM9 RecName: Full=GTP-binding protein engA;
  179::273     7e-13  39%  445 aa  ENGA_BURM7 RecName: Full=GTP-binding protein engA;
  159::269     7e-13  32%  436 aa  ENGA_BACLD RecName: Full=GTP-binding protein engA;
  190::303     9e-13  32%  498 aa  ENGA_VIBHB RecName: Full=GTP-binding protein engA;
  175::269     9e-13  38%  436 aa  ENGA_STRSY RecName: Full=GTP-binding protein engA;
  175::269     9e-13  38%  436 aa  ENGA_STRS2 RecName: Full=GTP-binding protein engA;
  144::269     9e-13  35%  436 aa  ENGA_STRMU RecName: Full=GTP-binding protein engA;
  155::270     9e-13  33%  465 aa  ENGA_STRMK RecName: Full=GTP-binding protein engA;
  172::292     9e-13  33%  487 aa  ENGA_PSEHT RecName: Full=GTP-binding protein engA;
  178::269     9e-13  47%  456 aa  ENGA_PROM4 RecName: Full=GTP-binding protein engA;
  178::267     9e-13  47%  452 aa  ENGA_MICAN RecName: Full=GTP-binding protein engA;
   11::163     9e-13  31%  461 aa  ENGA_HELPS RecName: Full=GTP-binding protein engA;
  231::322     9e-13  38%  495 aa  ENGA_DESVV RecName: Full=GTP-binding protein engA;
  227::318     9e-13  38%  491 aa  ENGA_DESVH RecName: Full=GTP-binding protein engA;
  155::264     9e-13  35%  443 aa  ENGA_DECAR RecName: Full=GTP-binding protein engA;
  177::268     9e-13  46%  452 aa  ENGA_CYAP7 RecName: Full=GTP-binding protein engA;
    3::92      9e-13  39%  462 aa  ENGA_CAMC1 RecName: Full=GTP-binding protein engA;
  186::278     9e-13  37%  451 aa  ENGA_BORPE RecName: Full=GTP-binding protein engA;
  186::278     9e-13  37%  451 aa  ENGA_BORPA RecName: Full=GTP-binding protein engA;
  186::278     9e-13  37%  451 aa  ENGA_BORBR RecName: Full=GTP-binding protein engA;
  176::269     9e-13  34%  436 aa  ENGA_BACSU RecName: Full=GTP-binding protein engA;
  153::274     1e-12  33%  439 aa  ENGA_THEAB RecName: Full=GTP-binding protein engA;
  155::270     1e-12  33%  465 aa  ENGA_STRM5 RecName: Full=GTP-binding protein engA;
  200::293     1e-12  37%  488 aa  ENGA_SHEFN RecName: Full=GTP-binding protein engA;
  177::271     1e-12  39%  480 aa  ENGA_PSYCK RecName: Full=GTP-binding protein engA;
   11::160     1e-12  31%  458 aa  ENGA_HELPY RecName: Full=GTP-binding protein engA;
  213::306     1e-12  36%  498 aa  ENGA_COLP3 RecName: Full=GTP-binding protein engA;
  176::271     1e-12  41%  443 aa  ENGA_CHLCH RecName: Full=GTP-binding protein engA;
  186::278     1e-12  36%  451 aa  ENGA_BORPD RecName: Full=GTP-binding protein engA;
  157::259     1e-12  45%  452 aa  ENGA_SYNY3 RecName: Full=GTP-binding protein engA;
  184::275     1e-12  39%  445 aa  ENGA_SULSY RecName: Full=GTP-binding protein engA;
  168::269     1e-12  38%  436 aa  ENGA_STRU0 RecName: Full=GTP-binding protein engA;
  176::266     1e-12  39%  435 aa  ENGA_MESFL RecName: Full=GTP-binding protein engA;
  152::269     1e-12  37%  436 aa  ENGA_LACS1 RecName: Full=GTP-binding protein engA;
  174::355     1e-12  32%  433 aa  ENGA_BORGA RecName: Full=GTP-binding protein engA;
  176::269     1e-12  35%  437 aa  ENGA_BACHD RecName: Full=GTP-binding protein engA;
  176::269     1e-12  35%  436 aa  ENGA_BACA2 RecName: Full=GTP-binding protein engA;
  180::268     2e-12  45%  453 aa  ENGA_SYNP6 RecName: Full=GTP-binding protein engA;
  180::268     2e-12  45%  453 aa  ENGA_SYNE7 RecName: Full=GTP-binding protein engA;
  176::269     2e-12  41%  437 aa  ENGA_PELPB RecName: Full=GTP-binding protein engA;
  189::281     2e-12  36%  460 aa  ENGA_NITHX RecName: Full=GTP-binding protein engA;
  157::268     2e-12  37%  453 aa  ENGA_ACAM1 RecName: Full=GTP-binding protein engA;
  177::269     3e-12  35%  469 aa  ENGA_THIDA RecName: Full=GTP-binding protein engA;
  175::269     3e-12  37%  436 aa  ENGA_STRPG RecName: Full=GTP-binding protein engA;
  199::292     3e-12  36%  488 aa  ENGA_SHESR RecName: Full=GTP-binding protein engA;
  199::292     3e-12  36%  488 aa  ENGA_SHESM RecName: Full=GTP-binding protein engA;
  199::292     3e-12  36%  488 aa  ENGA_SHESA RecName: Full=GTP-binding protein engA;
  199::292     3e-12  36%  487 aa  ENGA_SHEON RecName: Full=GTP-binding protein engA;
  189::288     3e-12  36%  482 aa  ENGA_PSEA6 RecName: Full=GTP-binding protein engA;
  207::300     3e-12  36%  493 aa  ENGA_PHOLL RecName: Full=GTP-binding protein engA;
  171::268     3e-12  40%  464 aa  ENGA_NITOC RecName: Full=GTP-binding protein engA;
  176::269     3e-12  38%  437 aa  ENGA_LEUCK RecName: Full=GTP-binding protein engA;
  181::274     3e-12  38%  447 aa  ENGA_HERAR RecName: Full=GTP-binding protein engA;
    4::156     3e-12  30%  487 aa  ENGA_HELHP RecName: Full=GTP-binding protein engA;
  177::269     3e-12  38%  441 aa  ENGA_GEOUR RecName: Full=GTP-binding protein engA;
  211::304     3e-12  36%  499 aa  ENGA_ERWT9 RecName: Full=GTP-binding protein engA;
    3::90      3e-12  41%  463 aa  ENGA_CAMFF RecName: Full=GTP-binding protein engA;
  171::268     3e-12  40%  439 aa  ENGA_THEPX RecName: Full=GTP-binding protein engA;
  171::268     3e-12  40%  439 aa  ENGA_THEP3 RecName: Full=GTP-binding protein engA;
  144::269     3e-12  32%  436 aa  ENGA_STRTD RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_SHIF8 RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_SHIB3 RecName: Full=GTP-binding protein engA;
  183::281     3e-12  34%  460 aa  ENGA_RHOP5 RecName: Full=GTP-binding protein engA;
  178::269     3e-12  44%  456 aa  ENGA_PROMA RecName: Full=GTP-binding protein engA;
  205::298     3e-12  35%  493 aa  ENGA_PHOPR RecName: Full=GTP-binding protein engA;
  177::267     3e-12  37%  448 aa  ENGA_PELPD RecName: Full=GTP-binding protein engA;
  177::269     3e-12  37%  441 aa  ENGA_GEOSF RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ESCF3 RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECOSM RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECOSE RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECOLU RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECOLI RecName: Full=GTP-binding protein engA;AltName:
  203::296     3e-12  35%  490 aa  ENGA_ECOLC RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECOL6 RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECOL5 RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECOHS RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECODH RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECOBW RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECO8A RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECO81 RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECO7I RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECO5E RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECO57 RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECO55 RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECO45 RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECO27 RecName: Full=GTP-binding protein engA;
  203::296     3e-12  35%  490 aa  ENGA_ECO24 RecName: Full=GTP-binding protein engA;
  157::261     3e-12  44%  453 aa  ENGA_CYAP4 RecName: Full=GTP-binding protein engA;
  211::304     3e-12  35%  500 aa  ENGA_ALISL RecName: Full=GTP-binding protein engA;
  177::268     4e-12  44%  449 aa  ENGA_THEEB RecName: Full=GTP-binding protein engA;
  144::269     4e-12  32%  436 aa  ENGA_STRGC RecName: Full=GTP-binding protein engA;
  176::270     4e-12  37%  471 aa  ENGA_SACD2 RecName: Full=GTP-binding protein engA;
  177::252     4e-12  46%  435 aa  ENGA_MYCPU RecName: Full=GTP-binding protein engA;
  175::269     4e-12  38%  436 aa  ENGA_LACSS RecName: Full=GTP-binding protein engA;
  175::269     4e-12  37%  437 aa  ENGA_LACRJ RecName: Full=GTP-binding protein engA;
  175::269     4e-12  37%  437 aa  ENGA_LACRD RecName: Full=GTP-binding protein engA;
  144::266     4e-12  35%  435 aa  ENGA_LACAC RecName: Full=GTP-binding protein engA;
  205::298     4e-12  35%  492 aa  ENGA_KLEP7 RecName: Full=GTP-binding protein engA;
  139::270     4e-12  32%  466 aa  ENGA_CELJU RecName: Full=GTP-binding protein engA;
  208::301     6e-12  35%  496 aa  ENGA_VIBVY RecName: Full=GTP-binding protein engA;
  208::301     6e-12  35%  496 aa  ENGA_VIBVU RecName: Full=GTP-binding protein engA;
  211::304     6e-12  35%  500 aa  ENGA_VIBFM RecName: Full=GTP-binding protein engA;
  211::304     6e-12  35%  500 aa  ENGA_VIBF1 RecName: Full=GTP-binding protein engA;
  175::269     6e-12  38%  436 aa  ENGA_STRT2 RecName: Full=GTP-binding protein engA;
  175::269     6e-12  38%  436 aa  ENGA_STRT1 RecName: Full=GTP-binding protein engA;
  199::292     6e-12  36%  488 aa  ENGA_SHESW RecName: Full=GTP-binding protein engA;
  199::292     6e-12  36%  488 aa  ENGA_SHEPC RecName: Full=GTP-binding protein engA;
  200::293     6e-12  36%  489 aa  ENGA_SHELP RecName: Full=GTP-binding protein engA;
  199::292     6e-12  36%  488 aa  ENGA_SHEB9 RecName: Full=GTP-binding protein engA;
  199::292     6e-12  36%  488 aa  ENGA_SHEB8 RecName: Full=GTP-binding protein engA;
  199::292     6e-12  36%  488 aa  ENGA_SHEB5 RecName: Full=GTP-binding protein engA;
  199::292     6e-12  36%  488 aa  ENGA_SHEB2 RecName: Full=GTP-binding protein engA;
  203::296     6e-12  35%  490 aa  ENGA_ENT38 RecName: Full=GTP-binding protein engA;
  203::294     6e-12  34%  490 aa  ENGA_DINSH RecName: Full=GTP-binding protein engA;
    6::94      7e-12  40%  296 aa  ERA_FUSNN RecName: Full=GTP-binding protein era homolog;
   93::270     7e-12  30%  465 aa  ENGA_XANC5 RecName: Full=GTP-binding protein engA;
   93::270     7e-12  30%  465 aa  ENGA_XANAC RecName: Full=GTP-binding protein engA;
  210::303     7e-12  34%  498 aa  ENGA_VIBPA RecName: Full=GTP-binding protein engA;
  203::298     7e-12  33%  492 aa  ENGA_SILST RecName: Full=GTP-binding protein engA;
    3::92      7e-12  38%  487 aa  ENGA_SILPO RecName: Full=GTP-binding protein engA;
  193::289     7e-12  37%  490 aa  ENGA_PSEPF RecName: Full=GTP-binding protein engA;
  193::289     7e-12  37%  490 aa  ENGA_PSEF5 RecName: Full=GTP-binding protein engA;
  150::266     7e-12  34%  435 aa  ENGA_LACDB RecName: Full=GTP-binding protein engA;
  150::266     7e-12  34%  435 aa  ENGA_LACDA RecName: Full=GTP-binding protein engA;
  175::268     7e-12  37%  435 aa  ENGA_LACCB RecName: Full=GTP-binding protein engA;
  175::268     7e-12  37%  435 aa  ENGA_LACC3 RecName: Full=GTP-binding protein engA;
  230::323     7e-12  40%  510 aa  ENGA_HYPNA RecName: Full=GTP-binding protein engA;
  184::269     7e-12  43%  438 aa  ENGA_HALOH RecName: Full=GTP-binding protein engA;
  174::270     7e-12  36%  438 aa  ENGA_GEOSL RecName: Full=GTP-binding protein engA;
  177::267     7e-12  38%  449 aa  ENGA_GEOLS RecName: Full=GTP-binding protein engA;
  176::266     7e-12  35%  438 aa  ENGA_DESAP RecName: Full=GTP-binding protein engA;
  185::277     7e-12  35%  456 aa  ENGA_BRASB RecName: Full=GTP-binding protein engA;
   93::270     1e-11  30%  465 aa  ENGA_XANOM RecName: Full=GTP-binding protein engA;
   93::270     1e-11  30%  465 aa  ENGA_XANCP RecName: Full=GTP-binding protein engA;
   93::270     1e-11  30%  465 aa  ENGA_XANCB RecName: Full=GTP-binding protein engA;
   93::270     1e-11  30%  465 aa  ENGA_XANC8 RecName: Full=GTP-binding protein engA;
  177::268     1e-11  42%  439 aa  ENGA_THETN RecName: Full=GTP-binding protein engA;
  175::269     1e-11  36%  436 aa  ENGA_STRA5 RecName: Full=GTP-binding protein engA;
  175::269     1e-11  36%  436 aa  ENGA_STRA3 RecName: Full=GTP-binding protein engA;
  175::269     1e-11  36%  436 aa  ENGA_STRA1 RecName: Full=GTP-binding protein engA;
  203::295     1e-11  35%  487 aa  ENGA_RHOSK RecName: Full=GTP-binding protein engA;
  203::295     1e-11  35%  487 aa  ENGA_RHOS5 RecName: Full=GTP-binding protein engA;
  203::295     1e-11  35%  487 aa  ENGA_RHOS4 RecName: Full=GTP-binding protein engA;
  203::295     1e-11  35%  487 aa  ENGA_RHOS1 RecName: Full=GTP-binding protein engA;
  193::289     1e-11  37%  490 aa  ENGA_PSEU2 RecName: Full=GTP-binding protein engA;
  192::288     1e-11  37%  489 aa  ENGA_PSESM RecName: Full=GTP-binding protein engA;
  193::289     1e-11  37%  490 aa  ENGA_PSE14 RecName: Full=GTP-binding protein engA;
    5::92      1e-11  38%  464 aa  ENGA_MAGSA RecName: Full=GTP-binding protein engA;
  175::266     1e-11  37%  435 aa  ENGA_LACH4 RecName: Full=GTP-binding protein engA;
  189::290     1e-11  37%  462 aa  ENGA_HELAH RecName: Full=GTP-binding protein engA;
  210::303     1e-11  36%  496 aa  ENGA_HAMD5 RecName: Full=GTP-binding protein engA;
  203::296     1e-11  35%  490 aa  ENGA_CITK8 RecName: Full=GTP-binding protein engA;
    5::91      1e-11  37%  506 aa  ENGA_ACTP7 RecName: Full=GTP-binding protein engA;
    5::91      1e-11  37%  506 aa  ENGA_ACTP2 RecName: Full=GTP-binding protein engA;
  155::270     1e-11  32%  465 aa  ENGA_XYLFM RecName: Full=GTP-binding protein engA;
  212::305     1e-11  36%  498 aa  ENGA_TOLAT RecName: Full=GTP-binding protein engA;
  175::269     1e-11  37%  436 aa  ENGA_STRSV RecName: Full=GTP-binding protein engA;
  200::293     1e-11  34%  488 aa  ENGA_SHEWM RecName: Full=GTP-binding protein engA;
  177::268     1e-11  41%  436 aa  ENGA_PELLD RecName: Full=GTP-binding protein engA;
  177::237     1e-11  54%  456 aa  ENGA_NOSP7 RecName: Full=GTP-binding protein engA;
  180::273     1e-11  39%  449 aa  ENGA_MYCPN RecName: Full=GTP-binding protein engA;
  144::266     1e-11  32%  444 aa  ENGA_MYCPE RecName: Full=GTP-binding protein engA;
  179::272     1e-11  40%  448 aa  ENGA_MYCGE RecName: Full=GTP-binding protein engA;
    5::91      1e-11  37%  504 aa  ENGA_HAEPS RecName: Full=GTP-binding protein engA;
  207::300     1e-11  34%  494 aa  ENGA_EDWI9 RecName: Full=GTP-binding protein engA;
  194::287     1e-11  35%  481 aa  ENGA_ALTMD RecName: Full=GTP-binding protein engA;
    5::91      1e-11  37%  506 aa  ENGA_ACTPJ RecName: Full=GTP-binding protein engA;
  200::293     2e-11  35%  490 aa  ENGA_SHEPA RecName: Full=GTP-binding protein engA;
  200::293     2e-11  35%  490 aa  ENGA_SHEHH RecName: Full=GTP-binding protein engA;
  200::293     2e-11  34%  488 aa  ENGA_SHEAM RecName: Full=GTP-binding protein engA;
  190::286     2e-11  35%  487 aa  ENGA_PSEPK RecName: Full=GTP-binding protein engA;
  190::286     2e-11  35%  487 aa  ENGA_PSEPG RecName: Full=GTP-binding protein engA;
  190::286     2e-11  35%  488 aa  ENGA_PSEE4 RecName: Full=GTP-binding protein engA;
  195::291     2e-11  36%  493 aa  ENGA_PSEAE RecName: Full=GTP-binding protein engA;
  195::291     2e-11  36%  493 aa  ENGA_PSEA8 RecName: Full=GTP-binding protein engA;
  195::291     2e-11  36%  493 aa  ENGA_PSEA7 RecName: Full=GTP-binding protein engA;
  177::268     2e-11  39%  436 aa  ENGA_PROVI RecName: Full=GTP-binding protein engA;
  185::277     2e-11  35%  456 aa  ENGA_BRASO RecName: Full=GTP-binding protein engA;
  184::345     2e-11  31%  475 aa  ENGA_BARHE RecName: Full=GTP-binding protein engA;
  200::293     2e-11  35%  490 aa  ENGA_SHEPW RecName: Full=GTP-binding protein engA;
  203::296     2e-11  34%  490 aa  ENGA_SALTY RecName: Full=GTP-binding protein engA;
  203::296     2e-11  34%  490 aa  ENGA_SALTI RecName: Full=GTP-binding protein engA;
  203::296     2e-11  34%  490 aa  ENGA_SALPK RecName: Full=GTP-binding protein engA;
  203::296     2e-11  34%  490 aa  ENGA_SALPC RecName: Full=GTP-binding protein engA;
  203::296     2e-11  34%  490 aa  ENGA_SALPB RecName: Full=GTP-binding protein engA;
  203::296     2e-11  34%  490 aa  ENGA_SALPA RecName: Full=GTP-binding protein engA;
  203::296     2e-11  34%  490 aa  ENGA_SALNS RecName: Full=GTP-binding protein engA;
  203::296     2e-11  34%  490 aa  ENGA_SALG2 RecName: Full=GTP-binding protein engA;
  203::296     2e-11  34%  490 aa  ENGA_SALEP RecName: Full=GTP-binding protein engA;
  203::296     2e-11  34%  490 aa  ENGA_SALCH RecName: Full=GTP-binding protein engA;
  201::297     2e-11  36%  499 aa  ENGA_PSEU5 RecName: Full=GTP-binding protein engA;
  190::286     2e-11  35%  487 aa  ENGA_PSEP1 RecName: Full=GTP-binding protein engA;
  195::291     2e-11  36%  493 aa  ENGA_PSEAB RecName: Full=GTP-binding protein engA;
  209::302     2e-11  34%  496 aa  ENGA_PROMH RecName: Full=GTP-binding protein engA;
  192::285     2e-11  35%  479 aa  ENGA_IDILO RecName: Full=GTP-binding protein engA;
    6::92      2e-11  38%  504 aa  ENGA_HAEIN RecName: Full=GTP-binding protein engA;
  183::275     2e-11  35%  467 aa  ENGA_ALHEH RecName: Full=GTP-binding protein engA;
  185::275     3e-11  42%  460 aa  ENGA_THERP RecName: Full=GTP-binding protein engA;
  178::270     3e-11  36%  471 aa  ENGA_SYMTH RecName: Full=GTP-binding protein engA;
  229::287     3e-11  51%  491 aa  ENGA_STRAW RecName: Full=GTP-binding protein engA;
  194::290     3e-11  35%  492 aa  ENGA_PSEMY RecName: Full=GTP-binding protein engA;
  157::271     3e-11  33%  487 aa  ENGA_PARUW RecName: Full=GTP-binding protein engA;
  176::270     3e-11  32%  473 aa  ENGA_MARAV RecName: Full=GTP-binding protein engA;
  203::313     3e-11  29%  510 aa  ENGA_HAEDU RecName: Full=GTP-binding protein engA;
    4::92      3e-11  40%  461 aa  ENGA_CAMLR RecName: Full=GTP-binding protein engA;
  204::343     3e-11  34%  474 aa  ENGA_BART1 RecName: Full=GTP-binding protein engA;
  193::289     3e-11  36%  491 aa  ENGA_AZOVD RecName: Full=GTP-binding protein engA;
    5::94      4e-11  38%  447 aa  ENGA_VARPS RecName: Full=GTP-binding protein engA;
  200::293     4e-11  33%  488 aa  ENGA_SHESH RecName: Full=GTP-binding protein engA;
  176::267     4e-11  33%  469 aa  ENGA_CHRVO RecName: Full=GTP-binding protein engA;
  180::269     4e-11  40%  437 aa  ENGA_CHLPD RecName: Full=GTP-binding protein engA;
  227::318     4e-11  38%  490 aa  ENGA_CHLMU RecName: Full=GTP-binding protein engA;
  199::291     4e-11  39%  460 aa  ENGA_CAMHC RecName: Full=GTP-binding protein engA;
  178::268     4e-11  35%  442 aa  ENGA_AZOSB RecName: Full=GTP-binding protein engA;
  187::280     4e-11  36%  453 aa  ENGA_AZOC5 RecName: Full=GTP-binding protein engA;
  175::270     4e-11  39%  469 aa  ENGA_ACIBY RecName: Full=GTP-binding protein engA;
  175::270     4e-11  39%  469 aa  ENGA_ACIBT RecName: Full=GTP-binding protein engA;
  175::270     4e-11  39%  469 aa  ENGA_ACIBS RecName: Full=GTP-binding protein engA;
  175::270     4e-11  39%  469 aa  ENGA_ACIBC RecName: Full=GTP-binding protein engA;
  175::270     4e-11  39%  469 aa  ENGA_ACIB5 RecName: Full=GTP-binding protein engA;
  175::270     4e-11  39%  469 aa  ENGA_ACIB3 RecName: Full=GTP-binding protein engA;
    5::92      4e-11  39%  447 aa  ENGA_ACIAC RecName: Full=GTP-binding protein engA;
  203::261     5e-11  49%  465 aa  ENGA_STRCO RecName: Full=GTP-binding protein engA;
    5::92      5e-11  36%  479 aa  ENGA_JANSC RecName: Full=GTP-binding protein engA;
  179::265     5e-11  40%  436 aa  ENGA_GEMAT RecName: Full=GTP-binding protein engA;
  188::280     5e-11  34%  460 aa  ENGA_BRAJA RecName: Full=GTP-binding protein engA;
  184::297     5e-11  33%  477 aa  ENGA_BARQU RecName: Full=GTP-binding protein engA;
    4::221     6e-11  27%  301 aa  ERA_BACSU RecName: Full=GTP-binding protein era homolog;AltName:
  206::299     6e-11  34%  493 aa  ENGA_VIBSL RecName: Full=GTP-binding protein engA;
  189::281     6e-11  34%  460 aa  ENGA_RHOPS RecName: Full=GTP-binding protein engA;
  188::280     6e-11  34%  459 aa  ENGA_RHOP2 RecName: Full=GTP-binding protein engA;
  199::289     6e-11  33%  489 aa  ENGA_PARDP RecName: Full=GTP-binding protein engA;
  184::276     6e-11  34%  455 aa  ENGA_NITWN RecName: Full=GTP-binding protein engA;
    1::69      6e-11  43%  490 aa  ENGA_CHLTR RecName: Full=GTP-binding protein engA;
    1::69      6e-11  43%  490 aa  ENGA_CHLTB RecName: Full=GTP-binding protein engA;
    1::69      6e-11  43%  490 aa  ENGA_CHLTA RecName: Full=GTP-binding protein engA;
    1::69      6e-11  43%  490 aa  ENGA_CHLT2 RecName: Full=GTP-binding protein engA;
  174::279     6e-11  33%  471 aa  ENGA_ALCBS RecName: Full=GTP-binding protein engA;
    8::206     8e-11  29%  298 aa  ERA_THETN RecName: Full=GTP-binding protein era homolog;
    1::89      8e-11  43%  295 aa  ERA_CLOBA RecName: Full=GTP-binding protein era homolog;
    6::95      8e-11  43%  301 aa  ERA_AQUAE RecName: Full=GTP-binding protein era homolog;
  208::299     8e-11  34%  495 aa  ENGA_YERPY RecName: Full=GTP-binding protein engA;
  208::299     8e-11  34%  495 aa  ENGA_YERPS RecName: Full=GTP-binding protein engA;
  208::299     8e-11  34%  495 aa  ENGA_YERPP RecName: Full=GTP-binding protein engA;
  208::299     8e-11  34%  495 aa  ENGA_YERPN RecName: Full=GTP-binding protein engA;
  208::299     8e-11  34%  495 aa  ENGA_YERPG RecName: Full=GTP-binding protein engA;
  208::299     8e-11  34%  495 aa  ENGA_YERPE RecName: Full=GTP-binding protein engA;
  208::299     8e-11  34%  495 aa  ENGA_YERPB RecName: Full=GTP-binding protein engA;
  208::299     8e-11  34%  495 aa  ENGA_YERPA RecName: Full=GTP-binding protein engA;
  208::299     8e-11  34%  495 aa  ENGA_YERP3 RecName: Full=GTP-binding protein engA;
  177::271     8e-11  32%  464 aa  ENGA_THISH RecName: Full=GTP-binding protein engA;
  188::280     8e-11  34%  459 aa  ENGA_RHOPT RecName: Full=GTP-binding protein engA;
  188::280     8e-11  34%  459 aa  ENGA_RHOPA RecName: Full=GTP-binding protein engA;
  190::286     8e-11  34%  487 aa  ENGA_PSEPW RecName: Full=GTP-binding protein engA;
    5::92      8e-11  36%  447 aa  ENGA_POLSJ RecName: Full=GTP-binding protein engA;
  180::271     8e-11  33%  445 aa  ENGA_POLNA RecName: Full=GTP-binding protein engA;
    6::92      8e-11  36%  510 aa  ENGA_PASMU RecName: Full=GTP-binding protein engA;
    1::89      1e-10  43%  295 aa  ERA_CLOBB RecName: Full=GTP-binding protein era homolog;
    1::89      1e-10  43%  298 aa  ERA_CLOB8 RecName: Full=GTP-binding protein era homolog;
  207::298     1e-10  34%  494 aa  ENGA_YERE8 RecName: Full=GTP-binding protein engA;
  155::270     1e-10  32%  465 aa  ENGA_XYLFT RecName: Full=GTP-binding protein engA;
  155::270     1e-10  32%  465 aa  ENGA_XYLF2 RecName: Full=GTP-binding protein engA;
    5::92      1e-10  44%  458 aa  ENGA_XANP2 RecName: Full=GTP-binding protein engA;
  208::301     1e-10  34%  494 aa  ENGA_SERP5 RecName: Full=GTP-binding protein engA;
    5::92      1e-10  36%  492 aa  ENGA_ROSDO RecName: Full=GTP-binding protein engA;
    5::94      1e-10  37%  447 aa  ENGA_RHOFD RecName: Full=GTP-binding protein engA;
  175::268     1e-10  36%  436 aa  ENGA_LEUMM RecName: Full=GTP-binding protein engA;
  175::269     1e-10  35%  437 aa  ENGA_LACF3 RecName: Full=GTP-binding protein engA;
  152::295     1e-10  32%  474 aa  ENGA_AGRVS RecName: Full=GTP-binding protein engA;
  213::306     1e-10  32%  499 aa  ENGA_AERS4 RecName: Full=GTP-binding protein engA;
  213::306     1e-10  32%  499 aa  ENGA_AERHH RecName: Full=GTP-binding protein engA;
   11::97      1e-10  44%  301 aa  ERA_SHISS RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_SHIFL RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_SHIF8 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_SHIDS RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_SHIBS RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_SHIB3 RecName: Full=GTP-binding protein era homolog;
    5::103     1e-10  39%  295 aa  ERA_RICBR RecName: Full=GTP-binding protein era homolog;
    5::103     1e-10  39%  295 aa  ERA_RICB8 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ESCF3 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  45%  301 aa  ERA_ENT38 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECOUT RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECOSM RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECOSE RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECOLU RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECOLI RecName: Full=GTP-binding protein era;
   11::97      1e-10  44%  301 aa  ERA_ECOLC RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECOL6 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECOL5 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECOK1 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECOHS RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECODH RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECOBW RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECO8A RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECO81 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECO7I RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECO5E RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECO57 RecName: Full=GTP-binding protein era;
   11::97      1e-10  44%  301 aa  ERA_ECO55 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECO45 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECO27 RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_ECO24 RecName: Full=GTP-binding protein era homolog;
    8::206     1e-10  28%  298 aa  ERA_CLOCE RecName: Full=GTP-binding protein era homolog;
   11::97      1e-10  44%  301 aa  ERA_CITK8 RecName: Full=GTP-binding protein era homolog;
  206::299     1e-10  34%  494 aa  ENGA_VIBCM RecName: Full=GTP-binding protein engA;
  206::299     1e-10  34%  494 aa  ENGA_VIBCH RecName: Full=GTP-binding protein engA;
  206::299     1e-10  34%  494 aa  ENGA_VIBC3 RecName: Full=GTP-binding protein engA;
  203::294     1e-10  37%  473 aa  ENGA_RHILW RecName: Full=GTP-binding protein engA;
  203::294     1e-10  38%  473 aa  ENGA_RHIL3 RecName: Full=GTP-binding protein engA;
  203::294     1e-10  37%  473 aa  ENGA_RHIEC RecName: Full=GTP-binding protein engA;
  203::294     1e-10  37%  473 aa  ENGA_RHIE6 RecName: Full=GTP-binding protein engA;
  177::269     1e-10  35%  439 aa  ENGA_PELCD RecName: Full=GTP-binding protein engA;
  199::294     1e-10  36%  473 aa  ENGA_PARL1 RecName: Full=GTP-binding protein engA;
  177::267     1e-10  36%  466 aa  ENGA_NITMU RecName: Full=GTP-binding protein engA;
  177::271     1e-10  33%  472 aa  ENGA_HALHL RecName: Full=GTP-binding protein engA;
   13::145     2e-10  30%  304 aa  ERA_PEDPA RecName: Full=GTP-binding protein era homolog;
   17::244     2e-10  31%  306 aa  ERA_PASMU RecName: Full=GTP-binding protein era homolog;
  205::296     2e-10  37%  476 aa  ENGA_RHIME RecName: Full=GTP-binding protein engA;
  212::303     2e-10  37%  483 aa  ENGA_OCHA4 RecName: Full=GTP-binding protein engA;
  182::268     2e-10  40%  458 aa  ENGA_MYCGA RecName: Full=GTP-binding protein engA;
  179::273     2e-10  32%  445 aa  ENGA_MARMS RecName: Full=GTP-binding protein engA;
  208::301     2e-10  34%  495 aa  ENGA_ERWCT RecName: Full=GTP-binding protein engA;
  180::271     2e-10  32%  447 aa  ENGA_DIAST RecName: Full=GTP-binding protein engA;
  212::303     2e-10  36%  483 aa  ENGA_BRUME RecName: Full=GTP-binding protein engA;
  212::303     2e-10  36%  483 aa  ENGA_BRUMB RecName: Full=GTP-binding protein engA;
  212::303     2e-10  36%  483 aa  ENGA_BRUAB RecName: Full=GTP-binding protein engA;
  212::303     2e-10  36%  483 aa  ENGA_BRUA2 RecName: Full=GTP-binding protein engA;
  212::303     2e-10  36%  483 aa  ENGA_BRUA1 RecName: Full=GTP-binding protein engA;
  178::233     2e-10  57%  437 aa  ENGA_AZOPC RecName: Full=GTP-binding protein engA;
  180::271     2e-10  32%  447 aa  ENGA_ACISJ RecName: Full=GTP-binding protein engA;
   11::97      2e-10  44%  301 aa  ERA_SALTY RecName: Full=GTP-binding protein era;
   11::97      2e-10  44%  301 aa  ERA_SALTI RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALSV RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALPK RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALPC RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALPB RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALPA RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALNS RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALHS RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALG2 RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALEP RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALDC RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALCH RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_SALA4 RecName: Full=GTP-binding protein era homolog;
    3::165     2e-10  31%  301 aa  ERA_LISW6 RecName: Full=GTP-binding protein era homolog;
   15::242     2e-10  31%  304 aa  ERA_HAES2 RecName: Full=GTP-binding protein era homolog;
   11::238     2e-10  31%  300 aa  ERA_HAES1 RecName: Full=GTP-binding protein era homolog;
   11::97      2e-10  44%  301 aa  ERA_ENTS8 RecName: Full=GTP-binding protein era homolog;
  155::270     2e-10  32%  465 aa  ENGA_XYLFA RecName: Full=GTP-binding protein engA;
  201::294     2e-10  33%  488 aa  ENGA_SODGM RecName: Full=GTP-binding protein engA;
    5::91      2e-10  37%  495 aa  ENGA_PECCP RecName: Full=GTP-binding protein engA;
  204::296     2e-10  34%  469 aa  ENGA_MYCUA RecName: Full=GTP-binding protein engA;
  204::296     2e-10  34%  469 aa  ENGA_MYCMM RecName: Full=GTP-binding protein engA;
  199::290     2e-10  36%  470 aa  ENGA_MESSB RecName: Full=GTP-binding protein engA;
  177::269     2e-10  34%  439 aa  ENGA_GEOMG RecName: Full=GTP-binding protein engA;
  179::239     2e-10  46%  441 aa  ENGA_CLOPH RecName: Full=GTP-binding protein engA;
    6::95      2e-10  36%  438 aa  ENGA_CLOAB RecName: Full=GTP-binding protein engA;
    4::90      2e-10  39%  460 aa  ENGA_CAMJR RecName: Full=GTP-binding protein engA;
    4::90      2e-10  39%  460 aa  ENGA_CAMJJ RecName: Full=GTP-binding protein engA;
    4::90      2e-10  39%  460 aa  ENGA_CAMJE RecName: Full=GTP-binding protein engA;
    4::90      2e-10  39%  460 aa  ENGA_CAMJ8 RecName: Full=GTP-binding protein engA;
  212::303     2e-10  36%  483 aa  ENGA_BRUSU RecName: Full=GTP-binding protein engA;
  212::303     2e-10  36%  483 aa  ENGA_BRUSI RecName: Full=GTP-binding protein engA;
  212::303     2e-10  36%  483 aa  ENGA_BRUO2 RecName: Full=GTP-binding protein engA;
  212::303     2e-10  36%  483 aa  ENGA_BRUC2 RecName: Full=GTP-binding protein engA;
  205::296     2e-10  37%  476 aa  ENGA_AGRT5 RecName: Full=GTP-binding protein engA;
   11::97      3e-10  44%  301 aa  ERA_SALAR RecName: Full=GTP-binding protein era homolog;
   11::97      3e-10  44%  301 aa  ERA_KLEP7 RecName: Full=GTP-binding protein era homolog;
   11::97      3e-10  44%  301 aa  ERA_KLEP3 RecName: Full=GTP-binding protein era homolog;
   11::98      3e-10  38%  307 aa  ERA_DESVM RecName: Full=GTP-binding protein era homolog;
  201::292     3e-10  33%  489 aa  ENGA_PSYIN RecName: Full=GTP-binding protein engA;
  181::270     3e-10  36%  467 aa  ENGA_NITEU RecName: Full=GTP-binding protein engA;
  175::268     3e-10  34%  462 aa  ENGA_LEGPL RecName: Full=GTP-binding protein engA;
  175::268     3e-10  34%  462 aa  ENGA_LEGPH RecName: Full=GTP-binding protein engA;
  175::268     3e-10  34%  462 aa  ENGA_LEGPC RecName: Full=GTP-binding protein engA;
  175::268     3e-10  34%  462 aa  ENGA_LEGPA RecName: Full=GTP-binding protein engA;
  159::277     3e-10  29%  465 aa  ENGA_FRATT RecName: Full=GTP-binding protein engA;
  159::277     3e-10  29%  465 aa  ENGA_FRAT1 RecName: Full=GTP-binding protein engA;
    3::165     4e-10  31%  301 aa  ERA_LISMO RecName: Full=GTP-binding protein era homolog;
    3::165     4e-10  31%  301 aa  ERA_LISMH RecName: Full=GTP-binding protein era homolog;
    3::165     4e-10  31%  301 aa  ERA_LISMF RecName: Full=GTP-binding protein era homolog;
    3::165     4e-10  31%  301 aa  ERA_LISMC RecName: Full=GTP-binding protein era homolog;
   12::170     4e-10  28%  301 aa  ERA_LACDB RecName: Full=GTP-binding protein era homolog;
   12::170     4e-10  28%  301 aa  ERA_LACDA RecName: Full=GTP-binding protein era homolog;
  222::279     4e-10  48%  481 aa  ENGA_LEIXX RecName: Full=GTP-binding protein engA;
  178::269     4e-10  37%  437 aa  ENGA_CHLL2 RecName: Full=GTP-binding protein engA;
    4::90      4e-10  39%  460 aa  ENGA_CAMJD RecName: Full=GTP-binding protein engA;
   13::240     5e-10  30%  302 aa  ERA_HAEIN RecName: Full=GTP-binding protein era homolog;
    7::248     5e-10  28%  297 aa  ERA_GEOUR RecName: Full=GTP-binding protein era homolog;
   17::105     5e-10  39%  307 aa  ERA_BRASO RecName: Full=GTP-binding protein era homolog;
   18::106     5e-10  39%  308 aa  ERA_BRASB RecName: Full=GTP-binding protein era homolog;
  177::270     5e-10  36%  464 aa  ENGA_TERTT RecName: Full=GTP-binding protein engA;
  165::271     5e-10  35%  447 aa  ENGA_RICFE RecName: Full=GTP-binding protein engA;
  205::296     5e-10  36%  476 aa  ENGA_RHISN RecName: Full=GTP-binding protein engA;
  166::281     5e-10  34%  454 aa  ENGA_ORITI RecName: Full=GTP-binding protein engA;
  181::271     5e-10  35%  468 aa  ENGA_NITEC RecName: Full=GTP-binding protein engA;
    5::91      5e-10  34%  485 aa  ENGA_NEIMF RecName: Full=GTP-binding protein engA;
    5::91      5e-10  34%  485 aa  ENGA_NEIMB RecName: Full=GTP-binding protein engA;
    5::91      5e-10  34%  485 aa  ENGA_NEIMA RecName: Full=GTP-binding protein engA;
  188::281     5e-10  35%  472 aa  ENGA_BAUCH RecName: Full=GTP-binding protein engA;
  178::270     5e-10  32%  442 aa  ENGA_AZOSE RecName: Full=GTP-binding protein engA;
    1::168     7e-10  29%  299 aa  ERA_THEAB RecName: Full=GTP-binding protein era homolog;
   53::143     7e-10  36%  339 aa  ERA_RICCN RecName: Full=GTP-binding protein era homolog;
    7::97      7e-10  36%  293 aa  ERA_RICAH RecName: Full=GTP-binding protein era homolog;
    5::91      7e-10  36%  485 aa  ENGA_NEIG2 RecName: Full=GTP-binding protein engA;
    5::91      7e-10  36%  485 aa  ENGA_NEIG1 RecName: Full=GTP-binding protein engA;
  178::241     7e-10  52%  455 aa  ENGA_GLOVI RecName: Full=GTP-binding protein engA;
  169::277     7e-10  27%  465 aa  ENGA_FRAP2 RecName: Full=GTP-binding protein engA;
  182::273     7e-10  31%  448 aa  ENGA_DELAS RecName: Full=GTP-binding protein engA;
   34::120     9e-10  43%  325 aa  ERA_VIBCH RecName: Full=GTP-binding protein era homolog;
    5::99      9e-10  36%  295 aa  ERA_RICTY RecName: Full=GTP-binding protein era homolog;
    5::99      9e-10  36%  295 aa  ERA_RICPR RecName: Full=GTP-binding protein era homolog;
    5::99      9e-10  35%  295 aa  ERA_RICCK RecName: Full=GTP-binding protein era homolog;
    3::96      9e-10  38%  301 aa  ERA_LISIN RecName: Full=GTP-binding protein era homolog;
   15::242     9e-10  31%  304 aa  ERA_HAEDU RecName: Full=GTP-binding protein era homolog;
   11::98      9e-10  38%  308 aa  ERA_DESVV RecName: Full=GTP-binding protein era homolog;
   11::98      9e-10  38%  308 aa  ERA_DESVH RecName: Full=GTP-binding protein era homolog;
   18::109     9e-10  38%  311 aa  ERA_BRUSU RecName: Full=GTP-binding protein era homolog;
   18::109     9e-10  38%  311 aa  ERA_BRUME RecName: Full=GTP-binding protein era homolog;
  176::276     9e-10  37%  452 aa  ENGA_RICBR RecName: Full=GTP-binding protein engA;
  176::276     9e-10  37%  452 aa  ENGA_RICB8 RecName: Full=GTP-binding protein engA;
  152::271     9e-10  35%  447 aa  ENGA_RICAH RecName: Full=GTP-binding protein engA;
  172::269     9e-10  41%  456 aa  ENGA_PROMT RecName: Full=GTP-binding protein engA;
  172::269     9e-10  41%  456 aa  ENGA_PROM1 RecName: Full=GTP-binding protein engA;
    8::95      1e-09  39%  302 aa  ERA_THEPX RecName: Full=GTP-binding protein era homolog;
    8::95      1e-09  39%  302 aa  ERA_THEP3 RecName: Full=GTP-binding protein era homolog;
    7::97      1e-09  36%  293 aa  ERA_RICFE RecName: Full=GTP-binding protein era homolog;
    8::131     1e-09  31%  300 aa  ERA_ANATD RecName: Full=GTP-binding protein era homolog;
   15::242     1e-09  31%  304 aa  ERA_ACTPJ RecName: Full=GTP-binding protein era homolog;
   15::242     1e-09  31%  304 aa  ERA_ACTP7 RecName: Full=GTP-binding protein era homolog;
   15::242     1e-09  31%  304 aa  ERA_ACTP2 RecName: Full=GTP-binding protein era homolog;
  178::269     1e-09  40%  455 aa  ENGA_PROMM RecName: Full=GTP-binding protein engA;
  201::293     1e-09  35%  463 aa  ENGA_MYCTU RecName: Full=GTP-binding protein engA;
  201::293     1e-09  35%  463 aa  ENGA_MYCTA RecName: Full=GTP-binding protein engA;
  201::293     1e-09  35%  463 aa  ENGA_MYCBT RecName: Full=GTP-binding protein engA;
  201::293     1e-09  35%  463 aa  ENGA_MYCBP RecName: Full=GTP-binding protein engA;
  201::293     1e-09  35%  463 aa  ENGA_MYCBO RecName: Full=GTP-binding protein engA;
  169::277     1e-09  27%  465 aa  ENGA_FRATW RecName: Full=GTP-binding protein engA;
  169::277     1e-09  27%  465 aa  ENGA_FRATO RecName: Full=GTP-binding protein engA;
  169::277     1e-09  27%  465 aa  ENGA_FRATN RecName: Full=GTP-binding protein engA;
  169::277     1e-09  27%  465 aa  ENGA_FRATM RecName: Full=GTP-binding protein engA;
  169::277     1e-09  27%  465 aa  ENGA_FRATH RecName: Full=GTP-binding protein engA;
  169::277     1e-09  27%  465 aa  ENGA_FRATF RecName: Full=GTP-binding protein engA;
  230::287     1e-09  48%  491 aa  ENGA_ARTAT RecName: Full=GTP-binding protein engA;
   12::98      2e-09  43%  303 aa  ERA_YERPY RecName: Full=GTP-binding protein era homolog;
   12::98      2e-09  43%  303 aa  ERA_YERPS RecName: Full=GTP-binding protein era homolog;
   12::98      2e-09  43%  303 aa  ERA_YERPP RecName: Full=GTP-binding protein era homolog;
   12::98      2e-09  43%  303 aa  ERA_YERPN RecName: Full=GTP-binding protein era homolog;
   12::98      2e-09  43%  303 aa  ERA_YERPG RecName: Full=GTP-binding protein era homolog;
   12::98      2e-09  43%  303 aa  ERA_YERPE RecName: Full=GTP-binding protein era homolog;
   12::98      2e-09  43%  303 aa  ERA_YERPB RecName: Full=GTP-binding protein era homolog;
   12::98      2e-09  43%  303 aa  ERA_YERPA RecName: Full=GTP-binding protein era homolog;
   12::98      2e-09  43%  303 aa  ERA_YERP3 RecName: Full=GTP-binding protein era homolog;
   12::98      2e-09  43%  303 aa  ERA_YERE8 RecName: Full=GTP-binding protein era homolog;
   21::87      2e-09  46%  315 aa  ERA_SYNY3 RecName: Full=GTP-binding protein era homolog;
    5::223     2e-09  26%  305 aa  ERA_LYSSC RecName: Full=GTP-binding protein era homolog;
    7::99      2e-09  35%  298 aa  ERA_GEOMG RecName: Full=GTP-binding protein era homolog;
  204::294     2e-09  35%  466 aa  ENGA_MYCPA RecName: Full=GTP-binding protein engA;
  199::291     2e-09  35%  461 aa  ENGA_MYCLE RecName: Full=GTP-binding protein engA;
  204::294     2e-09  35%  466 aa  ENGA_MYCA1 RecName: Full=GTP-binding protein engA;
  183::273     2e-09  33%  448 aa  ENGA_LEPCP RecName: Full=GTP-binding protein engA;
  179::269     2e-09  38%  443 aa  ENGA_COXBU RecName: Full=GTP-binding protein engA;
  179::269     2e-09  38%  443 aa  ENGA_COXBR RecName: Full=GTP-binding protein engA;
  179::269     2e-09  38%  443 aa  ENGA_COXBN RecName: Full=GTP-binding protein engA;
  179::269     2e-09  38%  443 aa  ENGA_COXB2 RecName: Full=GTP-binding protein engA;
  179::269     2e-09  38%  443 aa  ENGA_COXB1 RecName: Full=GTP-binding protein engA;
   11::97      2e-09  43%  300 aa  ERA_HAEPS RecName: Full=GTP-binding protein era homolog;
   10::98      2e-09  37%  300 aa  ERA_ENTFA RecName: Full=GTP-binding protein era homolog;
    1::240     2e-09  25%  289 aa  ERA_CAMC1 RecName: Full=GTP-binding protein era homolog;
  199::292     2e-09  30%  468 aa  ENGA_VEREI RecName: Full=GTP-binding protein engA;
  208::299     2e-09  34%  479 aa  ENGA_RHILO RecName: Full=GTP-binding protein engA;
   20::112     3e-09  38%  313 aa  ERA_RHIME RecName: Full=GTP-binding protein era homolog;
   21::109     3e-09  36%  310 aa  ERA_RHILO RecName: Full=GTP-binding protein era homolog;
   18::104     3e-09  38%  308 aa  ERA_OLICO RecName: Full=GTP-binding protein era homolog;
   11::98      3e-09  36%  297 aa  ERA_GEOSF RecName: Full=GTP-binding protein era homolog;
   18::111     3e-09  42%  314 aa  ERA_CYAA5 RecName: Full=GTP-binding protein era homolog;
    1::202     3e-09  26%  289 aa  ERA_CAMC5 RecName: Full=GTP-binding protein era homolog;
    8::131     3e-09  31%  300 aa  ERA_CALS8 RecName: Full=GTP-binding protein era homolog;
  152::271     3e-09  34%  447 aa  ENGA_RICRS RecName: Full=GTP-binding protein engA;
  152::271     3e-09  34%  447 aa  ENGA_RICRO RecName: Full=GTP-binding protein engA;
  152::271     3e-09  34%  447 aa  ENGA_RICCN RecName: Full=GTP-binding protein engA;
  177::270     3e-09  33%  463 aa  ENGA_METCA RecName: Full=GTP-binding protein engA;
  204::295     3e-09  33%  473 aa  ENGA_BARBK RecName: Full=GTP-binding protein engA;
  151::248     3e-09  36%  437 aa  ERG_ARATH RecName: Full=GTP-binding protein ERG;
    1::90      3e-09  38%  296 aa  ERA_CLOPS RecName: Full=GTP-binding protein era homolog;
    1::90      3e-09  38%  296 aa  ERA_CLOPE RecName: Full=GTP-binding protein era homolog;
    1::246     3e-09  26%  297 aa  ERA_CLOD6 RecName: Full=GTP-binding protein era homolog;
    1::95      3e-09  34%  296 aa  ERA_CLOBM RecName: Full=GTP-binding protein era homolog;
    1::95      3e-09  34%  296 aa  ERA_CLOBL RecName: Full=GTP-binding protein era homolog;
    1::95      3e-09  34%  296 aa  ERA_CLOBK RecName: Full=GTP-binding protein era homolog;
    1::95      3e-09  34%  296 aa  ERA_CLOBJ RecName: Full=GTP-binding protein era homolog;
    1::95      3e-09  34%  296 aa  ERA_CLOB6 RecName: Full=GTP-binding protein era homolog;
  152::271     3e-09  34%  447 aa  ENGA_RICPU RecName: Full=GTP-binding protein engA;
    5::91      3e-09  37%  446 aa  ENGA_METPP RecName: Full=GTP-binding protein engA;
  181::278     3e-09  32%  453 aa  ENGA_BUCAT RecName: Full=GTP-binding protein engA;
  181::278     3e-09  32%  453 aa  ENGA_BUCAI RecName: Full=GTP-binding protein engA;
  181::278     3e-09  32%  453 aa  ENGA_BUCA5 RecName: Full=GTP-binding protein engA;
    8::94      4e-09  39%  293 aa  ERA_MYCPU RecName: Full=GTP-binding protein era homolog;
   12::100     4e-09  36%  302 aa  ERA_LACPL RecName: Full=GTP-binding protein era homolog;
    1::90      4e-09  38%  296 aa  ERA_CLOP1 RecName: Full=GTP-binding protein era homolog;
    1::95      4e-09  34%  296 aa  ERA_CLOBH RecName: Full=GTP-binding protein era homolog;
    1::95      4e-09  34%  296 aa  ERA_CLOB1 RecName: Full=GTP-binding protein era homolog;
   18::105     4e-09  38%  308 aa  ERA_BRAJA RecName: Full=GTP-binding protein era homolog;
    5::92      4e-09  35%  472 aa  ENGA_HAHCH RecName: Full=GTP-binding protein engA;
  206::297     4e-09  33%  475 aa  ENGA_AGRRK RecName: Full=GTP-binding protein engA;
    8::70      6e-09  41%  300 aa  ERA_UREU1 RecName: Full=GTP-binding protein era homolog;
  152::271     6e-09  34%  447 aa  ENGA_RICAE RecName: Full=GTP-binding protein engA;
    4::92      6e-09  35%  461 aa  ENGA_NOVAD RecName: Full=GTP-binding protein engA;
  241::356     6e-09  26%  528 aa  ENGA_COREF RecName: Full=GTP-binding protein engA;
   29::112     8e-09  40%  320 aa  ERA_VIBVY RecName: Full=GTP-binding protein era homolog;
   29::112     8e-09  40%  320 aa  ERA_VIBVU RecName: Full=GTP-binding protein era homolog;
   29::112     8e-09  40%  320 aa  ERA_VIBPA RecName: Full=GTP-binding protein era homolog;
  176::268     8e-09  33%  442 aa  ENGA_UREPA RecName: Full=GTP-binding protein engA;
  176::268     8e-09  33%  442 aa  ENGA_UREP2 RecName: Full=GTP-binding protein engA;
  166::239     8e-09  35%  449 aa  ENGA_ACIF5 RecName: Full=GTP-binding protein engA;
  166::239     8e-09  35%  449 aa  ENGA_ACIF2 RecName: Full=GTP-binding protein engA;
    8::70      1e-08  40%  300 aa  ERA_UREPA RecName: Full=GTP-binding protein era homolog;
    8::70      1e-08  40%  300 aa  ERA_UREP2 RecName: Full=GTP-binding protein era homolog;
    6::217     1e-08  26%  299 aa  ERA_THEM4 RecName: Full=GTP-binding protein era homolog;
   11::143     1e-08  30%  303 aa  ERA_LEUCK RecName: Full=GTP-binding protein era homolog;
    7::96      1e-08  36%  297 aa  ERA_GEOSM RecName: Full=GTP-binding protein era homolog;
  176::268     1e-08  32%  442 aa  ENGA_UREU1 RecName: Full=GTP-binding protein engA;
  188::281     1e-08  33%  454 aa  ENGA_ORITB RecName: Full=GTP-binding protein engA;
   12::101     1e-08  34%  300 aa  ERA_PSEF5 RecName: Full=GTP-binding protein era homolog;
    7::98      1e-08  36%  300 aa  ERA_AZOVD RecName: Full=GTP-binding protein era homolog;
   17::109     2e-08  35%  310 aa  ERA_SINMW RecName: Full=GTP-binding protein era homolog;
   11::97      2e-08  37%  303 aa  ERA_LEUMM RecName: Full=GTP-binding protein era homolog;
    3::223     2e-08  26%  303 aa  ERA_BACSK RecName: Full=GTP-binding protein era homolog;
  152::271     2e-08  31%  447 aa  ENGA_RICPR RecName: Full=GTP-binding protein engA;
  152::271     2e-08  33%  447 aa  ENGA_RICCK RecName: Full=GTP-binding protein engA;
   83::170     2e-08  38%  519 aa  ENGA_CORGL RecName: Full=GTP-binding protein engA;
    3::95      2e-08  39%  462 aa  ENGA_BUCBP RecName: Full=GTP-binding protein engA;
    6::91      2e-08  36%  447 aa  ENGA_RICTY RecName: Full=GTP-binding protein engA;
   56::150     3e-08  38%  364 aa  GTP1_SCHPO RecName: Full=GTP-binding protein 1;
    9::104     3e-08  33%  299 aa  ERA_XANOR RecName: Full=GTP-binding protein era homolog;
    9::104     3e-08  33%  299 aa  ERA_XANOM RecName: Full=GTP-binding protein era homolog;
    9::104     3e-08  33%  300 aa  ERA_XANC5 RecName: Full=GTP-binding protein era homolog;
    9::104     3e-08  33%  299 aa  ERA_XANAC RecName: Full=GTP-binding protein era homolog;
    3::94      3e-08  37%  300 aa  ERA_THEP1 RecName: Full=GTP-binding protein era homolog;
    3::94      3e-08  37%  300 aa  ERA_THEMA RecName: Full=GTP-binding protein era homolog;
    8::96      3e-08  35%  299 aa  ERA_STRSY RecName: Full=GTP-binding protein era homolog;
    8::96      3e-08  35%  299 aa  ERA_STRS2 RecName: Full=GTP-binding protein era homolog;
    9::97      3e-08  38%  299 aa  ERA_STACT RecName: Full=GTP-binding protein era homolog;
    9::97      3e-08  35%  300 aa  ERA_LACCB RecName: Full=GTP-binding protein era homolog;
    9::97      3e-08  35%  300 aa  ERA_LACC3 RecName: Full=GTP-binding protein era homolog;
   11::140     3e-08  30%  296 aa  ERA_GEOLS RecName: Full=GTP-binding protein era homolog;
   12::98      4e-08  34%  300 aa  ERA_PSEU2 RecName: Full=GTP-binding protein era homolog;
   14::103     4e-08  33%  302 aa  ERA_PSEPK RecName: Full=GTP-binding protein era homolog;
   12::101     4e-08  33%  300 aa  ERA_PSEPG RecName: Full=GTP-binding protein era homolog;
   12::101     4e-08  34%  300 aa  ERA_PSEPF RecName: Full=GTP-binding protein era homolog;
   12::101     4e-08  33%  300 aa  ERA_PSEP1 RecName: Full=GTP-binding protein era homolog;
   12::98      4e-08  34%  300 aa  ERA_PSE14 RecName: Full=GTP-binding protein era homolog;
   11::98      4e-08  34%  296 aa  ERA_NITEC RecName: Full=GTP-binding protein era homolog;
    2::66      4e-08  48%  299 aa  ERA_HELMI RecName: Full=GTP-binding protein era homolog;
    1::89      4e-08  39%  293 aa  ERA_CLOK5 RecName: Full=GTP-binding protein era homolog;
    1::89      4e-08  39%  293 aa  ERA_CLOK1 RecName: Full=GTP-binding protein era homolog;
    1::184     4e-08  28%  289 aa  ERA_CAMHC RecName: Full=GTP-binding protein era homolog;
   11::99      5e-08  35%  298 aa  ERA_XYLFT RecName: Full=GTP-binding protein era homolog;
   11::99      5e-08  35%  298 aa  ERA_XYLF2 RecName: Full=GTP-binding protein era homolog;
    8::103     5e-08  33%  298 aa  ERA_XANCP RecName: Full=GTP-binding protein era homolog;
    8::103     5e-08  33%  298 aa  ERA_XANCB RecName: Full=GTP-binding protein era homolog;
    8::103     5e-08  33%  298 aa  ERA_XANC8 RecName: Full=GTP-binding protein era homolog;
   11::73      5e-08  41%  301 aa  ERA_LACAC RecName: Full=GTP-binding protein era homolog;
    1::94      5e-08  36%  295 aa  ERA_CLOTE RecName: Full=GTP-binding protein era homolog;
  178::269     5e-08  38%  455 aa  ENGA_SYNSC RecName: Full=GTP-binding protein engA;
    5::91      5e-08  31%  433 aa  ENGA_SULMW RecName: Full=GTP-binding protein engA;
   11::99      6e-08  34%  298 aa  ERA_XYLFM RecName: Full=GTP-binding protein era homolog;
   11::99      6e-08  34%  298 aa  ERA_XYLFA RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRZT RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRZP RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRZJ RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRU0 RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRSV RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRR6 RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRPS RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRPN RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRPJ RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRPI RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRP7 RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRP2 RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRMU RecName: Full=GTP-binding protein era homolog;
    8::96      6e-08  35%  299 aa  ERA_STRGC RecName: Full=GTP-binding protein era homolog;
   12::98      6e-08  34%  300 aa  ERA_PSESM RecName: Full=GTP-binding protein era homolog;
   10::143     6e-08  30%  300 aa  ERA_OCEIH RecName: Full=GTP-binding protein era homolog;
   11::99      6e-08  33%  303 aa  ERA_LACLS RecName: Full=GTP-binding protein era homolog;
   11::99      6e-08  33%  303 aa  ERA_LACLM RecName: Full=GTP-binding protein era homolog;
   11::99      6e-08  33%  303 aa  ERA_LACLA RecName: Full=GTP-binding protein era homolog;
   18::101     6e-08  41%  314 aa  ERA_CYAP8 RecName: Full=GTP-binding protein era homolog;
    6::98      6e-08  38%  304 aa  ERA_BACHD RecName: Full=GTP-binding protein era homolog;
    8::93      6e-08  35%  295 aa  ERA_ALKMQ RecName: Full=GTP-binding protein era homolog;
   12::104     8e-08  33%  306 aa  ERA_SYNAS RecName: Full=GTP-binding protein era homolog;
   12::98      8e-08  33%  300 aa  ERA_PSEPW RecName: Full=GTP-binding protein era homolog;
   12::98      8e-08  33%  300 aa  ERA_PSEE4 RecName: Full=GTP-binding protein era homolog;
   10::96      8e-08  36%  300 aa  ERA_LACS1 RecName: Full=GTP-binding protein era homolog;
   11::73      8e-08  40%  301 aa  ERA_LACH4 RecName: Full=GTP-binding protein era homolog;
    1::90      8e-08  37%  296 aa  ERA_CLOAB RecName: Full=GTP-binding protein era homolog;
    1::207     8e-08  25%  289 aa  ERA_CAMFF RecName: Full=GTP-binding protein era homolog;
    6::94      1e-07  36%  296 aa  ERA_THELT RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STRPZ RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STRPM RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STRPG RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STRPF RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STRPD RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STRPC RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STRPB RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  203 aa  ERA_STRP9 RecName: Full=GTP-binding protein era homolog;Flags:
    1::64      1e-07  45%  298 aa  ERA_STRP8 RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STRP6 RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STRP3 RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STRP1 RecName: Full=GTP-binding protein era homolog;
    1::64      1e-07  45%  298 aa  ERA_STREM RecName: Full=GTP-binding protein era homolog;
   17::103     1e-07  32%  305 aa  ERA_PSEAE RecName: Full=GTP-binding protein era homolog;
   17::103     1e-07  32%  305 aa  ERA_PSEAB RecName: Full=GTP-binding protein era homolog;
   17::103     1e-07  32%  305 aa  ERA_PSEA8 RecName: Full=GTP-binding protein era homolog;
   35::92      1e-07  45%  324 aa  ERA_ANASP RecName: Full=GTP-binding protein era homolog;
  214::299     1e-07  35%  470 aa  ENGA_MYCVP RecName: Full=GTP-binding protein engA;
  185::245     1e-07  43%  453 aa  ENGA_BUCAP RecName: Full=GTP-binding protein engA;
  228::303     2e-07  29%  556 aa  GNL3_CAEEL RecName: Full=Guanine nucleotide-binding protein-like 3
    8::96      2e-07  34%  299 aa  ERA_STRP4 RecName: Full=GTP-binding protein era homolog;
    1::64      2e-07  44%  298 aa  ERA_STRE4 RecName: Full=GTP-binding protein era homolog;
    3::96      2e-07  34%  298 aa  ERA_RALSO RecName: Full=GTP-binding protein era homolog;
   11::66      2e-07  46%  296 aa  ERA_PELPD RecName: Full=GTP-binding protein era homolog;
    8::93      2e-07  36%  295 aa  ERA_ALKOO RecName: Full=GTP-binding protein era homolog;
    9::101     2e-07  37%  319 aa  ERA_TREPS RecName: Full=GTP-binding protein era homolog;
    9::101     2e-07  37%  319 aa  ERA_TREPA RecName: Full=GTP-binding protein era homolog;
    8::65      2e-07  47%  299 aa  ERA_STRA5 RecName: Full=GTP-binding protein era homolog;
    8::65      2e-07  47%  299 aa  ERA_STRA3 RecName: Full=GTP-binding protein era homolog;
    8::65      2e-07  47%  299 aa  ERA_STRA1 RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAAW RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAAT RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAAS RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAAR RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAAN RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAAM RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAAE RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAAC RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAAB RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAA9 RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAA3 RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAA2 RecName: Full=GTP-binding protein era homolog;
    9::97      2e-07  36%  299 aa  ERA_STAA1 RecName: Full=GTP-binding protein era homolog;
   11::76      2e-07  41%  296 aa  ERA_NITEU RecName: Full=GTP-binding protein era homolog;
    1::96      2e-07  38%  291 aa  ERA_CAMJR RecName: Full=GTP-binding protein era homolog;
    1::96      2e-07  38%  291 aa  ERA_CAMJJ RecName: Full=GTP-binding protein era homolog;
    1::96      2e-07  38%  291 aa  ERA_CAMJE RecName: Full=GTP-binding protein era homolog;
    1::96      2e-07  38%  291 aa  ERA_CAMJD RecName: Full=GTP-binding protein era homolog;
    1::96      2e-07  38%  291 aa  ERA_CAMJ8 RecName: Full=GTP-binding protein era homolog;
   11::97      3e-07  36%  307 aa  ERA_DESDA RecName: Full=GTP-binding protein era homolog;
    8::246     3e-07  27%  298 aa  ERA_CARHZ RecName: Full=GTP-binding protein era homolog;
   11::72      4e-07  42%  301 aa  ERA_TROWT RecName: Full=GTP-binding protein era homolog;
   11::72      4e-07  42%  301 aa  ERA_TROW8 RecName: Full=GTP-binding protein era homolog;
    1::64      4e-07  44%  298 aa  ERA_STRS7 RecName: Full=GTP-binding protein era homolog;
   12::103     4e-07  35%  298 aa  ERA_STRMK RecName: Full=GTP-binding protein era homolog;
   12::103     4e-07  35%  298 aa  ERA_STRM5 RecName: Full=GTP-binding protein era homolog;
    9::66      4e-07  45%  299 aa  ERA_STAS1 RecName: Full=GTP-binding protein era homolog;
    8::93      4e-07  33%  294 aa  ERA_HALOH RecName: Full=GTP-binding protein era homolog;
    1::94      4e-07  34%  294 aa  ERA_CLONN RecName: Full=GTP-binding protein era homolog;
    6::95      4e-07  34%  458 aa  ENGA_PROM5 RecName: Full=GTP-binding protein engA;
    9::66      5e-07  45%  299 aa  ERA_STAES RecName: Full=GTP-binding protein era homolog;
    9::66      5e-07  45%  299 aa  ERA_STAEQ RecName: Full=GTP-binding protein era homolog;
    1::94      5e-07  39%  290 aa  ERA_CAMLR RecName: Full=GTP-binding protein era homolog;
    3::79      7e-07  36%  307 aa  ERA_NEIMA RecName: Full=GTP-binding protein era homolog;
    5::64      7e-07  45%  299 aa  ERA_MYCSS RecName: Full=GTP-binding protein era homolog;
    5::64      7e-07  45%  299 aa  ERA_MYCSK RecName: Full=GTP-binding protein era homolog;
    5::64      7e-07  45%  299 aa  ERA_MYCSJ RecName: Full=GTP-binding protein era homolog;
   17::87      7e-07  39%  305 aa  ERA_MARAV RecName: Full=GTP-binding protein era homolog;
   11::75      7e-07  40%  296 aa  ERA_AMOA5 RecName: Full=GTP-binding protein era homolog;
    6::61      7e-07  46%  457 aa  ENGA_PROMS RecName: Full=GTP-binding protein engA;
    6::61      7e-07  46%  457 aa  ENGA_PROM9 RecName: Full=GTP-binding protein engA;
    6::61      7e-07  46%  457 aa  ENGA_PROM2 RecName: Full=GTP-binding protein engA;
    6::61      7e-07  46%  457 aa  ENGA_PROM0 RecName: Full=GTP-binding protein engA;
   39::109     9e-07  37%  287 aa  YKFA_ECOLI RecName: Full=Uncharacterized protein ykfA;
   12::97      9e-07  34%  314 aa  ERA_MARMM RecName: Full=GTP-binding protein era homolog;
  178::269     9e-07  37%  455 aa  ENGA_SYNS3 RecName: Full=GTP-binding protein engA;
   56::151     9e-07  38%  364 aa  DRG2_DICDI RecName: Full=Developmentally-regulated GTP-binding
    7::107     1e-06  34%  185 aa  Y920_METJA RecName: Full=Uncharacterized protein MJ0920;
   10::95      1e-06  34%  295 aa  ERA_COXBU RecName: Full=GTP-binding protein era homolog;
   10::95      1e-06  34%  295 aa  ERA_COXBR RecName: Full=GTP-binding protein era homolog;
   23::82      2e-06  43%  317 aa  ERA_AGRT5 RecName: Full=GTP-binding protein era homolog;
   27::81      2e-06  40%  467 aa  ENGA_SALAI RecName: Full=GTP-binding protein engA;
    3::79      2e-06  36%  307 aa  ERA_NEIMF RecName: Full=GTP-binding protein era homolog;
    3::79      2e-06  36%  307 aa  ERA_NEIMB RecName: Full=GTP-binding protein era homolog;
   10::95      2e-06  34%  295 aa  ERA_COXB2 RecName: Full=GTP-binding protein era homolog;
   11::104     2e-06  28%  296 aa  ERA_CHRVO RecName: Full=GTP-binding protein era homolog;
    4::67      2e-06  44%  296 aa  ERA_BORA1 RecName: Full=GTP-binding protein era homolog;
   12::88      3e-06  34%  299 aa  ERA_PSEMY RecName: Full=GTP-binding protein era homolog;
    9::64      3e-06  41%  300 aa  ERA_MYCTU RecName: Full=GTP-binding protein era homolog;
    9::64      3e-06  41%  300 aa  ERA_MYCTA RecName: Full=GTP-binding protein era homolog;
    9::64      3e-06  41%  300 aa  ERA_MYCBT RecName: Full=GTP-binding protein era homolog;
    9::64      3e-06  41%  300 aa  ERA_MYCBP RecName: Full=GTP-binding protein era homolog;
    9::64      3e-06  41%  300 aa  ERA_MYCBO RecName: Full=GTP-binding protein era homolog;
    5::64      3e-06  43%  299 aa  ERA_MYCA1 RecName: Full=GTP-binding protein era homolog;
   11::67      3e-06  46%  296 aa  ERA_BORPE RecName: Full=GTP-binding protein era homolog;
   11::67      3e-06  46%  296 aa  ERA_BORPA RecName: Full=GTP-binding protein era homolog;
   11::67      3e-06  46%  296 aa  ERA_BORBR RecName: Full=GTP-binding protein era homolog;
    6::72      3e-06  41%  458 aa  ENGA_PROMP RecName: Full=GTP-binding protein engA;
    5::64      4e-06  43%  299 aa  ERA_MYCPA RecName: Full=GTP-binding protein era homolog;
   10::95      4e-06  34%  295 aa  ERA_COXBN RecName: Full=GTP-binding protein era homolog;
   10::95      4e-06  34%  295 aa  ERA_COXB1 RecName: Full=GTP-binding protein era homolog;
   11::97      4e-06  37%  305 aa  ERA_CORGL RecName: Full=GTP-binding protein era homolog;
   11::67      4e-06  44%  296 aa  ERA_BORPD RecName: Full=GTP-binding protein era homolog;
   56::151     4e-06  36%  364 aa  DRG2_BOVIN RecName: Full=Developmentally-regulated GTP-binding
    8::72      5e-06  42%  305 aa  ERA_CORDI RecName: Full=GTP-binding protein era homolog;
   14::68      5e-06  44%  316 aa  ERA_CAUCR RecName: Full=GTP-binding protein era homolog;
   14::68      5e-06  44%  316 aa  ERA_CAUCN RecName: Full=GTP-binding protein era homolog;
   56::151     5e-06  36%  364 aa  DRG2_HUMAN RecName: Full=Developmentally-regulated GTP-binding
  228::342     6e-06  28%  615 aa  GNL3_DICDI RecName: Full=Guanine nucleotide-binding protein-like 3
    5::65      6e-06  47%  300 aa  ERA_MYCLE RecName: Full=GTP-binding protein era homolog;
   24::78      8e-06  40%  317 aa  ERA_STRCO RecName: Full=GTP-binding protein era homolog;
    9::64      8e-06  43%  297 aa  ERA_LEIXX RecName: Full=GTP-binding protein era homolog;
   11::103     8e-06  35%  304 aa  ERA_ERYLH RecName: Full=GTP-binding protein era homolog;
   31::88      8e-06  38%  467 aa  ENGA_SALTO RecName: Full=GTP-binding protein engA;
   12::98      1e-05  33%  296 aa  ERA_EHRCJ RecName: Full=GTP-binding protein era homolog;
  137::234     1e-05  31%  423 aa  ERG_ANTMA RecName: Full=GTP-binding protein ERG;
   13::72      1e-05  38%  313 aa  ERA_NOCSJ RecName: Full=GTP-binding protein era homolog;
   12::174     1e-05  26%  296 aa  ERA_EHRCR RecName: Full=GTP-binding protein era homolog;
   10::100     1e-05  33%  307 aa  ERA_DEIDV RecName: Full=GTP-binding protein era homolog;
    5::73      2e-05  32%  210 aa  KGUA_BORA1 RecName: Full=Guanylate kinase;       
   13::68      2e-05  39%  308 aa  ERA_DINSH RecName: Full=GTP-binding protein era homolog;
    1::60      2e-05  43%  290 aa  ERA_BORGA RecName: Full=GTP-binding protein era homolog;
    1::60      2e-05  43%  290 aa  ERA_BORBZ RecName: Full=GTP-binding protein era homolog;
    1::60      2e-05  43%  290 aa  ERA_BORBU RecName: Full=GTP-binding protein era homolog;
    1::60      2e-05  43%  290 aa  ERA_BORAP RecName: Full=GTP-binding protein era homolog;
   39::96      2e-05  36%  287 aa  YFJP_ECOLI RecName: Full=Uncharacterized protein yfjP;
   20::77      2e-05  38%  311 aa  ERA_DEIRA RecName: Full=GTP-binding protein era homolog;
   20::77      2e-05  38%  309 aa  ERA_DEIGD RecName: Full=GTP-binding protein era homolog;
    1::60      2e-05  42%  290 aa  ERA_BORHD RecName: Full=GTP-binding protein era homolog;
   25::61      2e-05  57%  195 aa  ENGB_THEMA RecName: Full=Probable GTP-binding protein engB;
   14::84      3e-05  32%  207 aa  KGUA_RHOSR RecName: Full=Guanylate kinase;       
   13::66      3e-05  43%  283 aa  ERA_BUCAT RecName: Full=GTP-binding protein era homolog;
   13::66      3e-05  43%  283 aa  ERA_BUCAI RecName: Full=GTP-binding protein era homolog;
   13::66      3e-05  43%  283 aa  ERA_BUCA5 RecName: Full=GTP-binding protein era homolog;
   25::61      3e-05  54%  195 aa  ENGB_THESQ RecName: Full=Probable GTP-binding protein engB;
   25::61      3e-05  57%  195 aa  ENGB_THENN RecName: Full=Probable GTP-binding protein engB;
  108::193     4e-05  38%  959 aa  SEY11_ENTHI RecName: Full=Protein SEY1 homolog 1;       
    1::68      4e-05  35%  294 aa  ERA_TREDE RecName: Full=GTP-binding protein era homolog;
  172::242     5e-05  40%  655 aa  NOG1_TRYBB RecName: Full=Nucleolar GTP-binding protein 1;
  238::289     5e-05  40%  575 aa  GNL3L_BOVIN RecName: Full=Guanine nucleotide-binding protein-like
   25::61      5e-05  54%  195 aa  ENGB_THEP1 RecName: Full=Probable GTP-binding protein engB;
  154::219     7e-05  44%  366 aa  YQEH_BACSU RecName: Full=Uncharacterized protein yqeH;
  239::290     7e-05  40%  577 aa  GNL3L_MOUSE RecName: Full=Guanine nucleotide-binding protein-like
  245::296     7e-05  40%  582 aa  GNL3L_HUMAN RecName: Full=Guanine nucleotide-binding protein-like
   57::152     9e-05  33%  368 aa  YG3Y_YEAST RecName: Full=Uncharacterized GTP-binding protein
  258::329     9e-05  37%  520 aa  NUG1_YEAST RecName: Full=Nuclear GTP-binding protein NUG1;AltName:
  250::311     9e-05  32%  581 aa  GNL3_DROME RecName: Full=Guanine nucleotide-binding protein-like 3
    5::95      9e-05  30%  668 aa  FEOB_METJA RecName: Full=Ferrous iron transport protein B homolog;
    4::38      9e-05  49%  290 aa  ERA_MYCGE RecName: Full=GTP-binding protein era homolog;
  105::190     1e-04  37%  956 aa  SEY11_ENTDI RecName: Full=Protein SEY1 homolog 1;       
  171::241     1e-04  38%  634 aa  NOG1_MOUSE RecName: Full=Nucleolar GTP-binding protein 1;AltName:
  171::241     1e-04  38%  634 aa  NOG1_HUMAN RecName: Full=Nucleolar GTP-binding protein 1;AltName:
  171::241     1e-04  38%  652 aa  NOG1_DROME RecName: Full=Probable nucleolar GTP-binding protein 1;
   13::113     1e-04  27%  219 aa  KGUA_NITWN RecName: Full=Guanylate kinase;       
  171::241     1e-04  38%  637 aa  NOG1_RAT RecName: Full=Nucleolar GTP-binding protein 1;AltName:
  170::230     1e-04  39%  643 aa  NOG1_KLULA RecName: Full=Nucleolar GTP-binding protein 1;
  172::265     1e-04  36%  681 aa  NOG1_CAEEL RecName: Full=Probable nucleolar GTP-binding protein 1;
  248::291     1e-04  45%  548 aa  GNL3_XENTR RecName: Full=Guanine nucleotide-binding protein-like
    4::95      1e-04  30%  642 aa  FEOB_HELPY RecName: Full=Ferrous iron transport protein B;
    6::95      1e-04  31%  642 aa  FEOB_HELPJ RecName: Full=Ferrous iron transport protein B;
  114::171     1e-04  40%  437 aa  ERAL_MOUSE RecName: Full=GTP-binding protein era homolog;AltName:
  114::171     1e-04  40%  437 aa  ERAL_HUMAN RecName: Full=GTP-binding protein era homolog;       
    4::95      2e-04  29%  613 aa  FEOB_CAMJE RecName: Full=Ferrous iron transport protein B homolog;
   26::79      2e-04  47%  204 aa  ENGB_GEMAT RecName: Full=Probable GTP-binding protein engB;
   29::180     2e-04  29%  433 aa  CLP1_BRUMA RecName: Full=Protein CLP1 homolog;
   34::90      3e-04  37%  394 aa  YQN2_CAEEL RecName: Full=Uncharacterized GTP-binding protein
   12::98      3e-04  31%  296 aa  ERA_EHRRW RecName: Full=GTP-binding protein era homolog;
   12::98      3e-04  31%  296 aa  ERA_EHRRG RecName: Full=GTP-binding protein era homolog;
    1::204     3e-04  25%  290 aa  ERA_BORT9 RecName: Full=GTP-binding protein era homolog;
    9::62      3e-04  46%  193 aa  ENGB_CHLT3 RecName: Full=Probable GTP-binding protein engB;
   56::153     3e-04  33%  364 aa  DRG2_MOUSE RecName: Full=Developmentally-regulated GTP-binding
  112::146     3e-04  46%  373 aa  Y1464_METJA RecName: Full=Uncharacterized GTP-binding protein
  170::240     3e-04  40%  645 aa  NOG1_CANGA RecName: Full=Nucleolar GTP-binding protein 1;
  170::240     3e-04  40%  642 aa  NOG1_ASHGO RecName: Full=Nucleolar GTP-binding protein 1;
  173::237     3e-04  42%  671 aa  NOG1_ARATH RecName: Full=Probable nucleolar GTP-binding protein 1;
  272::357     3e-04  38%  470 aa  GRN1_SCHPO RecName: Full=GTPase grn1;AltName: Full=Nuclear
   41::78      3e-04  51%  212 aa  ENGB_RICRS RecName: Full=Probable GTP-binding protein engB;
   41::78      3e-04  51%  212 aa  ENGB_RICPU RecName: Full=Probable GTP-binding protein engB;
   37::87      3e-04  46%  217 aa  ENGB_RHOPS RecName: Full=Probable GTP-binding protein engB;
  170::240     4e-04  40%  647 aa  NOG1_YEAST RecName: Full=Nucleolar GTP-binding protein 1;
  248::291     4e-04  43%  542 aa  GNL3_XENLA RecName: Full=Guanine nucleotide-binding protein-like
  249::287     4e-04  44%  538 aa  GNL3_RAT RecName: Full=Guanine nucleotide-binding protein-like
  245::304     4e-04  37%  561 aa  GNL3_DANRE RecName: Full=Guanine nucleotide-binding protein-like
   38::87      4e-04  49%  216 aa  ENGB_RHOP5 RecName: Full=Probable GTP-binding protein engB;
   11::153     6e-04  32%  366 aa  YKK3_CAEEL RecName: Full=Uncharacterized GTP-binding protein
   88::175     6e-04  34%  391 aa  Y1326_METJA RecName: Full=Uncharacterized GTP-binding protein
   33::117     6e-04  35%  247 aa  RSLBB_RAT RecName: Full=Ras-like protein family member 11B;
  323::361     6e-04  41%  619 aa  NOG2_NEUCR RecName: Full=Nucleolar GTP-binding protein 2;
   80::250     6e-04  27%  528 aa  NOG1_ENCCU RecName: Full=Nucleolar GTP-binding protein 1;
   25::61      6e-04  51%  190 aa  ENGB_KOSOT RecName: Full=Probable GTP-binding protein engB;
  171::231     7e-04  38%  674 aa  NOG1_DICDI RecName: Full=Probable nucleolar GTP-binding protein 1;
   13::113     7e-04  24%  219 aa  KGUA_NITHX RecName: Full=Guanylate kinase;       
   20::112     7e-04  32%  186 aa  ENGB_MYCPU RecName: Full=Probable GTP-binding protein engB;
   25::194     7e-04  24%  204 aa  ENGB_CLOCE RecName: Full=Probable GTP-binding protein engB;
   33::117     0.001  34%  247 aa  RSLBB_MOUSE RecName: Full=Ras-like protein family member 11B;
    9::118     0.001  37%  248 aa  RSLBB_HUMAN RecName: Full=Ras-like protein family member 11B;
  151::248     0.001  33%  307 aa  RSGA_BORBZ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  151::248     0.001  33%  307 aa  RSGA_BORBU RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  158::224     0.001  42%  376 aa  OBG_TREPS RecName: Full=GTPase obg;AltName: Full=GTP-binding
  158::224     0.001  42%  376 aa  OBG_TREPA RecName: Full=GTPase obg;AltName: Full=GTP-binding
  311::346     0.001  44%  728 aa  NOG2_MOUSE RecName: Full=Nucleolar GTP-binding protein 2;
  311::346     0.001  44%  731 aa  NOG2_HUMAN RecName: Full=Nucleolar GTP-binding protein 2;AltName:
  171::241     0.001  37%  642 aa  NOG1_SCHPO RecName: Full=Probable nucleolar GTP-binding protein 1;
    1::71      0.001  27%  186 aa  KGUA_TRIEI RecName: Full=Guanylate kinase;       
  249::292     0.001  39%  549 aa  GNL3_HUMAN RecName: Full=Guanine nucleotide-binding protein-like
  363::396     0.001  53%  607 aa  GNL1_MOUSE RecName: Full=Guanine nucleotide-binding protein-like
   21::55      0.001  49%  208 aa  ENGB_UREPA RecName: Full=Probable GTP-binding protein engB;
   21::55      0.001  49%  208 aa  ENGB_UREP2 RecName: Full=Probable GTP-binding protein engB;
  211::393     0.001  24%  603 aa  ATM1_CHAGB RecName: Full=Iron-sulfur clusters transporter ATM1,
    1::445

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDNVMVVYFKSPG
MNME_RICCN      METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDNVMVVYFKSPG
MNME_RICRS      METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDNVMVVYFKSPG
MNME_RICRO      METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDNVMVVYFKSPG
MNME_RICM5      METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDNVMVVYFKSPG
MNME_RICAH      METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGKKAFKPRLMYYQQIIAPETKELIDNAMVVYFKLPN
MNME_RICFE      METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRADFKPRIMYYQQITVPKTKELIDNAMVVYFKSPN
MNME_RICCK      METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITFPESGELIDNAMVVYFKSPG
MNME_RICPR      METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKPRLMYYQQIIVPETNELIDNAMVVYFKLPN
MNME_RICTY      METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKPRLMYYQQIISPETNELIDNAMVVYFKLPN
MNME_RICBR      METIFAQSSSFGKAGVAVFRVSGTKSLEVLKLLTGKSNFKPRFMYYQKLTSPESNDLIDNAMVVYFKAPN
MNME_RICB8      METIFAQSSSFGKAGVAVFRVSGTKSLEVLKLLTGKSNFKPRFMYYQKLTSPESNDLIDNAMVVYFKAPN
MNME_ORITB      -KTIFAQSSAKGKAGVAVFRISGSLSLLIVERLCGKFNIVPRKVYYRTIRCYATSQVIDKALIVYFKGEQ
MNME_WOLWR      -ETIFALSTVFGKSGVAVIRISGNYALKALNHFHIKKEIKPRFATLVDL-YDDSSQLIDNGIIIYFPAPN
MNME_WOLPP      -ETIFALSTVFGKSGVAVIRISGNYTLKALNHFHIKKKIKPRFATLVDL-YDDSNQLIDNGIIIYFPAPN
MNME_WOLTR      -ETIFALSTVFGKSGVAVIRISGNHALKALNHFHVNKDMKPRFATLVDL-YDSSDQLIDNGIAIYFPAPN
MNME_ANAPZ      -DTIFALSTAQGKSGVAVIRISGPSSMEALRLLGVKDDISPRVAHCRLLHDSKGR-LIDQAVVLYFPKPG
MNME_PELUB      --TIYALSTGPGISGIAIVRVSGKDTKKVIKLLTNAALPETRVATLRKINKINTSELIDEGIILWFPGPE
MNME_EHRRG      MSTIFALCTPWGKSGVAVIRVSGQDAVKTFMHFKISNAIKPRVATFTPL-YNAAHEVIDEVIVVYFSAPN
MNME_ANAMM      -DTIFALSTPMGKSGVAVIRVSGHDALKSMQLLGVKEPVRSRVATCKTL-YDKKRQPIDQAVVLYFPGPG
MNME_EHRRW      MSTIFALCTPWGKSGVAVIRVSGQDAVKTFMHFKISNAIKPRVATFTPL-YNAAHEVIDEVIVVYFSAPN
MNME_EHRCR      MTTIFALCTPWGRSGVAVIRISGEDAAKAFVHFGINSSIKPRTATFTPL-YDKDGEVIDEAIVVYFVAPN
MNME_EHRCJ      MSTIFALCTPWGKSGVAVIRVSGKDAAKAFLHFGISSSIKPRTATFAHL-YNSKGEIIDEVIIVYFVAPS
MNME_WOLPM      -ETIFALSTVFGKSGVAVIRISGNYALKALNHFHIKKEIKPRFATLVDL-YDDSSQLIDNGIIIYFPAPN
MNME_AGRT5      -DTIYALSSGALPAGVAVIRISGAKAFIALRALTGRDLPLPRTASLCSIR-NRNNEIIDQSLVIVFPAPN
MNME_PARL1      METIYALSTAAGRAGIAVLRLSGPHARAALRALTGRKAGAPREAMLCRFRDPETHAALDRGLAIFFPAPA
MNME_NEOSM      MSTIYALSTVFGKSGVAVFRISGPDALRALELLLDIKQPRPRFVYFARLF--DEQLLIDEVLVVYFASPA
MNME_OCHA4      -DTIFALSSGRLPSGVAVVRISGPKVRFVLETIVGSIPTPRYAAY--KLFRSRNGDPIDRGLALFFPGPN
GTPB3_DANRE     -DTIYSLSSGQGKCGVAVVRVSGPASALAVRRLT-RSLPAPRTASLRSISHPQSKELLDRGLVLWFPGPA
MNME_MAGSA      -ETIYXXXXXXXXXXXXVWRLSGEGSGTALSALTG-KPLPEPXXXXXXXXXDGAGEVLDDGLVLWFPAPH
MNME_BRUC2      -DTIFALSSGRLPSGVAVIRISGPKTRFVYETICQAEPRHAALLTFRS----RNGDAIDRGLILFFPAPH
MNME_CLOAB      -DTIAAISTAIGNSGISIIRVSGKEALSIVDKVFKGKSKKGIIMRYGNIVELSNGDIIDEVIVSFMKGPK
MNME_BRUSU      -DTIFALSSGRLPSGVAVIRISGPKTRFVYETICQAEPRHAALLTFRS----RNGDAIDRGLTLFFPAPH
MNME_BRUO2      -DTIFALSSGRLPSGVAVIRISGPKTRFVYETIRQAEPRHAALLTFRS----RNGDAIDRGLTLFFPAPH
MNME_BRUME      -DTIFALSSGRLPSGVAVIRISGPKTRFVYETICQAEPRHAALLTFRS----RNGDAIDRGLTLFFPAPH
MNME_BEII9      LETIFAPASGQGRSAVAIVRVSGPKAGFLLGALAGYCP-EPRRATLAILHDPENGEALDEALVLWFPGPK
MNME_BRUAB      -DTIFALSSGRLPSGVAVIRISGPKTRFVYETICQAEPRHAALLTFRS----RNGDAIDRGLTLFFPAPH
MNME_BRUA2      -DTIFALSSGRLPSGVAVIRISGPKTRFVYETICQAEPRHAALLTFRS----RNGDAIDRGLTLFFPAPH
MNME_BART1      MDTIFAVSSGLLPSGVAVIRLSGPHVVHIVKTLCGCLP-KARFMHYGNL-IARDGSFLDSALTVFFPAPH
MNME_RHIEC      -DTIYALSSGAPPSGVSIVRISGPLTRNILIRLAGSVP-ADRSASYRTIRT-RNNEPIDNGLVLFFPGPH
MNME_BRUSI      -DTIFALSSGRLPSGVAVIRISGPKTRFVYETICQAEPRHAALLTFRS----RNGDAIDRGLTLFFPAPH
MNME_STRR6      -DTIAAISTPLGEGAIGIVRLSGTDSFAIAQKIFKGKDLNSHTLNYGHIIDPLTGKVMDEVMVGAMKSPK
MNME_STRP2      -DTIAAISTPLGEGAIGIVRLSGTDSFAIAQKIFKGKDLNSHTLNYGHIIDPLTGKVMDEVMVGAMKSPK
MNME_STRPN      -DTIAAISTPLGEGAIGIVRLSGTDSFAIAQKIFKGKDLNSHTLNYGHIIDPLTGKVMDEVMVGAMKSPK
MNME_STRPI      -DTIAAISTPLGEGAIGIVRLSGTDSFAIAQKIFKGKDLNSHTLNYGHIIDPLTGKVMDEVMVGAMKSPK
MNME_RHOPB      -QTIFALSSGRPPAALAIVRVSGPEAAIVLERIAGRLPPPRQAM--RALLHDASAQPIDDAIVLWFPAPR
MNME_MARMM      --TVYALATPAGRSGVAVIRLSXXXXXXXXXXXXXXPRPQPRMATLRALR-DSGGSVMDRGLVLWFPGPG
MNME_STRGC      -DTIAAISTPLGEGAIGIVRLSGTDSFAIAQKIFKGKDLSSHTLNYGHIVDPQNQEVLDEVMIGAMRSPK
MNME_BARHE      MDTIFAVSSGLLPSGVAVIRLSGSHVVHVVTTLCGCLP-KARFMHYGNLTARDGS-FLDSALTVFFPAPH
MNME_CLONN      -DTIAAIATNLGESGVSIIRVSGDKALSIVSIFTGKNDRKTYSMRYGFIIDKDTKEKLDEVIVSYMKGPR
MNME_MESSB      -DTIFALSSGSLPSGIAVIRISGADTRAVLERMAGGLS-EARFAKLTSIYSAE-REVLDRALCLFFPAPA
MNME_BARQU      MDTIFAVSSGLLPSGVAVIRLSGPHVINIVKALCGHLP-KARLMHYGNLTARDGS-FLDSALTVFFPAPH
MNME_STRSV      -DTIAAISTPLGEGAIGIVRLSGTDSFAIAQKIFKGKNLESHTLNYGHIVDPQNQEILDEVMLGAMRSPK
GTPB3_DICDI     -DTIYNLSSGVGKSGVAIIRVSGPQAETVIRKLIKKSDIKSRYATLSTFYNPKTNEQLDKGMFIWFPSPN
MNME_CLOTH      -DTIAAISTPHGAGGVGIIRISGDKAFEIAEIFRGKKDFKSHTINYGKIVNPENGAVLDEVLLSKMEKPK
MNME_RHIME      -DTIYALSSGSLPAGVAIIRVSGPETADALVRLCGTLP-PPRIATLRTIRT-RNGETLDSGLVLYFPTPA
MNME_DINSH      MDTIFALASAPGKSGVAVLRISGSRAFHAGRVLAGG------LPDAQRTSLRKLRDVIDEALVLAFESPN
MNME_CARHZ      -DTIAAISTPLGEGGIGIVRVSGPGAIEAVKNVFIPRQSKSFTLHYGKIVDPADGKIVDEVLVSVMRAPK
MNME_HAEDU      -ETIVAQATPIGRGGVGILRVSGPLAQQVAQEILG-KTLTPRLAHYLPFK-DNDGEILDQGIALFFKAPN
MNME_STRP1      -DTITAISTPLGEGAIGIVRLSGTDALAIAQSVFKGKNLESHTINYGHIINPKTGTIIDEVMVSVMLAPK
MNME_STRPD      -DTITAISTPLGEGAIGIVRLSGTDALAIAQSVFKGKNLESHTINYGHIIDPKTGTIIDEVMVSVMLAPK
MNME_STRP8      -DTITAISTPLGEGAIGIVRLSGTDALAIAQSVFKGKNLESHTINYGHIIDPKTGTIIDEVMVSVMLAPK
MNME_GLUOX      -QVIFALATGPSRAAIAIMRASGPGSDAILKALNGRLPAPRRVSLR---TLRHNGEVLDHAVALWLPGPN
MNME_STRPG      -DTITAISTPLGEGAIGIVRLSGTDALAIAQSVFKGKSLESHTINYGHIIDPKTGTIIDEVMVSVMLAPK
MNME_RHIE6      -DTIYALSSGAPPSGVSVIRVSGTLTRDILFQLVGSVP-AARTASYRTIRT-RYDQPVDSGLVLFFPGPN
MNME_ROSDO      MDTVFALGSAQGRAGVSVIRLSGPAAWAVAETICGSLPDPRKSAV--RVLRAQDGSVIDQALVLAFKAPH
MNME_HAEIG      -ETIVAQATAPGRGGIGILRVSGPLATEVAQAILGKCP-KPRMADYLPFKDADGT-ILDQGIALYFKSPN
MNME_STRP6      -DTITAISTPLGEGAIGIVRLSGTDALAIAQSVFKGKNLESHTINYGHIIDPKTGTIIDEVMVSVMLAPK
MNME_NATTJ      -DTIAALSTPPGEGGIAVIRVSGPDSQNKVKQISSRTDFNNKKMYHGQIVSPETNRILDEVLVVFMNKPY
MNME_STRP3      -DTITAISTPLGEGAIGIVRLSGTDALAIAQSVFKGKNLESHTINYGHIIDPKTGTIIDEVMVSVMLAPK
MNME_ACTPJ      -DTIVAQATPIGRGGVGILRISGPLAQEVAKEVLG-KELKPRLANYLPFK-DQDGTVLDQGIALFFKAPN
MNME_RHOS4      MDTIYALASARGKAGVAVLRLSGPRSHEAVQAF-GVPLPSLRHAALRRLTW--NGEVLDEALVLLFGAGA
MNME_HAEIE      -ETIVAQATAPGRGGIGILRVSGPLATEVAQAILGKCP-KPRMADYLPFKDADGT-ILDQGIALYFKSPN
GTPB3_HUMAN     --TIFALSSGQGRCGIAVIRTSGPASGHALRILTAPRDLPARHASLRLLSDPRSGEPLDRALVLWFPGPQ
MNME_STRSY      -DTIAAISTPLGEGAIGIVRLSGTDAFAIASTVFKGKDLASHSLNYGHAIDPATGQVLDEVMIGAMRSPK
MNME_STRS2      -DTIAAISTPLGEGAIGIVRLSGTDAFAIASTVFKGKDLASHSLNYGHAIDPATGQVLDEVMIGAMRSPK
MNME_ACTP2      -DTIVAQATPIGRGGVGILRISGPLAQEVAKEVLG-KELKPRLANYLPFK-DQDGTVLDQGIALFFKAPN
MNME_RHOPT      -QTIFALATGPLPSAIAILRVSGSRAGDVLRALTGRCDLRSR-----------DGDLIDDGVALWFPTPA
MNME_RHOPA      -QTIFALATGPLPSAIAIVRVSGSRAGEVLTALTGRCDLRSR-----------DGDLIDDGVALWFPTPA
MNME_STRPM      -DTITAISTPLGEGAIGIVRLSGTDALAIAQSVFKGKNLESHTINYGHIIDPKTGTIIDEVMVSVMLAPK
MNME_RHOS1      MDTIYALASARGKAGVAVLRLSGPRSHEAVQAF-GVXXXXXXXXXXXXXTWND--EVLDEALVLLFGAGA
MNME_STRPC      -DTITAISTPLGEGAIGIVRLSGTDALAIAQSVFKGKNLESHTINYGHIIDPKTGTIIDEVMVSVMLAPK
MNME_STRPF      -DTITAISTPLGEGAIGIVRLSGTDALAIAQSVFKGKNLESHTINYGHIIDPNTGTIVDEVMVSVMLAPK
MNME_AQUAE      -EPIVAIATPYGESAIGIVRLSGKGVLDLVKFFKTKREIKPRYAHFGVLYDDKGEELDEGVLI-YYKAPH
MNME_BARBK      MDTIFAVSSGLLPSGVAVIRVSGPRVVDIVKTLCGCLP-KARFMHHGDL-IARDGSFLDSALTVFFPRPH
MNME_THETN      -DTIAAISTFPGEAGIGIVRISGDEALEIISKIKDIKSVKSHTIHYGHIVDPETGEVYDEVLVTVMRKPN
MNME_THEP3      -DTIAAISTFPGEAGIGIVRLSGDDALEIISKIKDIKKVKSHTLHYGHIVDPETEEVYDEVLVSIMKKPN
MNME_HAEI8      -ETIVAQATAPGRGGIGILRVSGPLATKVAQAILGKCP-KPRMADYLPFKDADGT-ILDQGIALYFKSPN
MNME_HAEIN      -ETIVAQATAPGRGGIGILRVSGPLATKVAQAILGKCP-KPRMADYLPFKDADGT-ILDQGIALYFKSPN
MNME_PASMU      -ETIVAQATAPGRGGIGILRVSGPKAVEVAHTVLGKCP-KPRMADYLPFKDSDGN-VLDQGIALYFKAPH
MNME_JANSC      MQTIFAQATARGKAGVAIIRISGPDAFEVGRCLLGSLPDAGRFAL-RDVRTP-LGELLDRGLVLVFKAPA
MNME_THEPX      -DTIAAISTFPGEAGIGIVRLSGDDALEIISKIKDIKKVKSHTLHYGHIVDPETEEVYDEVLVSIMEKPN
MNME_SINMW      -DTIYALSSGSPPAGVALIRVSGPATADALARLCGPLP-PARVATLRTIRT-RNSDILDSGLVLYFPGPA
MNME_HYPNA      --------------------------------------------------------LIDQGIALYANAPH
MNME_RHOPS      -QTIFALATGQLPSAIAMVRVSGPRAGDLLTALTG--SLPPPRTARRVLIRDQNQDLIDDGVALWFAGPA
MNME_RHIL3      ---------------------------------------------------------IDSGLVLFFPAPN
MNME_BACCN      -DTIAAISTALGEGAIAIVRVSGEDAIEKVNRIFKGKDLSSHTIHYGHIVDLDTNQVIEEVMVSIMRAPK
MNME_MANSM      -ETIVAQATPIGRGGVGILRVSGPLATEVAKAVVD-KELKPRMANYLPFK-DEDGTILDQGIALYFKSPN
MNME_GRABC      -------------------------------------------------------EILDQGIILWFAGPG
MNME_ALKOO      -----------GEAGIGIVRISGEKAIELIDKIFKSKDYKSRRITYGHIIDPKTEKVVDEVLVSYMKGPN
MNME_RUTMC      --TICALASGVCKGGIGVVRVSGPLCKVIAKKMLGFVP-KPRYAHYGLFFDQENDE-IDKGIALFFPKPH
MNME_STRA5      -DTIAAISTPLGEGAIGIVRISGTDALKIASKIYRGKDLQSHTLNYGHIVDPDKNEILDEVMLGVMLAPK
MNME_STRA3      -DTIAAISTPLGEGAIGIVRISGTDALKIASKIYRGKDLQSHTLNYGHIVDPDKNEILDEVMLGVMLAPK
MNME_STRA1      -DTIAAISTPLGEGAIGIVRISGTDALKIASKIYRGKDLQSHTLNYGHIVDPDKNEILDEVMLGVMLAPK
MNME_FINM2      -DCIAAISSATGEAGIGIVRMTGEGCADVLDSVFKRADFINRKMTYGHIV--DDNEIVDEVLVCYMKAPH
MNME_DESRM      -DTIVAIATALGEGSIGVIRMSGPDAITI-----GKKVFRPKYIIYGHVINPETGEIIDEVLLSIMRGPK
MNME_VESOH      --TICALASSVGKGGIGIVRVSGPLCKVIAKKMLGFIP-KPRYAYYGLFFDQESTE-IDKGIALFFPKPY
MNME_HAES1      -DTIVAQATPIGRGGVGILRVSGPLAQQVAEQVLG-KTLTPRMANYLPFKDSDGT-VLDQGIALYFKAPN
MNME_GLUDA      --------------------------------------------------------LLDRALVLWFPGPR
GTPB3_RAT       --TIFALSSGQGRCAIAVIRTSGPASGLALRSLTAREPPPARSACLRLLRHPCSGEPLDRSLVLWFPGPQ
MSS1_YEAST      --TIYALSTPANQSAIAIIRISGTHAKYIYNRLVDRKAILRNIYSPSSCSVKESKILLDTSLLLYFQAPY
MNME_SILST      METIFALATAQGKAGVAVIRVSGPHAIEIGEKLT-RRTLPARGMIFSKLK-DSAGEILDEALVLSFTSPD
MNME_CLOBK      ------------------------KSLDIVSSIFKGKDIKPYSMRYGFIIEKESKEMIDEVLVSYMKGPR
MNME_CLOBH      ------------------------KSLDIVSSIFKGKDIKPYSMRYGFIIEKESKEMIDEVLVSYMKGPR
MNME_CLOB1      ------------------------KSLDIVSSIFKGKDIKPYSMRYGFIIEKESKEMIDEVLVSYMKGPR
MNME_HAES2      -DTIVAQATPIGRGGVGILRVSGPLAQQVAEQVLG-KTLTPRMANYLPFKDSDGS-VLDQGIALYFKAPN
MNME_RHOP5      -QTIFALSSGRPPSAIAIVRVSGSRGAKIVEALAGR--LPTPRMAMRALIKDRDGEPIDDAVVLWFPGPA
MNME_STRMU      -DTITAIATPLGEGAIGIVRISGSKALAIIKKIFKGKDVPSHTINYGHIV--ENGAIIDEVMVSVMRAPK
MNME_GEOSL      -DTIAAISTAAGEGGVGIVRVSGPDAPSIARRVFRRGDFESHRFYYGSVVDAVTGEAVDEAMAVLMVRPR
MNME_LISW6      -DTIAAISTPPGEGAIAIIRLSGPEAIQIADRIFYAKEAESHTIHYGHIK--EDGEVIEEVMVTVMRAPR
MNME_ARCB4      -DTIVAIATANGIGSISIVRVSGAKALEIATKISKKNNFKARLATLSTI-YDSKNEIIDEALVIYFKSPF
MNME_ACIAD      --TIAAIATPPGRGGVGVIRLSGPKASLIAEHLTAKTLPAARMAGFRQFYDAEGL-VMDEGLVLYFPNPN
MNME_CLOBL      ------------------------KSLDIVSSIFKGKDIKPYSMRYGFIIEKESKEMIDEVLVSYMKGPR
MNME_PROMH      -DTIVAQATPPGRGGVGILRVSGPKAAVVAQTILGKVP-KPRYADYLPFR-NEDNSVLDQGIALFFPNPN
MNME_BACWK      -DTIAAISTALGEGAIAIVRVSGDDAIEKVDRIFKGKDLSSHTIHYGHIVDLDTNQVIEEVMVSIMRAPR
MNME_BACAH      -DTIAAISTALGEGAIAIVRVSGDDAVEKVNRIFKGKDLTSHTIHYGHIVDLDTNQVIEEVMVSIMRAPR
MNME_SILPO      MDTIFALATAQGKAGVAVIRLSGPRAYHTACLLAG-PDLPSRGLSVRQLKDSQGARLDDGV-VLTFAAPA
MNME_LISMO      -DTIAAISTPPGEGAIAIIRLSGPEAIQIADRIFYAKEAESHTIHYGHIK--EDGEVIEEVMVTVMRAPR
MNME_LISMF      -DTIAAISTPPGEGAIAIIRLSGPEAIQIADRIFYAKEAESHTIHYGHIK--EDGEVIEEVMVTVMRAPR
MNME_LACBA      -DTIAAISTPPGEGGISIIRLSGEEVFQVAAKLFKGADLTSHTIHYGHILDPETGDEVDEVMVTVMRAPK
MNME_CLOTE      -DTIAAISTVLXXXXXXXXXXXXDKSLAIVNKLFKAKDMKPYTMKYGHIIEQDTKNILDEVLISYMKAPR
MNME_NITHX      -QTIFALSSGRPPSAIAVVRVSGAEAGTALQEIAGAIPV---VRTAKRVLLRDLLEAIDDAIVLWFAGPA
MNME_LISIN      -DTIAAISTPPGEGAIAIIRLSGPEAIQIADRIFYAKEAESHTIHYGHIK--EDGEVIEEVMVTVMRAPR
MNME_BACHK      -DTIAAISTALGEGAIAIVRVSGDDAVEKVNRIFKGKDLTSHTIHYGHIVDLDTNQVIEEVMVSIMRAPR
MNME_BACCZ      -DTIAAISTALGEGAIAIVRVSGDDAVEKVNRIFKGKDLTSHTIHYGHIVDLDTNQVIEEVMVSIMRAPR
MNME_BACAN      -DTIAAISTALGEGAIAIVRVSGDDAVEKVNRIFKGKDLTSHTIHYGHIVDLDTNQVIEEVMVSIMRAPR
MNME_ACIBY      --TIAAIATPPGRGGVGVIRLSGPKAYDIAQKLTQKNLPEARMAGFRKFYDTDGS-IMDEGIVLCFPNPH
MNME_ACIBT      --TIAAIATPPGRGGVGVIRLSGPKAYDIAQKLTQKNLPEARMAGFRKFYDADGS-IMDEGIVLCFPNPH
MNME_LACS1      -DTIAAISTPPGEGAISIVRLSGEDAVKIANKVFKGKNLETHTINYGHIVNPKTNEELDEVMVSVMLAPR
MNME_FRAP2      -DTIVAVATPQGNGGIGIVRISGSDALSIAEKLT-KKRLKPR--YATFCNIYNINEIIDHGIVIFFNSPN
MNME_BACCR      -DTIAAISTALGEGAIAIVRVSGDDAVEKVDRIFKGKDLTSHTIHYGHIVDLDTNQVIEEVMVSIMRAPR
MNME_STRTD      -DTITAISTPLGEGAIGIVRLSGTDAIAIANKVFKGKNLESHTINYGHIV--ENNEIIDEVMVSVMRAPK
MNME_STRT1      -DTITAISTPLGEGAIGIVRLSGTDAIAIANKVFKGKNLESHTINYGHIV--ENNEIIDEVMVSVMRAPK
MNME_STRT2      -DTITAISTPLGEGAIGIVRLSGTDAIAIANKVFKGKNLESHTINYGHIV--ENNEIIDEVMVSVMRAPK
MNME_ACTSZ      -ETIVAQATPIGRGGVGILRVSGPLXXXXXXXXXXXXXXPRFANYLP--FKDEDGTTLDQGIALFFQSPN
MNME_SHESR      -------------------------------------------------------QVIDQGIALYFKGPN
MNME_SHEPC      -DTIVAQATAPXXXXXXXXXXXXDKATDVAMAVLGHLP-KTRYADYCDFK-NATGQVIDQGIALFFKGPN
MNME_SHESW      -DTIVAQATAPXXXXXXXXXXXXDKATDVAMAVLGHLP-KTRYADYCDFK-NATGQVIDQGIALFFKGPN
MNME_PHOPR      -DTIVAQATXXXXXXXXXXXXSGPKAKEVALAVAGR-ELKTRYAEYLPFK-NEDGSALDQGIALFFKGPN
MNME_BACC1      -DTIAAISTALGEGAIAIVRVSGDDAVEKVNRIFKGKDLTSHTIHYGHIVDLDTNQVIEEVMVSIMRAPR
MNME_CAUCR      ---------------------------------------------------------LDAALVLRFEKPA
MNME_CAUCN      ---------------------------------------------------------LDAALVLRFEKPA
MNME_BRASB      -QTIFALSSGRPPSAIAIVRLSGVGAGPALQTLTGKXXXXXXXXXXXXXXXXG--DPIDDAVVLWFPGPA
MNME_BACSU      MDTIAAISTPMGEGAIAIVRLSGPEAIQIAKIYKGPKSVESHTIHYGHIVDRPSDRVVEEVMVSVLKAPR
MNME_BACP2      MDTIAAISTPMGEGAIAIIRLSGPEAVQIARMYKGPKEKKSHTIHYGHIVDARTDQVIEEVMVSVLRAPK
MNME_SHESM      -------------------------------------------------------QVIDQGIALFFKGPN
MNME_SHESA      -------------------------------------------------------QVIDQGIALFFKGPN
MNME_NITWN      -QTIFALSSGRPPSAIAVVRASGSQAGTALRKLAGA--IPAARTAKRVLLRDSVGEAIDDAVILWFPAPA
MNME_LACLA      -DTIAAISTPLGEGAIAIVRLSGTDALKIAQSVYKGKNLTSHTINYGHIF--EEKRLVDEVMVSVMRAPK
MNME_RHOP2      -QTIFALASGRLPSALAIVRVSGARARDVLAALTGA--LXXXXXXXXXXXXXXNHELIDDAVVLWFAAPA
MNME_COXBU      -ETIAAQATPXXXXXXXXXXXXXEKTKAIAQKILG---CVPKPRYATFVKFRDSGSVIDEGIALYFPKPN
MNME_COXBR      -ETIAAQATPXXXXXXXXXXXXXEKTKAIAQKILG---CVPKPRYATFVKFRDSGSVIDEGIALYFPKPN
MNME_COXBN      -ETIAAQATPXXXXXXXXXXXXXEKTKAIAQKILG---CVPKPRYATFVKFRDSGSVIDEGIALYFPKPN
GTPB3_MOUSE     --TIFALSSGQGRCAIAVIRTSGPASGLALRSLTALQEXXXXXXXXXXXXXXXXSEPLDRSLVLWFPGPQ
MNME_THEM4      -DTIAAVSSPHGTGAIAVIRIDGPKSHDIAKKLTGLNKVEYRRVYTTYLNFEG--DILDQVNIVFFKSPN
MNME_LACC3      -DTIAAISTPPGEGAISIVRLSGETAVATANQVFKGKDLKSHTIHYGHIVDPESGELIDEVMVSVMLAPK
MNME_BACHD      -DTIAAISTALGEGAIGIVRLSGDEAVQLARVYRGKKPLQSHTIVYGHIVDPKTDEIIDEVMVSVLRAPR
MNME_SULNB      --TIAAIATAYGVXXXXXXRVSGNAALDIAKKISHLEEVKPRHAHLTSLYNSQN-DLIDQAIMIYFKAPF
MNME_SHEAM      -DTIVAQATAPXXXXXXXXXXSGKLASDVAHTLLGHLP-KPRYADFCDFKAADGS-VIDQGIALFFKGPN
MNME_LACLM      -DTIAAISTPLGEGAIAIVRLSGTDALKIAQSVYKGKNLASHTINYGHIF--EEERLVDEVMVSVMRAPK
MNME_VIBC3      -DTIVAQATALXXXXXXXXXXSGPLAAHVAQTVTGRT-LRPRYAEYLPFTDEDGQQL-DQGIALFFPNPH
MNME_SHEON      -------------------------------------------------------QVIDQGIALFFKGPN
MNME_CLOD6      -----------GEGGIGILRISGEKALEIFKSMSGKEEYNKRTLIYGNIV--DNENIIDEVLLAYMKGPN
MNME_STAAT      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPESKEVIEEVMVSVLRAPK
MNME_STAAE      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPESKEVIEEVMVSVLRAPK
MNME_STAAC      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPESKEVIEEVMVSVLRAPK
MNME_STAA3      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPESKEVIEEVMVSVLRAPK
MNME_LACLS      -DTIAAISTPLGEGAIAIVRLSGTDALKIAQSVYKGKNLASHTINYGHIF--EEERLVDEVMVSVMRAPK
MNME_GEOMG      -DTIAAIGTPVGEGGIGIIRVSGPDXXXXXXXXNENGDFVSHRFYYGTVVDPESRDTVDEVMAVLMRAPR
MNME_BACA2      MDTIAAISTPMGEGAIAIVRLSGPEAVKIAKMYKGPKSAESHTIHYGHIADSTTGRIIEEVMVSVLRAPR
MNME_LACSS      -DTITAISTPPGEGAISIVRLSGDDSLAIIKRVYRGKDLDSHTINYGHIIDPKTDAVVDEVMVSVMRAPK
MNME_PSEHT      -------------------------------------------------------EQLDQGIAIYFAGPN
MNME_BRASO      -QTIFALSSGRLPSAIAIVRLSGPHAGAALQMLAGKMP-APRLVTRALLRDPQG-EPIDDAVVLWFPAPA
MNME_STRAG      -DTIAAISTPLGEGAIGIVRISGTDALKIASKLRGKSAIQSHTLNYGHIVDPDKNEILDEVMLGVMLAPK
MNME_LACAC      -DTIAAISTPIGEGGISIVRMSGEDAIKIANEVFKGADLATHTIHYGHIIDPDTGKTIDESMVTVLRAPK
MNME_SHESH      -DTIVAQATAPXXXXXXXXXXXXDQASEVAMALLGHIP-KTRYADYCDFKDGEG-EVIDQGIALYFQGPN
MNME_MARAV      -----------GQAGVGIVRVSGPRAMAIARTMLGFEP-KPRYAHYGPFR-DRQGELIDEGIGLYFPNPH
MNME_ENTFA      -DTIAAISTPPGEGAISIVRLSGEQAVAIANKVSGTKDLATHTIHYGHIVDPQNDQLIDEVMLSVMRAPK
MNME_CLOPS      -DTIAAIATALGEGGIAIIRVSGNKALEIVNKINGKDDIKPYTMRYGHMXXXXXXXXXXXXXS-FMKGPR
MNME_BACLD      MDTIAAISTPMGEGAIAIVRMSGPEALAIADKVRGKRSVDSHTINYGHIVDPETEKVVEEVMVSVLKAPK
MNME_VIBPA      -DTIVAQATAXXXXXXXXXXXXXXKANQVALEVTG-KTLKPRYAEYLPFQA-EDGTVLDQGIALYFPNPH
MNME_GRAFK      -DTIVALATPSGAGAIAIIRVSGPDALEIVAPLKSKKDLAKQPTHTLHLNVMDGERTIDEVLASVFRAPK
MNME_VIBVY      -DTIVAQATAXXXXXXXXXXXXXXQAAQVALEVTG-KTLKARYAEYLPFKAQDGSEL-DQGIALFFPNPH
MNME_VIBVU      -DTIVAQATAXXXXXXXXXXXXXXQAAQVALEVTG-KTLKARYAEYLPFKAQDGSEL-DQGIALFFPNPH
MNME_CLOPE      -DTIAAIATALGEGGIAIIRVSGNKALEIVNKINGKDDIKPYTMRYGHMXXXXXXXXXXXXXS-FMKGPR
MNME_CLOP1      -DTIAAIATALGEGGIAIIRVSGNKALEIVNKINGKDDIKPYTMRYGHMXXXXXXXXXXXXXS-FMKGPR
MNME_CLOBM      ------------------------------------------------------------VLVSYMKGPR
MNME_LYSSC      -DTIAAISTPMGEGAIAIVRLSGDEAVAIADKIPGGKSLTSHTIHYGHLVDPKTNEVVEEVMLSLMRGPK
MNME_STAHJ      -DTITSISTPMGEGAIGIVRLSGPQAVEIGKLYKGKKDVDSHTINYGHIVDPETNEVVEEVMISVLRAPR
MNME_SHEWM      -DTIVAQATAPXXXXXXXXXXXXDKASDVAMAVLGHLP-KTRYADYCDFKDAENA-VIDQGIALYFQGPN
MNME_PARUW      -ETIAAIATPPGEGGVAIIRISGDQSLEVAAKIFSGPIFRSHTAHYGQI-YNSSGEHVDDVLVLIMLGKR
MNME_LEGPA      IDTIVAIATXXXXXXXXXXXXSGPKAYAIALCLNGNKALQPRLATFCSL-YKGNNEVLDQGLVLYFKGPH
MNME_ERWT9      -DTIVAQATPPGRGGVGILRVSGSKAAEVAQLLLGKLP-KPRYADYLPFRDADGSTL-DQGIALWFPGPN
MNME_STAES      -DTITSISTPMGEGAIGIVRLSGPQAIEIGDILKGKKEVETHTINYGHIIDPETNETVEEVMVSVLRAPK
MNME_STAEQ      -DTITSISTPMGEGAIGIVRLSGPQAIEIGDILKGKKEVETHTINYGHIIDPETNETVEEVMVSVLRAPK
MNME_GEOTN      -DTIAAISTPMGEGAIAIVRLSGDEAVEIADRLTGKKDVPSHTIHYGHIVDPKSGRIVEEVMVSVMRAPK
MNME_VIBHB      -DTIVAQATAXXXXXXXXXXXXXXKANQVALEVTG-KTLKPRYAEYLPFQA-EDGTVLDQGIALYFPNPH
MNME_THEEB      -DTIAAIATAIQQGSIGIVRLSGAKAVAIAQSLPGKQPWESHRILYGYVRDPQTKERVDEALLLLMLAPR
MNME_SYNEL      -DTIAAIATAIQQGSIGIVRLSGAKAVAIAQSLPGKQPWESHRILYGYVRDPQTKERVDEALLLLMLAPR
MNME_NITSB      --TIAAIATAYGVGSIAIVRISGPKSLSIAQKLSKKKDIQPRVAHLVTL-YDDQSEPIDQAILIYFQAPK
MNME_MARMS      -----------GRGGVGIIRLSGPKSLAIAKQIIG---FEPKPRYAHYVPFKTTQEQLDEGIALYFPGPN
MNME_CLOB8      -DTICAIATPIGEGGVSIIRISGENVLKIAKIFTPRNKYKTYTMKYGNIVDLENKEIIDEVILSYMKAPR
MNME_PHOLL      -DTIVAQATPPGRGGVGILRVSGPKAAQVAEVVLGKLP-KPRYADYLPFRDVDG-QILDQGIAIYFPGPN
MNME_LEGPL      IDTIVAIATXXXXXXXXXXXXSGPNAYAIALCLNGNKALQPRLATFCSL-YKGNNEVLDQGLVLYFKGPH
MNME_FLAJ1      -DSIVALATPSGAGAIAVIRISGAEAVSI-----GNSVFKS--IKNKDLTKQKTHTLLDEVLVSVFKGPN
MNME_PELCD      -DTIVAPATAPGEGGIGIVRLSGSGAEKLLLKFFSPRRFCERLLYYGKFT-DETGKIVDEVMAVIMRKPR
MNME_PSEPG      -ETIAAIATAQGRGGVGIVRLSGPLAGKAGQLITGRT-LTPRHAHYGPFR-DDDGLVLDEGIALFFPGPN
MNME_NITEC      ----------------------------------------------------QNNQVIDQGIVLYFPSPN
MNME_LEGPC      IDTIVAIATXXXXXXXXXXXXSGPNAYAIALCLNGNKALQPRLATFCSL-YKGNNEVLDQGLVLYFKGPH
MNME_CYTH3      ---IVALASPQGIGAIGVIRLSGPQAFDITSSVFPSKNIAAVPTHTVHVNIEDEGRILDEVVVTVFKGPK
MNME_AZOC5      -DTIFALSSGRVPSGVAVVRASGPRAREXXXXXXXXVP-PPRVARYVALREPGTGDLLDRGLILFFPGPR
MNME_PSEPW      -ETIAAIATAQGRGGVGIVRLSGPLAAKAGQLITGRT-LTPRHAHYGPFRDQEGL-VLDEGIALFFPGPN
MNME_PSEPU      -ETIAAIATAQGRGGVGIVRLSGPLAAKAGLLITGRT-LTPRHAHYGPFRDDEGL-VLDEGIALFFPGPN
MNME_PSEPK      -ETIAAIATAQGRGGVGIVRLSGPLAAKAGLLITGRT-LTPRHAHYGPFRDDEGL-VLDEGIALFFPGPN
MNME_PSEP1      -ETIAAIATAQGRGGVGIVRLSGPLAAKAGLLITGRT-LTPRHAHYGPFRDDEGL-VLDEGIALFFPGPN
MNME_PSYIN      IDTIVAQATAPXXXXXXXXXXXXPDVEAVAKVILGKVP-KLRFAEYLSFS-DQHNEVLDQGIALFFKAPN
MNME_LEGPH      IDTIVAIATXXXXXXXXXXXXSGPNAYAIALCLNGNKALQPRLATFCSL-YKGNNEVLDQGLVLYFKGPH
MNME_FRATO      -------------------------ALEIAEKLT-KKQLKPR--YATFCNVYNDNEIIDHGIVIFFKAPL
MNME_FRATH      -------------------------ALEIAEKLT-KKQLKPR--YATFCNVYNDNEIIDHGIVIFFKAPL
MNME_FRATF      -------------------------ALEIAEKLT-KKQLKPR--YATFCNVYNDNEIIDHGIVIFFKAPL
MNME_SHEHH      -DTIVAQATAPXXXXXXXXXXSGDLASNVAMAVLGHIP-KTRYADYCDFK-EDSGEVIDQGIALFFKGPN
MNME_FRATN      -------------------------ALAIAEKLT-KKQLKPR--YATFCNVYNDNEIIDHGIVIFFKAPL
MNME_FLAPJ      -DTIVALATPSGAGAIAVIRISGNNAIEVFQSVSGKDITKQKSHTLHLGHITDGTKVLDQVLLSIFKGTN
MNME_CALS8      -------------------------SIEVAGKIIKSKRFNSPVRYAALVEVYDNDEFIDQAILIKFKAPH
MNME_BUCCC      ---------------------------------------KERFAYFSSF-YDVKNNLLDQGIALFFLAPK
MNME_ALCBS      -DTIVAIATAPXXXXXXXXXLSGPQALSIASSIVGERLLSPRLAHFCRFR-NQDGDVLDEGLVISFPAPH
MNME_VIBCH      -DTIVAQATAXXXXXXXXXXXXXXLAAHVAQTVTGRT-LRPRYAEYLPFTDEDGQQL-DQGIALFFPNPH
MNME_NEIMA      --TIAAVATAPXXXXXXXXXXSGKNLLPMAQALCGKTP-KPRVATYADFT-DEDGQAIDSGLLLFFAAPA
MNME_DESPS      -ETIAAISTPMGTGGIGVIRISGKESLTILQTINDSCSYRSHQMYYGQIVAADGHQL-DEVLVVYMRAPK
MNME_BACSK      MDTIAAISTALGEGAIGIVRLSGDQAIAIGKLFKGTKDTPSHTIVYGHLMDDASEEAIEEAMVTVMRAPR
MNME_SHEPA      -DTIVAQATAPXXXXXXXXXXSGDLATNVAIAVLGHIP-KTRYADYCDFK-DEAGEVIDQGIALFFKGPN
MNME_LACPL      ----------------------------VTQIFKGKSRVQSHTINYGHIVDPDTHQEVDEVMATVMRAPK
MNME_DICNV      -ETIAAIATPPGIGGVCIIRISGAQAHAIAVNITHKKNLVPRLSHFYDLS----GEQIDQGIVLYFPAPH
MNME_FRATW      -------------------------ALAIAEKLT-KKQLKPR--YATFCNVYNDNEIIDHGIVIFFKAPL
MNME_DESHY      -DTIIALATAVGEGSIHVLRLSGPQAQEIIQRWQEKSNFTLHLGYFRA-----GAKVLDEVLIGRMSAPG
MNME_ANASP      ------------QGSVGIVRVSGSQAIAIAQTLPGKQVWESHRILYGYIRHPQTRQIVDEALLLLMKAPR
MNME_HELMI      -DTIAAVATPPGEGGIGIVRVSGPGARDVLKAVRGVDDWASHTLHLGTIIHPDDHRVIDEALVAWMVAPR
MNME_FRATT      -------------------------ALAIAEKLT-KKQLKPR--YATFCNVYNDNEIIDHGIIIFFKAPL
MNME_FRAT1      -------------------------ALAIAEKLT-KKQLKPR--YATFCNVYNDNEIIDHGIIIFFKAPL
MNME_SERP5      -DTIVAQATPPGRGGVGILRISGRGAKDVAQALLGKLP-KPRYADYLPFR-DAAGATLDQGIALWFPGPN
MNME_VIBF1      -DTIVAQATAXXXXXXXXXXXXXXKAKDVALAVIG-KELKPRYAEYAPFKDENGLEL-DQGIALYFPNPH
MNME_NEIMF      --TIAAVATAPXXXXXXXXXXSGKNLLPMAEALCGKTP-KPRVATYADFTDADG-QAIDSGLLLFFAAPA
MNME_NEIMB      --TIAAVATAPXXXXXXXXXXSGKNLLPMAQALCGKTP-KPRTATYADFTDTDG-QAIDSGLLLFFAAPA
MNME_IDILO      ------------------------------------------------------EQLLDEGIALFFPGPN
MNME_NEIM0      --TIAAVATAPXXXXXXXXXXSGKNLLPMAQALCGKTP-KPRVATYADFTDADG-QAIDSGLLLFFAAPA
MNME_ENTS8      -DTIVAQATPPGRGGVGILRVSGQQARNVAQAVLGKLP-KARYADYLPFKDADGTAL-DQGIALWFPGPN
MNME_YERE8      -DTIVAQATPPGRGGVGILRVSGRAAATVAQAVLGKLP-KPRYADYLPFKDVDGSTL-DQGIALYFPGPN
MNME_YERPS      -DTIVAQATPPGRGGVGILRVSGRAASEVAHAVLGKLP-KPRYADYLPFKDVDGSTL-DQGIALYFPGPN
MNME_YERPB      -DTIVAQATPPGRGGVGILRVSGRAASEVAHAVLGKLP-KPRYADYLPFKDVDGSTL-DQGIALYFPGPN
MNME_YERP3      -DTIVAQATPPGRGGVGILRVSGRAASEVAHAVLGKLP-KPRYADYLPFKDVDGSTL-DQGIALYFPGPN
MNME_RHILO      -DSIVALSSGRLPAGVAVLRISGPQTRFVVETIAGGM-VKDRVAVLRRFKAPDGT-VLDSGLVIFFPGPA
MNME_ANAVT      ------------QGSVGIVRVSGSQAIAIAQTLPGKQVWESHRILYGYIRHPQTRQIVDEALLLLMKAPR
MNME_YERPY      -DTIVAQATPPGRGGVGILRVSGRAASEVAHAVLGKLP-KPRYADYLPFKDVDGSTL-DQGIALYFPGPN
MNME_YERPP      -DTIVAQATPPGRGGVGILRVSGRAASEVAHAVLGKLP-KPRYADYLPFKDVDGSTL-DQGIALYFPGPN
MNME_YERPN      -DTIVAQATPPGRGGVGILRVSGRAASEVAHAVLGKLP-KPRYADYLPFKDVDGSTL-DQGIALYFPGPN
MNME_YERPG      -DTIVAQATPPGRGGVGILRVSGRAASEVAHAVLGKLP-KPRYADYLPFKDVDGSTL-DQGIALYFPGPN
MNME_YERPA      -DTIVAQATPPGRGGVGILRVSGRAASEVAHAVLGKLP-KPRYADYLPFKDVDGSTL-DQGIALYFPGPN
MNME_SACD2      -ETIAAIATAXXXXXXXXXXXXXXKALPIAQHILGITP-KPRYAHYGDFC-NANGDILDQGIALYFPNPH
MNME_FERNB      -DTIVALSTXXXXXXXXXXRISGNKSXXXXXXXXXXXXXXXXXXXXRRINYDENGEIIDEIMFVYFKSPR
MNME_TRIEI      ------------QGSVGIVRMSGSEAMKIAQTLPGKQVWETHHILYGYIRHPHTGQLVDETLLLIMKAPR
MNME_AKKM8      -----------------VIRMSGPGCMDILKQCTPAA-FTERLRPRRATLVDAEGAAIDQALVTWFPAPA
MNME_ZYMMO      MKTIFALSSGRPPAGIAVIRISGSAAADTACLLTRKKIPEARRAVLRNLYDPDSGEQLDQSLLLWLPAPK
MNME_THELT      -DTIVAISTPIGTGAISVIRMSGSKSWQICQNVLLRKTKIEPRKAFHNYVKDSDGTILDEVMVIFYKSPN
MNME_NEIG2      --TIAAVATAPXXXXXXXXXXSGKNLLPMAQALCGKTP-EPRVATYADFTDADG-QAIDSGLLLFFAAPA
MNME_NEIG1      --TIAAVATAPXXXXXXXXXXSGKNLLPMAQALCGKTP-EPRVATYADFTDADG-QAIDSGLLLFFAAPA
MNME_LACH4      -DTIAAISTPIGEGGISIVRMSGEDAVKIANEVFKGADLTTHTIHYGHIVDPDTDKTIDESMVTVLRAPK
MNME_SULDN      -DTISAIATANGXXXXXXXXXXXXXXLEIASKITHKDNFTPRYASLSNI-YDFHGELIDEAIVIYFKAPF
MNME_SHELP      -DTIVAQATAPXXXXXXXXXXSGDKASDVAMAVLGHLP-KVRYADYCDFKAADGA-VIDQGIALYFKGPN
MNME_HELAH      -DTIAAVATPLGKGAISIVKISGNNALNILKQLTKKQDFTPRYAYVCDIF--SNNILLDKALAIYFKAPY
MNME_PARD8      MSTICAISTAPGVGGIAVIRVSGPDTFKICDRIFRPKKAGKSLSTQKAYTVGNNDETIDEVIAAVFRAPH
MNME_EXIS2      -DTIAAISTPMGEGAIAIVRLSGPKAVEVYRGANRLTDVPTHTIHYGKLXXXXXXXXXXXXXXSVMRAPK
MNME_YERPE      -DTIVAQATPPGRGGVGILRVSGRAASEVAHAVLGKLP-KPRYADYLPFKDVDGSTL-DQGIALYFPGPN
MNME_SODGM      -DTITALATPPGRGSVGILRVSGPLAAPVARALLGKLPRPRQAEYLPFRDDDGTT--LDQGIALFFPGPH
MNME_PELTS      -DTIAAISTPIGEGGIGIVRISGPDAVKVAKFLTKRKDWDQRLIYGH--VFDREGNIVDEVLLSFMRAPR
MNME_UNCTG      -DTIAALSTAAGKSAIAVIRLSGENSFQIIG-----KIFKTHSKPEQQVKITDGIEKKDEVLCTFFKAPH
MNME_GEOUR      -DTIAAISTPTGEGGVGIIRVSGRHVLSIADAIFKRNGLQSHRFYYGAIIDPVSADCLDEVMVVFMKGPH
MNME_CLOK5      -------------------------------------DIKPYSMRYGFIIEKDTGEILDEVLVSFMKGPK
MNME_CHRVO      --------------------------LPFAQAISGGKTPKPRYATYTDFFDAHGQAL-DNGLLLFFPGPN
MNME_SALPK      -DTIVAQATPPGRGGVGILRISGLKARDVAQEVLGKLP-KPRYADYLPFKDVDGSAL-DQGIALWFPGPN
MNME_DESAP      ----------------------------------GEKDWRAGRMYYGHAVDPGTGETVDEVLVSVMRAPK
MNME_CYAP4      -QTIAAIATAIQQGSIAIVRLSGSEAVAIAQRLPGQQVWESHRILYGYVCNPRTGQRVDEALLLLMLAPR
MNME_LACGA      -DTIAAISTPIGEGGISIVRLSGEDAVAIANKLFKGADLTTHTIHYGHIVDPKTKEVVDETMVSVLRAPK
MNME_ENT38      -DTIVAQATPPGRGGVGILRISGLKAREVAEAVLGKLP-KPRYADYLPFNDADGTAL-DQGIALWFPGPN
MNME_LARHH      -DTIAAIATAPGRGGVGVIRLSGRNLLPLAGQLSGGRQPRPRHALYTDF-VASDGQAIDSGLLLYFPAPH
MNME_PSEF5      -ETIAAIATAQXXXXXXXXXXSGPLAGAAAKAISGR-ELKPRFAHYGPF-LSEQEEVLDEGIVLYFPGPN
MNME_PEDPA      ----------------------------------------SHTINYGHIIDPENGNEVDEVMVSVMRAPH
MNME_SALPA      -DTIVAQATPPGRGGVGILRISGLKARGVAQEVLGKLP-KPRYADYLPFKDVDGSAL-DQGIALWFPGPN
MNME_OCEIH      -DTITAISTPVGEGAIAIVRLSGSEAITITQIFEGKQEVPSHTIQYGKIIDPGTNEVAEEVMVSIMRGPK
MNME_NITMU      ----------------------------------------------------ENDRVIDQGIALYFPAPQ
MNME_STAAB      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_SALTI      -DTIVAQATPPGRGGVGILRISGLKARDVAQEVLGKLP-KPRYADYLPFKDVDGSAL-DQGIALWFPGPN
MNME_PROMA      -----ASAVAPGQGAIAIVKVSGASAKEVVKNVVSNKIWSSHKILYGHVIDKSTKKNIDEVLILIMDGPR
MNME_STAAW      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_STAAR      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_STAAN      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_STAA9      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_STAA8      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_STAA2      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_SHEB9      -DTIVAQATAPXXXXXXXXXXXXDKASDVAMAVLGHLP-KTRYADYCDFK-SASGQVIDQGIALFFKGPN
MNME_SHEB8      -DTIVAQATAPXXXXXXXXXXXXDKASDVAMAVLGHLP-KTRYADYCDFK-SASGQVIDQGIALFFKGPN
MNME_KLEP3      -DTIVAQATPPGRGGVGILRISGLKARDVAQAVLGKLPKPRYADYLPFNDVDGTP--LDQGIALWFPGPN
MNME_PSEPF      -ETIAAVATAQXXXXXXXXXXSGPLASVAAKAISGR-ELKPRFAHYGPF-FSDNQQVLDEGLALYFPGPN
MNME_MYCAP      -DTITAISSG-GKINISIIRVSGPDSVNVVKIFTGKVGTSHTITFGNIVDNLNGNEVIDEVLCMWFLGTN
MNME_PSEA6      -----------------------------------------------------TGEPLDQGIALFFKAPH
MNME_GEOKA      -DTIAAISTPMGEGAIAIVRLSGDQAVEIADRLSGKKDVPSHTIHYGHIIDPKXXXXXXXXXXXXXXAPK
MNME_CAMHC      -ETIVAVATAHGIGGISIVRLSGENALSLSDILINKNRKKNRIQNFKKINLKPRYELYDNSVVIYYKSPN
MNME_SULMW      ------------------------------------------------------KQIIDKVLIFLFKKPK
MNME_SHEB5      -------------------------------------------------------QVIDQGIALFFKGPN
MNME_HELPS      -DTIAAIATPLGKGAISVIKISGNSALNILKQLTQKQDFTPRYAYVCDIF--SNGVLLDKALVIYFKAPY
MNME_SHEDO      --------------------------------------------------------VIDQGIALFFKGPN
MNME_LACJO      -DTIAAISTPIGEGGISIVRLSGEDAVAIANKLFKGADLTSHTIHYGHIVDPKTKDVVDETMVSVLRAPK
MNME_CAUSK      ---------------------------------------------------------LDDALVLWFQGPA
MNME_AMOA5      -EPIIALATPAGKSAIAVIRLSGQNVISIVNQVFKGKDLNQQPSHTIHFTINYQGEMIDEVLIALFKAPR
MNME_SHISS      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_PORGI      -DTICAVATAPGVGGIAVIRVSGADAFRLVSLYRGKSGAKPRTALYGEIM--EADELIDEVILTCFHGPH
MNME_POLSQ      ---IIAVATAPGKAGVGVVRISGQGLGELVETLFHRS------LAPRQATLDADNQPIDQLLAIYFVGPA
MNME_PETMO      -DTIVAISSPIGTGAIGVVRISGDHVKNIIDQALKRKKYTPKKMYYGWLYDKEG-EKVDEITWVYHSQPH
MNME_KLEP7      -DTIVAQATPPGRGGVGILRISGLKARDVAQAVLGKLPKPRYADYLPFNDVDGTP--LDQGIALWFPGPN
MNME_ESCF3      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECOUT      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECOSM      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECOL6      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECOL5      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECOK1      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECO81      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECO7I      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECO45      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECO27      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_STAAS      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_STAAM      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_STAA1      LDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKDVPSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_SHIDS      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_SHIBS      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_SHIB3      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECOSE      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECOLI      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECOLC      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECOHS      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECODH      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECOBW      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECO8A      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECO5E      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECO57      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_ECO55      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_BRAJA      -QTIFALSSGRPPSAIAVVRVSGAQAGLVLTTLAGKLPAPRQAS--RRLLRDGTGQPIDDAVVLWFPGPA
MNME_THEP1      MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKLRTRSEIVPRKAIHGWIH--ENGEDVDEVVVIFYKSPK
MNME_COLP3      ---------------------------------------KAEYLPFLDCTSTDKTQVLDQGIALYFKAPN
MNME_CLOPH      -DTIAAIATGLSNAGISIVRISGDQAFAVIDKIFQTKSKAKRLSEMDSHTVXXXXXXXXXXXXXXXRAPR
MNME_BRAHW      -DTIAALSTPYSKSALAIIRMSGSKALEIASKICXXXXFEHRKSYYALIK-DENNIPVDEVIVLSSLSPN
MNME_SHIFL      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_SHIF8      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_PSEE4      -ETIAAIATAQGRGGVGIVRLSGPLASQAGQAITGRT-LTPRHAHYGPFRDADGL-VLDEGIALFFPGPN
MNME_PSEAB      ---------------------SGPLAGQIAVAVSGRQ-LKARHAHYGPF-LDAGGQVIDEGLSLYFPGPN
MNME_HAHCH      ----------------------------------------------------EEGDTLDSGIALLFIAPN
MSS1_SCHPO      --TIYALSTPPGTSAVAIVRISGPNACKVAKTLAGSVP-KPRIASLRTIKHPVRSEVIDKALMLYFKKPS
MNME_PELPD      ----------------------------------------SHRFYYGTLIDIQTGAVVDEVMAVIMRAPH
MNME_CAMFF      ---IVALASAYGVGSISIVRLSGDGAYD-LAINLCKKPLTPRYAHLRKLYC-ENMVFLDEAIVIYYKAPF
MNME_ALKMQ      -DTIAAIATAHGEAGIGIVRISGEKALQVFQSKQGKKDISPRRITYGHIIDTERNERIDEVLVSYMKGPH
MNME_AERHH      -DTIVAQATAPXXXXXXXXXXXXPAAEQVAEIVLGKLP---RVRYAEYLPFDEQGQPLDQGIALLFKAPN
MNME_MICAN      ------------QGSIGIVRLSGSEAVAIARRLPNRQKWQSHRLLYGYIRHPQSQAIIDEALLLLMLAPR
MNME_ECOLU      -DTIVAQATPPGRGGVGILRISGLKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_BAUCH      -DTIAAQATPNXXXXXXXXXXSGTLTTRVAKELLGKVPIQRKLTFYHQ-----NGNIIDKGIALFFPGPN
MNME_SHEFN      -------------------------------------------------------QVIDQGIALFFKGPN
MNME_RHOS5      MDTIYALASARGKAGVAVLRLSGPQAYEAVAAF-GVSLPEVRRAALRRLTW--NGEVLDEALILLFAEGA
MNME_CAMC1      -ETIAALATAYGIGSVSIVRLSGKDXXXXXXXXXXXXXXEPRYAKLAKIYSIDD-EILDEGIVIYFKAPA
MNME_AERS4      -DTIVAQATAPXXXXXXXXXXXXPAAEQVAEIVLGKLP---RVRYAEYLPFKDEQQPLDQGIALLFKAPN
MNME_POLNA      ---IVAIATAPGRGGVGIVRLSGQRIAPVVQALCGRKLSPRQATYLPFRDAHG--QIIDKGLAIFFPAPH
MNME_ECO24      -DTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLP-KPRYADYLPFKDADGS-VLDQGIALWFPGPN
MNME_NITEU      ----------------------------------------------------QNSQIIDQGIALYFPSPH
MNME_LEPBL      -DTIAAVSTASGPGAIGIIRMSGPGALSISSSFLFSKDIQPRIAIQCVFQIGDRK--IDQILFFYFKTPN
MNME_LEPBJ      -DTIAAVSTASGPGAIGIIRMSGPGALSISSSFLFSKDIQPRIAIQCVFQIGDRK--IDQILFFYFKTPN
MNME_THICR      ------------------------KAAEIAEHVLGKCP-KPRYAHYGPFLGAEG-QVLDQGIALFFPNPH
MNME_SALAR      -DTIVAQATPPGRGGVGILRISGLNAKKVAQTVLGKLP-KPRYADYLPFKDADGATL-DQGIALWFPGPN
MNME_BACTN      -DTICAIATAQGGA-IGSIRVSGPEAISITSRIFQPAKAGKLLSEQKPYTLTNGEEVIDEVLVSLFRAPH
MNME_PSEU2      -ETIAAIATAQXXXXXXXXXXSGPLAGKAAEAIIGRT-LKPRFAHYGPF-VDGTGQVLDEGIALYFPGPN
MNME_METFK      --------------------------------------------------------LIDRGIAIYYPGPH
MNME_LEPIN      -DTIAAVSTSSGAGAIGIIRMSGPEALTIXXXXXXXXEILPRTAIQCVFQIGDRK--IDQILFFYFKSPN
MNME_LEPIC      -DTIAAVSTSSGAGAIGIIRMSGPEALTIXXXXXXXXEILPRTAIQCVFQIGDRK--IDQILFFYFKSPN
MNME_PSE14      -ETIAAIATAQXXXXXXXXXXXXPLAGRAAEAIIGRT-LKPRFAHYGPF-VDDAGQVLDEGIALYFPGPN
MNME_NITOC      -DTIAAIATPPGQGSVGIVRVSGPFCRQIAEQVTGRVPFRNRY-----------GEILDQGLILYFPGPH
MNME_ACAM1      ------------QGSIGIVRLSGVEAVSIAKQLPGKQQWESHRVLYGYIQQPLTQQIIDEGLLLLMLAPR
MNME_MOOTA      -DTIAALATPPGEGGISIIRLSGSQAIAIVAKLTTTRSHTLRLGF---IIDPVSGESLDEVLVSVMRAPH
MNME_LACDB      -DTIAAISTPLGEGGISIVRVSGEDAVAIVNRLFKGKDLESHTINYGHIVDPATGQVIDEVMASVMLAPK
MNME_LACDA      -DTIAAISTPLGEGGISIVRVSGEDAVAIVNRLFKGKDLESHTINYGHIVDPATGQVIDEVMASVMLAPK
MNME_FUSNN      LDTIAAISTPRGEGGISIVRMSGQDSLNILEKIFKPKNKKVSELKNYSINIIDNEHIVDEVLVSIMKAPN
MNME_AYWBP      -DTIAAISTPLGTGGVSVIRVSGNNSIEINKIFKGKNLIKAKTHTITHFILNKDQTILDEVLISVFKTPN
MNME_RALEJ      -------------------------------------------------------KVIDHGLALYFPGPN
MNME_PROM1      ----------------------------------GIQDWSTHKVLYGHVTEENRKKYIDEVLILVMKGPR
MNME_CHLPN      -DTIAAIATPPGEGSIAVVRLSGPQAIVIARIFSGSASFASHTIHLGQVIFEET--LIDQALLLLMRSPR
MNME_BACFN      -DTICAIATAQGGA-IGSIRVSGPEAITI----TGRTPAKSGKLLSEQKPYTLTEEMIDEVLVSLFRAPH
MNME_SALTY      -DTIVAQATPPGRGGVGILRISGLKARDVAQEVLGKLP-KPRYADYLPFKDVDGSAL-DQGIALWFPGPN
MNME_SALSV      -DTIVAQATPPGRGGVGILRISGLKARDVAQEVLGKLP-KPRYADYLPFKDVDGSAL-DQGIALWFPGPN
MNME_SALPC      -DTIVAQATPPGRGGVGILRISGLKARDVAQEVLGKLP-KPRYADYLPFKDVDGSAL-DQGIALWFPGPN
MNME_SALPB      -DTIVAQATPPGRGGVGILRISGLKARDVAQEVLGKLP-KPRYADYLPFKDVDGSAL-DQGIALWFPGPN
MNME_SALNS      -DTIVAQATPPGRGGVGILRISGLKARDVAQEVLGKLP-KPRYADYLPFKDVDGSAL-DQGIALWFPGPN
MNME_SALEP      -DTIVAQATPPGRGGVGILRISGLKARDVAQEVLGKLP-KPRYADYLPFKDVDGSAL-DQGIALWFPGPN
MNME_SALCH      -DTIVAQATPPGRGGVGILRISGLKARDVAQEVLGKLP-KPRYADYLPFKDVDGSAL-DQGIALWFPGPN
MNME_CHRSD      -DTIAAIATPPGRGGVGIIRLSGPASRDLAERILGHCP-APRHAHYGPFYDADA-QVLDEGIALFFPGPH
MNME_BACFR      -DTICAIATAQGGA-IGSIRVSGPEAITI----TGRTPAKSGKLLSEQKPYTLTEEMIDEVLVSLFRAPH
MNME_PROMT      ----------------------------------GIQDWSTHKVLYGHVTEENRKKYIDEVLILVMKGPR
MNME_MAGSM      -DCIIGMATPPGTSGVAVLRLSGPGSLVVPYLYTPKGEFKPRVMRRLNFIDPQAPDVLDHMLVVHFPNPH
MNME_CITK8      -DTIVAQATPPGRGGVGILRISGLKAREVAEAVLGKLP-KPRYADYLPFKDADGTAL-DQGIALWFPGPN
MNME_BURXL      -DPIVAIATAPGRGGIGVVRISFGRAGELMQALTGQTLAARRASYVPFLDA--SGDALDRGIALYFPAPH
MNME_SALG2      -DTIVAQATPPGRGGVGILRISGLKARDVAQEVLGKLPKPRHADYLPFKDVDGSA--LDQGIALWFPGPN
MNME_THEMA      MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKLRTRSKIVPRKAIHGWIH--ENGXXXXXXXXXFYKSPK
MNME_STAS1      LDTITSISTPMGEGAIGIVRLSGVDAVDIADKLYKGKDVTSHTINYGHIIDPXXXXXXXXXXXXXLRAPK
MNME_MYCGA      -ETIYALATAPYNSAIHVIRLSGPDAFEIINKICDKQITKEGYRI-QNARIVDNDQIIDDVLLMKFVAPK
MNME_BUCBP      -DTIVSRVTSEGKSSVGIIRISGKLAFEVSIKVLNRDYLPIRTACYLSF-LDLSGKIIDQGIVLWFPGPS
MNME_PSEA7      -------------------------------------------------------QVIDEGLSLYFPGPN
MNME_BORPE      -------------------------------------------------------EVIDEGLAIYFRAPH
MNME_CAMJJ      -DTIAAIATAHGVGSISIVRLSGERALEFALKLSHKTKLTPRHATFTKL-FNQNNEIIDEAIMIYFKAPY
MNME_CAMJE      -DTIAAIATAHGVGSISIVRLSGERALEFALKLSHKTKLTPRHATFTKL-FNQNNEIIDEAIMIYFKAPY
MNME_ACHLI      -QTIAAIATPLGTAGISVIRVSGDEAIKVNQIFKGKNKVKSHTIHYGHI-LNEDGSILDEVMISVFIAPK
MNME_HERAR      --------------------------------------------------------VIDQGLAIYFKAPH
MNME_HELPH      -------------------------ALNILKQLTKKQDFTPRYAYVRDIFSDGV--LLDKALVIYFKAPY
MNME_THESQ      MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKLRTRSKIVPRKAIHGWIH--ENGXXXXXXXXXFYKSPK
MNME_SYNY3      -DTIAAIATAIQQGSIGVVRLSGPQSLTIAKTLPGNQTWESHRILYGHVRHPQTKAAIDEALLLLMLAPR
MNME_RHORT      VDTIFAPATARGRAGVAIVRLSXXXXXXXXXXXXARRATRAALRXXXXXXXXXXXXVLDDALVLWFPAPA
MNME_PSEAE      -------------------------------------------------------QVIDEGLSLYFPGPN
MNME_BORBR      -------------------------------------------------------EVIDEGLAIYFRAPH
MNME_SYNAS      -------------------RISGSEAASILNLLFKSSHFKPRYLYHGDLSDPQTGQVIDEVLVSLMKAPR
MNME_BURS3      ---------------------------------------------------------LDRGIALYFPAPH
MNME_ACICJ      -DVIFAPASGVGGA-ISLLRLSGAGVARVIGALAGSLPAPRRASL--RSFXXXXXXXXXXXXXXWFPGPA
MNME_PSEMY      -DTIAAVATAQXXXXXXXXXXXXPLSGQLAQAIC-RRELKPRFAHHGPF-YGEQELPLDEGLAIYFPGPN
MNME_PECCP      -DTIVAQATPPGRGGVGILRVSGRAAAEVAQAVLGKLPKPRHADYLPFRDANGTT--LDQGIALWFPGPN
MNME_CAMJ8      -DTIAAIATAHGVGSISIVRLSGERALEFALKLSHKTKLTPRHATFTKL-FNQNNEIIDEAIMIYFKAPY
MNME_BURCC      ---------------------------------------------------------LDRGIALYFPAPH
MNME_ACIBL      -DTIVAIATPPGRGGIGVVRLAGPEALLMLRLANGKAELEAQRAHFAELVDPESGERLDEVVVAYFAKPH
MNME_BURTA      -DPIVAIATASGRGGIGVVRISXXXXXXXXXXXXXXXXXXXRLTPRHASYVPGAGEPLDRGIALYFPAPH
MNME_BURCH      ---------------------------------------------------------LDRGIALYFPAPH
MNME_BURCA      ---------------------------------------------------------LDRGIALYFPAPH
MNME_METS4      -DTIFAPASGFGRAAVAVIRISGPGAASCLTALTGHXXXXXXXXXXXXXXDPGTGEVLDRALVVWLPGPA
MNME_CAMJR      -DTIAAIATAHGVGSISIVRLSGERALEFALKLSHKTKLTPRHATFTKL-FNQNNEIIDEAIMIYFKAPY
MNME_CAMC5      -DDIAAIATAHGIGSICIIRLSGSTALQSALKLTKISNLSPRLATLTKIYSLD-KEFLDEAIMIYFKAPA
MNME_SYNP2      -DTIVAIASAVNQGSIGIVRLSGAAALPIARQLPGQQTWESHRILYGYVRHPQTQTIVDEALLLLMLAPR
MNME_PSYA2      LPTIAAIATPLGRGGVGVIRLSGTRAYSIACTLTGKSEFKPRMASFCRFYQADGT-VVDEGLVLYFKGPH
MNME_HELPJ      -------------------------ALNILKQLTQKQDFTPRYAYVCDIFSDGV--LLDKALVIYFKAPY
MNME_CAMJD      -DTIAAIATAHGVGSISIVRLSGERALEFALRFSRKTKLTPRHATFTKL-FNQNNEIIDEAIMIYFKAPY
MNME_SYNWW      -DDIAAISTAPGEGGIAIVRLSGNDVIEKVERLSDKEGYSLSLGWL----CDEKMEIIDEVLLGLMRAPR
MNME_PSYCK      LPTIAAIATPLGRGGVGVIRLSGTHAYSIACTLTGKSAFKPRMASFCRFYQADGT-VIDEGLVLYFKGPH
MNME_HELPY      -------------------------ALNILKQLTQKQDFTPRYAYVHDIF--SNGVLLDKALVIYFKAPY
MNME_ERWCT      -DTIVAQATPPGRGGVGILRVSGQAAAEVAHAVLGKLPKPRHADYLPFRDTNGTT--LDQGIALWFPGPN
MNME_LEPBP      IDTIAALSTAQGPGAIGILRVSGPIALAVLE--KNQKPLTETFLQNQKRSAVENGKPLDQIVFFYFPAPN
MNME_LEPBA      IDTIAALSTAQGPGAIGILRVSGPIALAVLE--KNQKPLTETFLQNQKRSAVENGKPLDQIVFFYFPAPN
MNME_BURCM      ---------------------------------------------------------LDRGIALYFPAPH
MNME_BURA4      ---------------------------------------------------------LDRGIALYFPAPH
MNME_POLSJ      -DPIVAIATAPGRGAVGIVRVSGKDIAPVIAAICGRALAPRQATYLPFRDAQG--QVIDQGLAIHFPAPH
MNME_BURVG      ---------------------------------------------------------LDRGIALYFPAPH
MNME_ACISJ      -DPIVAIATAPGRGAVGIVRVSGKQIGALVQALCGRA-LKPREATYLPFR-DAAGQAIDQGLALYFPAPH
MNME_BACV8      ---------------------------------------KSETLQKTSSITSSAEEVIDEVLISLFRAPH
MNME_JANMA      --------------------------------------------------------VIDQGLAIYFKAPH
MNME_METRJ      -DTLFAPASGFGRAAVAVIRISGPAAGGVLAXXXXXXXXXXXXXXXXXXXXXXXTEL-DRALVAWFPGPD
MNME_SALRD      ---------------------SGPAAIEIVDRCDALTDADSHTAHVGVLT-DEAGTDIDQVVATVFRAPN
MNME_PSESM      -ETIAAIATAQXXXXXXXXXXXXPLAGKTAQAITGRMP-KPRFAHYGPFA-DESGQVLDEGIALYFPGPN
MNME_ONYPE      -DTIAAISTPLGTGGVSVIRVSGNNSIEINKIFKGKDLTKTKTHTITHFILNKNQTILDEVLISVFKTPN
MNME_MYCPU      -------SGAKVNQAISIIRLSGPDVFEIMKKIFTGKVGKDKSITYGYIK--NDQEIIDEVLVMWFKGPN
MNME_PHEZH      ---------------------------------------------------------IDQALVLWFPGPG
MNME_DEIGD      -DTIAAIATAPGSAGVGIVRISGPDALGIADAFRGRRRPSARFLFGQ--LVAGDGEVLDEGLCLVFRGPH
MNME_BUCAP      -DTIIAQVTCPGKSAVGILRVSGIHANQVAFAVLGKIP-KPRFATYSKF-FDESKKVLDEGISLWFPAPF
MNME_BORPA      -------------------------------------------------------EVIDEGLAIYFRAPH
MNME_BORPD      ------------------------------------RELTPRHAHYLPFTA-ETGEHLDEGIALYFRAPQ
MNME_BORA1      -----------------------------IRALLGR-DLTPRHAHYLPF-LAEDGERIDEGIAIYFQGPH
MNME_MYCMO      -DTIAAIATGNSIQAISIIRISGSDSFKIVKKIFTGKIGKNKTITYGNILNHERK-IVDEVLVAWFEGTN
MNME_BORDL      -DDIVALATPFFSSALCVIRSSGVSAIEKFSKMFSDPEASGHTIHYGYILDNETKEKLDEVVVCLYRAPK
MNME_BURPS      -DPIVAIATASGRGGIGVVXXXXXXXXXXXXXXXXXXXXXXRLMPRHASYVPGAGEPLDRGIALYFPAPH
MNME_BURP6      -DPIVAIATASGRGGIGVVXXXXXXXXXXXXXXXXXXXXXXRLMPRHASYVPGAGEPLDRGIALYFPAPH
MNME_BURP0      -DPIVAIATASGRGGIGVVXXXXXXXXXXXXXXXXXXXXXXRLMPRHASYVPGAGEPLDRGIALYFPAPH
MNME_BURMS      -DPIVAIATASGRGGIGVVXXXXXXXXXXXXXXXXXXXXXXRLMPRHASYVPGAGEPLDRGIALYFPAPH
MNME_BURMA      -DPIVAIATASGRGGIGVVXXXXXXXXXXXXXXXXXXXXXXRLMPRHASYVPGAGEPLDRGIALYFPAPH
MNME_BURM9      -DPIVAIATASGRGGIGVVXXXXXXXXXXXXXXXXXXXXXXRLMPRHASYVPGAGEPLDRGIALYFPAPH
MNME_BURM7      -DPIVAIATASGRGGIGVVXXXXXXXXXXXXXXXXXXXXXXRLMPRHASYVPGAGEPLDRGIALYFPAPH
MNME_MYCMS      -DTVVAPATNISTQAIALIRVSGSEALIVNKLIKDKKLEEKRGLFLRKLYFED--ELIDEVVLSCFVAPN
MNME_BORRA      -DDIVALATPFFSSALCVIRSSGVSAIEKFSTMFSDPEASGHTIHYGYILDNETKEKLDEVVVCLYRAPK
MNME_WOLSU      -ETIIALSTPSGAGALAVVKLSGSRALEIALKLSRRDHLQPRHATLANLWNRED-EMMDEAILIYFKAPH
MNME_CHLMU      -DTIAAIATPPGEGSVAIVRVSGPDAISI-----SNRIFSGNIAGYASHTVVHNEVCIDQALVLIMRTPR
MNME_MYCCT      -DTVVAPATNISTQAIALIRVSGSEALIVNKLIKDKKLEEKRGLFLRKLYFED--ELIDEVVLSCFVAPN
MNME_XYLFA      -------------------------------------------------------EVIDDGLALWFPAPH
MNME_SYMTH      -------------------RISGADALQVAERIXXXXXXXSHTVTYGWVVTPGG-DRIDEALALVMRGPH
MNME_PROM5      -DTIAAIASAIGKGGIAVIRVTGEEAINSCKNIVETKSWESHRVFHGYVKDNLENKYIDEILISVMHSPN
MNME_WIGBR      -DSIVAIATPPGKGGIGIIRVSGNLSVKIAKIFLKRLPKEKQAEYIPFYS--KNGNTLDQGIALFFKSPK
MNME_METCA      -DTITAIATPPGKGGVGIVRISGSNLGPVLDALLGRPP-RPRYAEFRHFLDADGRA-IDSGIALYFPAPR
MNME_PSEU5      -------------------------------------------------------EVIDEGLLLFFPGPH
MNME_XYLFT      -------------------------------------------------------QVIDDGLAIWFPAPH
MNME_SYNJB      ------------QGSVGIVRLSGSRALPIVQAIPARRNWESHRLLYGWIR-DEKGQILDEALAVWMQAPR
MNME_HAMD5      -DTIVAQATPXXXXXXXXXXXSGCATKTVAKEILGKLP-RARYAEYLAFKDPEGN-ILDQGIALYFPAPH
MNME_CHLTE      ---IAAIATPVGVGALAIVRISGAGVLDLADRVFRKVHGSGKLAEAAGYTAHDGEEMVDEVIALVFRAPR
MNME_BDEBA      ---------------------------------------ESHKVYFGNLKNSQTGDEIDEVLATYFKEGR
MNME_MYCHJ      -DTICAIASGQINQAISIIRISGPNAFKIME-----KIFLGKVGRSMEITIHDDNQKIDQVLVLWFAGNK
MNME_MYCH2      -DTICAIASGQINQAISIIRISGPNAFKIME-----KIFLGKVGKSMEITIHDDNQKIDQVLVLWFAGNK
MNME_DEIRA      -DTIAAVATAPGSAGVGIVRVSGPRALEIADGLFRGKRRPSRFLFGE---LHADEELLDEGLCLVFRGPR
MNME_CHLFF      -DTIAAIATPPGEGSIAIVRVSGPEAIQITKIFSGPPSFASHTAHLG--TASHHGRQIDQVLLLIMRAPR
MNME_MYCH7      -DTICAIASGQINQAISIIRISGPNAFKIME-----KIFLGKVGKSMEITIHDDNQKIDQVLVLWFAGNK
MNME_SYNE7      -DTIAAIATAIQQGSVGIVRLSGAAATEIARQIAGQQPWESHRILYGYIRDPESGRLVDEALLLPMLAPR
MNME_BUCMP      IETIVAPVTSPGKSAVSILRISGSQTKIVAKKVLGSIP-KARFATYSKF-LGKNSVVLDQGISLWFPAPF
MNME_SOLUE      -ETIVAIATPPGRAGIGMVRVSGPDARAIVSRFVTSIAWQPWQAHLAKLLDQQGHE-IDQVIVTFFERPR
MNME_PROM9      -------------------RVSGKDSINSCKKIVQTKSWESHRVFHGFILENKQNKFIDEVLILVMKSPN
MNME_SYNR3      ---------------------SGPQAEAIGRQLAGKQSWESHRVLYGHVNDPANGDVVDEVLLLLMRAPR
MNME_OPITP      -DTIAALATPAGISALAILRASGPDTRRIAEAILGRTPLPRRI---QRVDYRDRAHILDEVLCVFFPQPR
MNME_SYNJA      ------------QGSIGIVRLSGSRALAIAQAIPARRNWESHRLLYGWIHDEKGRRL-DEALAVWMQAPR
MNME_SYNP6      -DTIAAIATAIQQGSVGIVRLSGAAATEIARQIAGQQPWESHRILYGYIRDPESGRLVDEALLLPMLAPR
MNME_HELHP      --TIVAIATPIGVGAISIVRLSGEKAYHIALALTHKESLKPR--YAHLCHIYDAQQMIDEALVLYFPKPY
MNME_SYNPW      -----------GQGGIAVIRLSGPQAQAAVQSVTGQQSWESHRVLYGHVLAGESGERIDEVLVLLMLAPR
MNME_PSYWF      -----------GRGGVGIIRLSGPKAYAIACALTGKESFTPRLASFCRF-YDANNNVLDEGLVLYFKAPH
MNME_MESFL      -QTIVAPTTNISTQAISLIRISGDDSFXXXXXXXXXXXXXXXXVWVRKMF--DGQELVDEVVITSFVSPA
MNME_RALSO      ---------------------------------------------------------------LWFPAPH
MNME_DECAR      ---------------------------------------------------------IDTGLLLYFPNPQ
MNME_BURP1      -DPIVAIATASGRGGIGVVXXXXXXXXXXXXXXXXXXXXXXRLMPRHASYVPGAGEPLDRGIALYFPAPH
MNME_TREDE      -----------------IVRTSGEGAIDLASAIFSKKEAQGNSILHGWVLDPESKKEVDEVTVCVYREPK
MNME_BUCAI      -ETIVAQVTCPGKSAVGILRISGFQTKIVAIKILGKIPL-ARFATYSNF-LDENNEILDKGISLWFPAPH
MNME_RHOFD      -DPIVAIATAPGRGAVGIVRVSGKSIGSLMQALLGRQ-LRAREATYLPF-LDRSQLAIDQGIALYFPAPH
MNME_RALME      --------------------------------------------------------VIDHGLALYFPAPN
MNME_RALEH      -------------------------------------------------------KVIDHGLALYFPAPN
MNME_MYCPN      -QTMFALATAPFNSAIHIIRLSGPDVYRIINQITN-KEVKPLGMRIQRVLIDHNQKKVDDVLLFKFVAPN
MNME_MYCGE      ---IFALATAPFNSALHIIRFSGPDVYEILNKITNKKITRKGMQIQRTWIVDENNKRIDDVLLFKFVSPN
MNME_BLOFL      --------------------------------------------------------IMEKVITLFFPEPH
MNME_BLOPB      --------------------------------------------------------ILERVIALFFPEPN
MNME_SYNS3      -----------GQGGIAVIRLSGPSAVRAVAAITGQQVWESHRVLYGHVVAAGGVERLDEVLVLVMLAPR
MNME_AZOSE      ---------------------------------------------------------IDEGILLYFPAPH
MNME_SYNS9      LDTIAAVATAVGQGGIAVIRLSGPXXXXXXXXXXGHQEWGSHRILYGHVMAVDGQRRLDEVLLLLMRAPR
MNME_ERYLH      METIFALSSGAPPAAIGVIRISGTEARGALEALAG--SVPDXXXXXXXXXXDGEGKTLDDALVLWLPGPD
MNME_PROMM      -----------GQGGIAVVRLSGPAAEVVVVSIPGQQLWVSHRVLYGHVMDESGKERIDEVLVLLMKGPR
MNME_METPP      -DPIVAIATAPGRGAVGIVRVSGRGLGALIEAVCGRA-LQPRHAHYGPF-LDAQGEAIDQGLALHFPAPH
MNME_MYCPE      ----------------------GPNTYEIVSKITKKEITKTGYTFVKEF-IYQNDLIIDEVIILKYVAPK
MNME_LEPCP      -EPIAAIATAPGRGAVGIVRVSGRGLTALATALVGRP-LRPRVASYGPF-LDRQGGAIDRGLALHFPAPH
MNME_BORT9      -DDIVALATPLLSSALCVIRSSGISSIEKFSKMFSDPEASGHTIHYGYLIDKEICEKLDEVVVCIYRAPK
MNME_PROVI      -EAIAAIATPVGVGALAIVRMSGRGVLEIADRVFRKKSFKEAEGFSAHFTLSDSRGMVDEVIALVFRAPS
MNME_THET8      -DPICAIATPPGKGAIGVVRLSGEGALEIAARVWRGKDLKGGRFALGEVVDPKTGEAIDQAILLVFRAPR
MNME_SYNSC      -----------GQGGIAVIRLSGPAAEATGRSVVGRQEWGSHRVVYGHVIDSEGRRL-DEVLLLLMRGPR
MNME_THET2      -DPICAIATPLGKGAIGVVRLSGEGALEIAARVWRGKDLKGGRFTLGEVVDPKTGEAIDQALLLVFRAPR
MNME_CYACA      -DTIAAIATCPNGGGVSILRLSGSKSIDVVKLVSSNQCWHSHCILYGWIKDNEDQSFVDEVLILLMMAPR
MNME_CHLTR      -DTITAIATPPGEGSIAIVRVSGPDAISISDRI-----FSGNIAGYASHTVSHNAVCIDQALVLVMRAPR
MNME_CHLTB      -DTITAIATPPGEGSIAIVRVSGPDAISISDRI-----FSGNIAGYASHTVSHNAVCIDQALVLVMRAPR
MNME_CHLT2      -DTITAIATPPGEGSIAIVRVSGPDAISISDRI-----FSGNIAGYASHTVSHNAVCIDQALVLVMRAPR
MNME_CHLCV      -DTIAAIATPPGEGSIAIVRISGPEAIQITKIFSGSPSFASHTAHLGIVNHKDRQ--IDQVLLLIMRAPR
MNME_PROMP      ---------SLGKGGIAVIRVSGEEAINSCKNIVETKSWESHRVFHGFIKDNLENKFIDEILITVMHSPN
MNME_BORGA      -DDIVALATPFLSSALCVIRSSGPKFSKIFSNHSALNSAPGNTIHYGYILDNENNCKVDEVVVCLYRAPK
MNME_CHLTA      -DTITAIATPPGEGSIAIVRVSGPDAISISDRI-----FSGNIAGYASHTVSHNAVYIDQALVLVMRAPR
MNME_BORBZ      -------------------------------------------IHYGYILDSENGCKVDEVVVCLYRAPK
MNME_BORBU      -------------------------------------------IHYGYILDSENGCKVDEVVVCLYRAPK
MNME_MYCS5      ---------------ISIIRISGKNAQSIVSKIFSGKVGENKTITYGFIK--ENSEIVDEVLVSWFLGEN
MNME_PROM2      -------------------RVSGKDSINSCKKIVQTKSWESHRVFHGFIQENKQNKFIDEVLISVMKSPN
MNME_PROM3      -----------GQGGIAVVRLSGPAAEVVVVSIPGQQLWVSHRVLYGHVMDESGKERIDEVLVLLMKGPR
MNME_METPB      -----------------------------------------------------TGNILDQALVAWLPGPA
MNME_BORAP      -------------------------------------------IHYGYILDNENNCKVDEVVVCLYRAPK
MNME_SPHWW      -DTIFALSSGAPPAGVAVVRISGPMAGVAIDRLTGXXXXXXXXXXXXXXTNXXXXXXXXXXXXXXXXXXG
MNME_HALHL      -------------------------------------------------------ETLDHGLVLVFPGPG
MNME_AZOSB      ---------------------------------------------------------IDEGILLYFPAPA
MNME_GLOVI      -DTICAIATAIQQGSVGIVRLSGSEALALAKRLRGKQAFESHRIHYGHF-LDADGGILDECLVLYMQAPR
MNME_ALHEH      --TICALATPPGRGGVAVIRVSGPAVPAIARALAGRLPEPRRAVLARFCDAGG--DTLDEGLMLYFPAPR
MNME_SYNPX      -DTIAAVATAVGQGGIAVVRVSGPAAEATGRSVVGRQVCGSHRVMYGHVIDGEGRRL-DEVLLLLMRGPR
MNME_PROMS      -------------------RVSGKDAINSCKKIVQTKSWESHRVFRGFIQENKQNKFIDEVLILVMKSPN
MNME_XANCP      -------------------RLSGPQSVQIAAAL-GIAGLQSRHARYARFRDAQG-EVIDDGIAVWFPAPH
MNME_XANCB      -------------------RLSGPQSVQIAAAL-GIAGLQSRHARYARFRDAQG-EVIDDGIAVWFPAPH
MNME_XANC8      -------------------RLSGPQSVQIAAAL-GIAGLQSRHARYARFRDAQG-EVIDDGIAVWFPAPH
MNME_PARDP      MDTIFAEATXXXXXXXXXXXXXXXKAHATLESLAGPVA-TPRMAALRALR--DGDDLIDRALVIWFAEGH
MNME_CYAME      -DTIVAIATYLAPSSVAIIRLSGNEAIRLAKSICVKKNHWHSHRIIHTYVQDDQNQLIDEVLVLPMLAPR
MNME_CHLPD      -DPIAAIATPLGVGALAVVRISGATAFDI----AGRVFRKARDPHQPLSETPDGLTLIDEVIALVFRSPS
MNME_PROM0      -------------------RVSGKDAINSCKKIVQTKSWESHRVFRGFIQENKQNKFIDEVLILVMKSPN
MNME_CHLAA      -DTIAAIATPPGEGGIGIIRLSGPDAQSIALRIPGR--LRSHRVRYGHVIGPDG-EVIDEALLTLMAAPH
MNME_THIDA      ---------------------------------------------------------LDEGIALYFAAPH
MNME_SYNFM      ---------------------------------------ESHRLYHGWIKDPVTGQSLDEVLVGTMAAPH
MNME_VEREI      ---------------------------------------------------------IDQGLALYFPGPH
MNME_LAWIP      -------------------------------------DFKPWMLHRGYLVAP-TNEFLDDILAVYMPAPY
MNME_DESDG      -DTIAAVATPLGQGGVGIIRLSGPRSHAILTALPGFSGFRPRVLHHGHIHTPQ-RRILDDVLAVHMPAPR
MNME_UREPA      MSTIVALATAPMNCAIHIIRVSGPKAXXXXXXXXXXXXXXXXXXXWYTI-LKDDNQILDEVLINTFVAPK
MNME_UREP2      MSTIVALATAPMNCAIHIIRVSGPKAXXXXXXXXXXXXXXXXXXXWYTI-LKDDNQILDEVLINTFVAPK
MNME_DESVV      -----------------------PASLEVLRALFRPSSFRPWTLHHGTIT--DGCDPLDDVLAVHMPGPR
MNME_DESVH      -----------------------PASLEVLRALFRPSSFRPWTLHHGTIT--DGCDPLDDVLAVHMPGPR
MNME_SPHAL      -------------------RISGIDAAKALQALAGRLPTPRRASL-ARLTDTDGGAL-DHALILWFPGPA
MNME_ACIAC      -------------------------------------------------------QAIDQGLALYFPAPH
MNME_CHLCH      -EPIVALATPLGVGALAVVRMSGQGVFDIARKVQGAPDFSSKGFQAHFGTIHDAQGVVDEVIALVFRSPR
MNME_NOVAD      -DTIFALSSGQPPAGIGVIRIXXXXXXXXXXXXXXXXXXXXXATL-ATLADPRDGTHLDRTMVLWLPGPA
MNME_CHLAB      -DTIAAIATPPGEGSIAIVRISGPEAIQITKIFSGSPSFSSHTAHLG--TVSYNGQQIDQTLLLIMRAPR
MNME_ROSS1      -DTIAAIATPPGEGGIGIVRISGRDALKILERIPGR--WKPYQMRYGRV-VDQNGAVVDEALAVFMRGPR
MNME_PELLD      ---IAAIATPVGVGALAIVRMSGKGVFGIADRAFRKKSFEAAEGFTAHVTLFDGEGMVDEVVALVFRAPS
MNME_ROSCS      -DTIAAIATPPGEGGIGIVRISGKDALSILERIPGR--WKPYRMRYGHV-VDGAGVRVDEALAVFMRGPR
MNME_TREPS      -DDIVAIATALSPAALGIVRTSGSSSIERVASFFSRAQALTRARAHTFLHILDGKTRVDEVVLLVYRAPH
MNME_TREPA      -DDIVAIATALSPAALGIVRTSGSSSIERVASFFSRAQALTRARAHTFLHILDGKTRVDEVVLLVYRAPH
MNME_XANAC      -------------------RLSGPQSVQIAAHL-GIARMQPRHAHYARFRDGHGA-VIDDGIALWFNAPH
MNME_XANC5      -------------------RLSGAQSVQIAAQL-GIARMQPRHAHYARFRDGQGA-VIDDGIALWFNAPH
MNME_XANOP      -------------------RLSGPQSRQIAVQL-GVARLQPRHAHYARFRDAQGA-VIDDGIALWFNAPH
MNME_XANOR      -------------------RLSGPQSRQIAVQL-GVARLQPRHAHYARFRDAQGA-VIDDGIALWFNAPH
MNME_XANOM      -------------------RLSGPQSRQIAVQL-GVARLQPRHAHYARFRDAQGA-VIDDGIALWFNAPH
MNME_RHOBA      -DTIAAIASPMTPAPRGIVRLSGHDCIDVLCRMSGRRPFRSS----KTLSLGEPLGAIE-VDVMVWPTQR
MNME_MYXXD      -------------------RLSGPEALDVGRLLAPGVPAQPRHAYLASFVDAEGRSL-DEGLFLYFRGPQ
MNME_CARRP      MNTIFSRITPLGNGTLCVIRISGKNVKFLIQKIV-KKNIKEKIATFSKLFLD--KECVDYAMIIFFKKPN
ENGA_CALS8      ----------------------------------------------------------------------
ENGA_CLOPS      ----------------------------------------------------------------------
ENGA_CLOPE      ----------------------------------------------------------------------
ENGA_CLOP1      ----------------------------------------------------------------------
ENGA_TREPS      ----------------------------------------------------------------------
ENGA_TREPA      ----------------------------------------------------------------------
ENGA_THELT      ----------------------------------------------------------------------
ENGA_HERA2      ----------------------------------------------------------------------
ENGA_CLOCE      ----------------------------------------------------------------------
ENGA_EUBR3      ----------------------------------------------------------------------
ENGA_AMOA5      ----------------------------------------------------------------------
ENGA_KOSOT      ----------------------------------------------------------------------
ENGA_DESMR      ----------------------------------------------------------------------
ENGA_CHLSY      ----------------------------------------------------------------------
ENGA_CHLAA      ----------------------------------------------------------------------
ENGA_FUSNN      ----------------------------------------------------------------------
ENGA_DEIRA      ----------------------------------------------------------------------
ENGA_CLOBB      ----------------------------------------------------------------------
ENGA_CLOBA      ----------------------------------------------------------------------
ENGA_DESAD      ----------------------------------------------------------------------
ENGA_BORBU      ----------------------------------------------------------------------
ENGA_STAHJ      ----------------------------------------------------------------------
ENGA_STAAW      ----------------------------------------------------------------------
ENGA_STAAT      ----------------------------------------------------------------------
ENGA_STAAS      ----------------------------------------------------------------------
ENGA_STAAR      ----------------------------------------------------------------------
ENGA_STAAN      ----------------------------------------------------------------------
ENGA_STAAM      ----------------------------------------------------------------------
ENGA_STAAE      ----------------------------------------------------------------------
ENGA_STAAC      ----------------------------------------------------------------------
ENGA_STAA9      ----------------------------------------------------------------------
ENGA_STAA8      ----------------------------------------------------------------------
ENGA_STAA3      ----------------------------------------------------------------------
ENGA_STAA2      ----------------------------------------------------------------------
ENGA_STAA1      ----------------------------------------------------------------------
ENGA_MYCAP      ----------------------------------------------------------------------
ENGA_CLOB8      ----------------------------------------------------------------------
ENGA_CHLPN      ----------------------------------------------------------------------
ENGA_CARHZ      ----------------------------------------------------------------------
ENGA_CYTH3      ----------------------------------------------------------------------
ENGA_CLOK5      ----------------------------------------------------------------------
ENGA_CLOK1      ----------------------------------------------------------------------
ENGA_CLOBH      ----------------------------------------------------------------------
ENGA_CLOB1      ----------------------------------------------------------------------
ENGA_BORAP      ----------------------------------------------------------------------
ENGA_ALKOO      ----------------------------------------------------------------------
ENGA_STAES      ----------------------------------------------------------------------
ENGA_STAEQ      ----------------------------------------------------------------------
ENGA_ALKMQ      ----------------------------------------------------------------------
ENGA_LEPIN      ----------------------------------------------------------------------
ENGA_LEPIC      ----------------------------------------------------------------------
ENGA_EUBE2      ----------------------------------------------------------------------
ENGA_CLOBM      ----------------------------------------------------------------------
ENGA_CLOBL      ----------------------------------------------------------------------
ENGA_CLOBJ      ----------------------------------------------------------------------
ENGA_DESHY      ----------------------------------------------------------------------
ENGA_DESHD      ----------------------------------------------------------------------
ENGA_CLOBK      ----------------------------------------------------------------------
ERA_MYCAP       ----------------------------------------------------------------------
ENGA_THENN      ----------------------------------------------------------------------
ENGA_STACT      ----------------------------------------------------------------------
ENGA_MYCCT      ----------------------------------------------------------------------
ENGA_LEPBL      ----------------------------------------------------------------------
ENGA_LEPBJ      ----------------------------------------------------------------------
ENGA_CHLAB      ----------------------------------------------------------------------
ENGA_HELMI      ----------------------------------------------------------------------
ENGA_FINM2      ----------------------------------------------------------------------
ENGA_CLONN      ----------------------------------------------------------------------
ENGA_THEP1      ----------------------------------------------------------------------
ENGA_THEMA      ----------------------------------------------------------------------
ENGA_STAS1      ----------------------------------------------------------------------
ENGA_DESRM      ----------------------------------------------------------------------
ENGA_MOOTA      ----------------------------------------------------------------------
ENGA_CLOTE      ----------------------------------------------------------------------
ENGA_THESQ      ----------------------------------------------------------------------
ENGA_LISW6      ----------------------------------------------------------------------
ENGA_LISMO      ----------------------------------------------------------------------
ENGA_LISMH      ----------------------------------------------------------------------
ENGA_LISMF      ----------------------------------------------------------------------
ENGA_LISMC      ----------------------------------------------------------------------
ENGA_LISIN      ----------------------------------------------------------------------
ENGA_DEIGD      ----------------------------------------------------------------------
ENGA_CLOTH      ----------------------------------------------------------------------
ENGA_CHRSD      ----------------------------------------------------------------------
ENGA_LAWIP      ----------------------------------------------------------------------
ENGA_DEIDV      ----------------------------------------------------------------------
ENGA_CHLAD      ----------------------------------------------------------------------
ENGA_CLOB6      ----------------------------------------------------------------------
ENGA_CHLCV      ----------------------------------------------------------------------
ENGA_RALME      ----------------------------------------------------------------------
ENGA_RALEJ      ----------------------------------------------------------------------
ENGA_MYXXD      ----------------------------------------------------------------------
ENGA_CUPTR      ----------------------------------------------------------------------
ENGA_BURXL      ----------------------------------------------------------------------
ENGA_BACV8      ----------------------------------------------------------------------
ENGA_BACHK      ----------------------------------------------------------------------
ENGA_BACCZ      ----------------------------------------------------------------------
ENGA_BACCR      ----------------------------------------------------------------------
ENGA_BACCQ      ----------------------------------------------------------------------
ENGA_BACC7      ----------------------------------------------------------------------
ENGA_BACC4      ----------------------------------------------------------------------
ENGA_BACC3      ----------------------------------------------------------------------
ENGA_BACC1      ----------------------------------------------------------------------
ENGA_BACC0      ----------------------------------------------------------------------
ENGA_BACAN      ----------------------------------------------------------------------
ENGA_BACAH      ----------------------------------------------------------------------
ENGA_BACAC      ----------------------------------------------------------------------
ENGA_BACAA      ----------------------------------------------------------------------
ENGA_ANAVT      ----------------------------------------------------------------------
ENGA_RHOBA      ----------------------------------------------------------------------
ENGA_MYCMS      ----------------------------------------------------------------------
ENGA_GEOBB      ----------------------------------------------------------------------
ENGA_FLAJ1      ----------------------------------------------------------------------
ENGA_CHLPB      ----------------------------------------------------------------------
ENGA_BACTN      ----------------------------------------------------------------------
ENGA_BACCN      ----------------------------------------------------------------------
ENGA_ANASP      ----------------------------------------------------------------------
ENGA_PELTS      ----------------------------------------------------------------------
ENGA_BURPP      ----------------------------------------------------------------------
ENGA_SYNR3      ----------------------------------------------------------------------
ENGA_PERMH      ----------------------------------------------------------------------
ENGA_DESOH      ----------------------------------------------------------------------
ENGA_PORGI      ----------------------------------------------------------------------
ENGA_NATTJ      ----------------------------------------------------------------------
ENGA_GEOTN      ----------------------------------------------------------------------
ENGA_CHLFF      ----------------------------------------------------------------------
ENGA_POLSQ      ----------------------------------------------------------------------
ENGA_POLNS      ----------------------------------------------------------------------
ENGA_OCEIH      ----------------------------------------------------------------------
ENGA_GEOSW      ----------------------------------------------------------------------
ENGA_BACWK      ----------------------------------------------------------------------
ENGA_BACC2      ----------------------------------------------------------------------
ENGA_WOLSU      ----------------------------------------------------------------------
ENGA_TRIEI      ----------------------------------------------------------------------
ENGA_GEOSM      ----------------------------------------------------------------------
ENGA_DESAA      ----------------------------------------------------------------------
ENGA_SYNPW      ----------------------------------------------------------------------
ENGA_SYNJA      ----------------------------------------------------------------------
ENGA_SYNFM      ----------------------------------------------------------------------
ENGA_SULDN      ----------------------------------------------------------------------
ENGA_LACJO      ----------------------------------------------------------------------
ENGA_THEYD      ----------------------------------------------------------------------
ENGA_STRZT      ----------------------------------------------------------------------
ENGA_STRZP      ----------------------------------------------------------------------
ENGA_STRZJ      ----------------------------------------------------------------------
ENGA_STRR6      ----------------------------------------------------------------------
ENGA_STRPS      ----------------------------------------------------------------------
ENGA_STRPN      ----------------------------------------------------------------------
ENGA_STRPJ      ----------------------------------------------------------------------
ENGA_STRPI      ----------------------------------------------------------------------
ENGA_STRP7      ----------------------------------------------------------------------
ENGA_STRP4      ----------------------------------------------------------------------
ENGA_STRP2      ----------------------------------------------------------------------
ENGA_PSYWF      ----------------------------------------------------------------------
ENGA_PARD8      ----------------------------------------------------------------------
ENGA_GRAFK      ----------------------------------------------------------------------
ENGA_GEOKA      ----------------------------------------------------------------------
ENGA_NITSB      ----------------------------------------------------------------------
ENGA_LACLS      ----------------------------------------------------------------------
ENGA_LACLM      ----------------------------------------------------------------------
ENGA_FLAPJ      ----------------------------------------------------------------------
ENGA_ENTS8      ----------------------------------------------------------------------
ENGA_CYAA5      ----------------------------------------------------------------------
ENGA_BREBN      ----------------------------------------------------------------------
ENGA_BACP2      ----------------------------------------------------------------------
ENGA_NAUPA      ----------------------------------------------------------------------
ENGA_LACPL      ----------------------------------------------------------------------
ENGA_LACLA      ----------------------------------------------------------------------
ENGA_HELPH      ----------------------------------------------------------------------
ENGA_ENTFA      ----------------------------------------------------------------------
ENGA_CHLP8      ----------------------------------------------------------------------
ENGA_BURVG      ----------------------------------------------------------------------
ENGA_BURS3      ----------------------------------------------------------------------
ENGA_BURM1      ----------------------------------------------------------------------
ENGA_BURCM      ----------------------------------------------------------------------
ENGA_BURCJ      ----------------------------------------------------------------------
ENGA_BURCH      ----------------------------------------------------------------------
ENGA_BURCC      ----------------------------------------------------------------------
ENGA_BURCA      ----------------------------------------------------------------------
ENGA_BURA4      ----------------------------------------------------------------------
ENGA_SYNP2      ----------------------------------------------------------------------
ENGA_STRPZ      ----------------------------------------------------------------------
ENGA_STRPM      ----------------------------------------------------------------------
ENGA_STRPF      ----------------------------------------------------------------------
ENGA_STRPD      ----------------------------------------------------------------------
ENGA_STRPC      ----------------------------------------------------------------------
ENGA_STRPB      ----------------------------------------------------------------------
ENGA_STRP8      ----------------------------------------------------------------------
ENGA_STRP6      ----------------------------------------------------------------------
ENGA_STRP3      ----------------------------------------------------------------------
ENGA_STRP1      ----------------------------------------------------------------------
ENGA_MACCJ      ----------------------------------------------------------------------
ENGA_LACBA      ----------------------------------------------------------------------
ENGA_HELPJ      ----------------------------------------------------------------------
ENGA_BURP8      ----------------------------------------------------------------------
ENGA_BACFR      ----------------------------------------------------------------------
ENGA_BACFN      ----------------------------------------------------------------------
ENGA_AQUAE      ----------------------------------------------------------------------
ENGA_SYNPX      ----------------------------------------------------------------------
ENGA_SYNJB      ----------------------------------------------------------------------
ENGA_RALSO      ----------------------------------------------------------------------
ENGA_PROA2      ----------------------------------------------------------------------
ENGA_HELPG      ----------------------------------------------------------------------
ENGA_HELP2      ----------------------------------------------------------------------
ENGA_DESAH      ----------------------------------------------------------------------
ENGA_CYAP8      ----------------------------------------------------------------------
ENGA_CHLT3      ----------------------------------------------------------------------
ENGA_CAMC5      ----------------------------------------------------------------------
ENGA_BIFLO      ----------------------------------------------------------------------
ENGA_AKKM8      ----------------------------------------------------------------------
ENGA_THEM4      ----------------------------------------------------------------------
ENGA_SYNS9      ----------------------------------------------------------------------
ENGA_SHEDO      ----------------------------------------------------------------------
ENGA_RALPJ      ----------------------------------------------------------------------
ENGA_PSYA2      ----------------------------------------------------------------------
ENGA_JANMA      ----------------------------------------------------------------------
ENGA_CHLTE      ----------------------------------------------------------------------
ENGA_BURPS      ----------------------------------------------------------------------
ENGA_BURP6      ----------------------------------------------------------------------
ENGA_BURP0      ----------------------------------------------------------------------
ENGA_BURM9      ----------------------------------------------------------------------
ENGA_BURM7      ----------------------------------------------------------------------
ENGA_BACLD      ----------------------------------------------------------------------
ENGA_VIBHB      ----------------------------------------------------------------------
ENGA_STRSY      ----------------------------------------------------------------------
ENGA_STRS2      ----------------------------------------------------------------------
ENGA_STRMU      ----------------------------------------------------------------------
ENGA_STRMK      ----------------------------------------------------------------------
ENGA_PSEHT      ----------------------------------------------------------------------
ENGA_PROM4      ----------------------------------------------------------------------
ENGA_MICAN      ----------------------------------------------------------------------
ENGA_HELPS      ----------------------------------------------------------------------
ENGA_DESVV      ----------------------------------------------------------------------
ENGA_DESVH      ----------------------------------------------------------------------
ENGA_DECAR      ----------------------------------------------------------------------
ENGA_CYAP7      ----------------------------------------------------------------------
ENGA_CAMC1      ----------------------------------------------------------------------
ENGA_BORPE      ----------------------------------------------------------------------
ENGA_BORPA      ----------------------------------------------------------------------
ENGA_BORBR      ----------------------------------------------------------------------
ENGA_BACSU      ----------------------------------------------------------------------
ENGA_THEAB      ----------------------------------------------------------------------
ENGA_STRM5      ----------------------------------------------------------------------
ENGA_SHEFN      ----------------------------------------------------------------------
ENGA_PSYCK      ----------------------------------------------------------------------
ENGA_HELPY      ----------------------------------------------------------------------
ENGA_COLP3      ----------------------------------------------------------------------
ENGA_CHLCH      ----------------------------------------------------------------------
ENGA_BORPD      ----------------------------------------------------------------------
ENGA_SYNY3      ----------------------------------------------------------------------
ENGA_SULSY      ----------------------------------------------------------------------
ENGA_STRU0      ----------------------------------------------------------------------
ENGA_MESFL      ----------------------------------------------------------------------
ENGA_LACS1      ----------------------------------------------------------------------
ENGA_BORGA      ----------------------------------------------------------------------
ENGA_BACHD      ----------------------------------------------------------------------
ENGA_BACA2      ----------------------------------------------------------------------
ENGA_SYNP6      ----------------------------------------------------------------------
ENGA_SYNE7      ----------------------------------------------------------------------
ENGA_PELPB      ----------------------------------------------------------------------
ENGA_NITHX      ----------------------------------------------------------------------
ENGA_ACAM1      ----------------------------------------------------------------------
ENGA_THIDA      ----------------------------------------------------------------------
ENGA_STRPG      ----------------------------------------------------------------------
ENGA_SHESR      ----------------------------------------------------------------------
ENGA_SHESM      ----------------------------------------------------------------------
ENGA_SHESA      ----------------------------------------------------------------------
ENGA_SHEON      ----------------------------------------------------------------------
ENGA_PSEA6      ----------------------------------------------------------------------
ENGA_PHOLL      ----------------------------------------------------------------------
ENGA_NITOC      ----------------------------------------------------------------------
ENGA_LEUCK      ----------------------------------------------------------------------
ENGA_HERAR      ----------------------------------------------------------------------
ENGA_HELHP      ----------------------------------------------------------------------
ENGA_GEOUR      ----------------------------------------------------------------------
ENGA_ERWT9      ----------------------------------------------------------------------
ENGA_CAMFF      ----------------------------------------------------------------------
ENGA_THEPX      ----------------------------------------------------------------------
ENGA_THEP3      ----------------------------------------------------------------------
ENGA_STRTD      ----------------------------------------------------------------------
ENGA_SHIF8      ----------------------------------------------------------------------
ENGA_SHIB3      ----------------------------------------------------------------------
ENGA_RHOP5      ----------------------------------------------------------------------
ENGA_PROMA      ----------------------------------------------------------------------
ENGA_PHOPR      ----------------------------------------------------------------------
ENGA_PELPD      ----------------------------------------------------------------------
ENGA_GEOSF      ----------------------------------------------------------------------
ENGA_ESCF3      ----------------------------------------------------------------------
ENGA_ECOSM      ----------------------------------------------------------------------
ENGA_ECOSE      ----------------------------------------------------------------------
ENGA_ECOLU      ----------------------------------------------------------------------
ENGA_ECOLI      ----------------------------------------------------------------------
ENGA_ECOLC      ----------------------------------------------------------------------
ENGA_ECOL6      ----------------------------------------------------------------------
ENGA_ECOL5      ----------------------------------------------------------------------
ENGA_ECOHS      ----------------------------------------------------------------------
ENGA_ECODH      ----------------------------------------------------------------------
ENGA_ECOBW      ----------------------------------------------------------------------
ENGA_ECO8A      ----------------------------------------------------------------------
ENGA_ECO81      ----------------------------------------------------------------------
ENGA_ECO7I      ----------------------------------------------------------------------
ENGA_ECO5E      ----------------------------------------------------------------------
ENGA_ECO57      ----------------------------------------------------------------------
ENGA_ECO55      ----------------------------------------------------------------------
ENGA_ECO45      ----------------------------------------------------------------------
ENGA_ECO27      ----------------------------------------------------------------------
ENGA_ECO24      ----------------------------------------------------------------------
ENGA_CYAP4      ----------------------------------------------------------------------
ENGA_ALISL      ----------------------------------------------------------------------
ENGA_THEEB      ----------------------------------------------------------------------
ENGA_STRGC      ----------------------------------------------------------------------
ENGA_SACD2      ----------------------------------------------------------------------
ENGA_MYCPU      ----------------------------------------------------------------------
ENGA_LACSS      ----------------------------------------------------------------------
ENGA_LACRJ      ----------------------------------------------------------------------
ENGA_LACRD      ----------------------------------------------------------------------
ENGA_LACAC      ----------------------------------------------------------------------
ENGA_KLEP7      ----------------------------------------------------------------------
ENGA_CELJU      ----------------------------------------------------------------------
ENGA_VIBVY      ----------------------------------------------------------------------
ENGA_VIBVU      ----------------------------------------------------------------------
ENGA_VIBFM      ----------------------------------------------------------------------
ENGA_VIBF1      ----------------------------------------------------------------------
ENGA_STRT2      ----------------------------------------------------------------------
ENGA_STRT1      ----------------------------------------------------------------------
ENGA_SHESW      ----------------------------------------------------------------------
ENGA_SHEPC      ----------------------------------------------------------------------
ENGA_SHELP      ----------------------------------------------------------------------
ENGA_SHEB9      ----------------------------------------------------------------------
ENGA_SHEB8      ----------------------------------------------------------------------
ENGA_SHEB5      ----------------------------------------------------------------------
ENGA_SHEB2      ----------------------------------------------------------------------
ENGA_ENT38      ----------------------------------------------------------------------
ENGA_DINSH      ----------------------------------------------------------------------
ERA_FUSNN       ----------------------------------------------------------------------
ENGA_XANC5      ----------------------------------------------------------------------
ENGA_XANAC      ----------------------------------------------------------------------
ENGA_VIBPA      ----------------------------------------------------------------------
ENGA_SILST      ----------------------------------------------------------------------
ENGA_SILPO      ----------------------------------------------------------------------
ENGA_PSEPF      ----------------------------------------------------------------------
ENGA_PSEF5      ----------------------------------------------------------------------
ENGA_LACDB      ----------------------------------------------------------------------
ENGA_LACDA      ----------------------------------------------------------------------
ENGA_LACCB      ----------------------------------------------------------------------
ENGA_LACC3      ----------------------------------------------------------------------
ENGA_HYPNA      ----------------------------------------------------------------------
ENGA_HALOH      ----------------------------------------------------------------------
ENGA_GEOSL      ----------------------------------------------------------------------
ENGA_GEOLS      ----------------------------------------------------------------------
ENGA_DESAP      ----------------------------------------------------------------------
ENGA_BRASB      ----------------------------------------------------------------------
ENGA_XANOM      ----------------------------------------------------------------------
ENGA_XANCP      ----------------------------------------------------------------------
ENGA_XANCB      ----------------------------------------------------------------------
ENGA_XANC8      ----------------------------------------------------------------------
ENGA_THETN      ----------------------------------------------------------------------
ENGA_STRA5      ----------------------------------------------------------------------
ENGA_STRA3      ----------------------------------------------------------------------
ENGA_STRA1      ----------------------------------------------------------------------
ENGA_RHOSK      ----------------------------------------------------------------------
ENGA_RHOS5      ----------------------------------------------------------------------
ENGA_RHOS4      ----------------------------------------------------------------------
ENGA_RHOS1      ----------------------------------------------------------------------
ENGA_PSEU2      ----------------------------------------------------------------------
ENGA_PSESM      ----------------------------------------------------------------------
ENGA_PSE14      ----------------------------------------------------------------------
ENGA_MAGSA      ----------------------------------------------------------------------
ENGA_LACH4      ----------------------------------------------------------------------
ENGA_HELAH      ----------------------------------------------------------------------
ENGA_HAMD5      ----------------------------------------------------------------------
ENGA_CITK8      ----------------------------------------------------------------------
ENGA_ACTP7      ----------------------------------------------------------------------
ENGA_ACTP2      ----------------------------------------------------------------------
ENGA_XYLFM      ----------------------------------------------------------------------
ENGA_TOLAT      ----------------------------------------------------------------------
ENGA_STRSV      ----------------------------------------------------------------------
ENGA_SHEWM      ----------------------------------------------------------------------
ENGA_PELLD      ----------------------------------------------------------------------
ENGA_NOSP7      ----------------------------------------------------------------------
ENGA_MYCPN      ----------------------------------------------------------------------
ENGA_MYCPE      ----------------------------------------------------------------------
ENGA_MYCGE      ----------------------------------------------------------------------
ENGA_HAEPS      ----------------------------------------------------------------------
ENGA_EDWI9      ----------------------------------------------------------------------
ENGA_ALTMD      ----------------------------------------------------------------------
ENGA_ACTPJ      ----------------------------------------------------------------------
ENGA_SHEPA      ----------------------------------------------------------------------
ENGA_SHEHH      ----------------------------------------------------------------------
ENGA_SHEAM      ----------------------------------------------------------------------
ENGA_PSEPK      ----------------------------------------------------------------------
ENGA_PSEPG      ----------------------------------------------------------------------
ENGA_PSEE4      ----------------------------------------------------------------------
ENGA_PSEAE      ----------------------------------------------------------------------
ENGA_PSEA8      ----------------------------------------------------------------------
ENGA_PSEA7      ----------------------------------------------------------------------
ENGA_PROVI      ----------------------------------------------------------------------
ENGA_BRASO      ----------------------------------------------------------------------
ENGA_BARHE      ----------------------------------------------------------------------
ENGA_SHEPW      ----------------------------------------------------------------------
ENGA_SALTY      ----------------------------------------------------------------------
ENGA_SALTI      ----------------------------------------------------------------------
ENGA_SALPK      ----------------------------------------------------------------------
ENGA_SALPC      ----------------------------------------------------------------------
ENGA_SALPB      ----------------------------------------------------------------------
ENGA_SALPA      ----------------------------------------------------------------------
ENGA_SALNS      ----------------------------------------------------------------------
ENGA_SALG2      ----------------------------------------------------------------------
ENGA_SALEP      ----------------------------------------------------------------------
ENGA_SALCH      ----------------------------------------------------------------------
ENGA_PSEU5      ----------------------------------------------------------------------
ENGA_PSEP1      ----------------------------------------------------------------------
ENGA_PSEAB      ----------------------------------------------------------------------
ENGA_PROMH      ----------------------------------------------------------------------
ENGA_IDILO      ----------------------------------------------------------------------
ENGA_HAEIN      ----------------------------------------------------------------------
ENGA_ALHEH      ----------------------------------------------------------------------
ENGA_THERP      ----------------------------------------------------------------------
ENGA_SYMTH      ----------------------------------------------------------------------
ENGA_STRAW      ----------------------------------------------------------------------
ENGA_PSEMY      ----------------------------------------------------------------------
ENGA_PARUW      ----------------------------------------------------------------------
ENGA_MARAV      ----------------------------------------------------------------------
ENGA_HAEDU      ----------------------------------------------------------------------
ENGA_CAMLR      ----------------------------------------------------------------------
ENGA_BART1      ----------------------------------------------------------------------
ENGA_AZOVD      ----------------------------------------------------------------------
ENGA_VARPS      ----------------------------------------------------------------------
ENGA_SHESH      ----------------------------------------------------------------------
ENGA_CHRVO      ----------------------------------------------------------------------
ENGA_CHLPD      ----------------------------------------------------------------------
ENGA_CHLMU      ----------------------------------------------------------------------
ENGA_CAMHC      ----------------------------------------------------------------------
ENGA_AZOSB      ----------------------------------------------------------------------
ENGA_AZOC5      ----------------------------------------------------------------------
ENGA_ACIBY      ----------------------------------------------------------------------
ENGA_ACIBT      ----------------------------------------------------------------------
ENGA_ACIBS      ----------------------------------------------------------------------
ENGA_ACIBC      ----------------------------------------------------------------------
ENGA_ACIB5      ----------------------------------------------------------------------
ENGA_ACIB3      ----------------------------------------------------------------------
ENGA_ACIAC      ----------------------------------------------------------------------
ENGA_STRCO      ----------------------------------------------------------------------
ENGA_JANSC      ----------------------------------------------------------------------
ENGA_GEMAT      ----------------------------------------------------------------------
ENGA_BRAJA      ----------------------------------------------------------------------
ENGA_BARQU      ----------------------------------------------------------------------
ERA_BACSU       ----------------------------------------------------------------------