[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL03749.1

[Show Plain Result]


## Summary of Sequence Search
    1::1181
    1::1181      0.0 100% 1181 aa  DPO3A_RICCN RecName: Full=DNA polymerase III subunit alpha;       
    1::1207      0.0  93% 1207 aa  DPO3A_RICFE RecName: Full=DNA polymerase III subunit alpha;       
    1::1178      0.0  89% 1180 aa  DPO3A_RICTY RecName: Full=DNA polymerase III subunit alpha;       
    1::1180      0.0  87% 1182 aa  DPO3A_RICPR RecName: Full=DNA polymerase III subunit alpha;       
    1::1169      0.0  83% 1172 aa  DPO3A_RICBR RecName: Full=DNA polymerase III subunit alpha;       
    9::1067      0.0  43% 1143 aa  DPO3A_CAUCR RecName: Full=DNA polymerase III subunit alpha;       
    9::1067      0.0  43% 1143 aa  DPO3A_CAUCN RecName: Full=DNA polymerase III subunit alpha;       
    4::1039      0.0  40% 1147 aa  DPO3A_BORBU RecName: Full=DNA polymerase III subunit alpha;       
    4::1125      0.0  37% 1160 aa  DPO3A_ECO57 RecName: Full=DNA polymerase III subunit alpha;       
    4::1125      0.0  37% 1160 aa  DPO3A_ECOLI RecName: Full=DNA polymerase III subunit alpha;       
    4::1125      0.0  38% 1160 aa  DPO3A_ECOL6 RecName: Full=DNA polymerase III subunit alpha;       
    1::1119    e-180  39% 1173 aa  DPO3A_PSEFL RecName: Full=DNA polymerase III subunit alpha;       
    4::1120    e-179  36% 1159 aa  DPO3A_HAEIN RecName: Full=DNA polymerase III subunit alpha;       
    3::986     e-179  41% 1170 aa  DPO3A_TREPA RecName: Full=DNA polymerase III subunit alpha;       
    4::1075    e-178  38% 1159 aa  DPO3A_VIBCH RecName: Full=DNA polymerase III subunit alpha;       
    4::1125    e-177  36% 1160 aa  DPO3A_SALTY RecName: Full=DNA polymerase III subunit alpha;       
    4::1068    e-177  38% 1161 aa  DPO3A_BUCAI RecName: Full=DNA polymerase III subunit alpha;       
    1::1090    e-175  38% 1173 aa  DPO3A_PSEAE RecName: Full=DNA polymerase III subunit alpha;       
    4::1074    e-173  37% 1159 aa  DPO3A_PASMU RecName: Full=DNA polymerase III subunit alpha;       
    4::1089    e-172  37% 1144 aa  DPO3A_NEIMB RecName: Full=DNA polymerase III subunit alpha;       
    3::1054    e-171  38% 1200 aa  DPO3A_CAMJE RecName: Full=DNA polymerase III subunit alpha;       
    6::1082    e-171  39% 1220 aa  DPO3A_THEAQ RecName: Full=DNA polymerase III subunit alpha;       
    4::1089    e-171  36% 1144 aa  DPO3A_NEIMA RecName: Full=DNA polymerase III subunit alpha;       
    5::1052    e-170  38% 1161 aa  DPO3A_BUCAP RecName: Full=DNA polymerase III subunit alpha;       
    6::1091    e-170  39% 1193 aa  DPO3A_XYLFT RecName: Full=DNA polymerase III subunit alpha;       
    7::1162    e-169  37% 1211 aa  DPO3A_HELPY RecName: Full=DNA polymerase III subunit alpha;       
    7::1162    e-168  36% 1211 aa  DPO3A_HELPJ RecName: Full=DNA polymerase III subunit alpha;       
    6::1084    e-167  38% 1193 aa  DPO3A_XYLFA RecName: Full=DNA polymerase III subunit alpha;       
    5::1062    e-167  37% 1077 aa  DPO3A_BUCBP RecName: Full=DNA polymerase III subunit alpha;       
    3::994     e-163  37% 1115 aa  DPO3A_BACSU RecName: Full=DNA polymerase III subunit alpha;       
    2::986     e-161  38% 1116 aa  DPO3A_BACHD RecName: Full=DNA polymerase III subunit alpha;       
    1::1143    e-161  36% 1161 aa  DPO3A_AQUAE RecName: Full=DNA polymerase III subunit alpha;       
    3::1087    e-155  38% 1237 aa  DPO3A_CHLTR RecName: Full=DNA polymerase III subunit alpha;       
    3::1072    e-155  37% 1240 aa  DPO3A_CHLPN RecName: Full=DNA polymerase III subunit alpha;       
    3::1087    e-151  37% 1237 aa  DPO3A_CHLMU RecName: Full=DNA polymerase III subunit alpha;       
    3::1037    e-150  36% 1179 aa  DPO3A_STRCO RecName: Full=DNA polymerase III subunit alpha;       
   23::302     e-146  40% 1335 aa  DPO3A_DEIRA RecName: Full=DNA polymerase III subunit alpha;       
   10::1099    e-137  35% 1184 aa  DPO3A_MYCTU RecName: Full=DNA polymerase III subunit alpha;       
   10::1099    e-137  35% 1184 aa  DPO3A_MYCBO RecName: Full=DNA polymerase III subunit alpha;       
    4::966     e-131  35% 1065 aa  DPO3A_STAAW RecName: Full=DNA polymerase III subunit alpha;       
    4::966     e-131  35% 1065 aa  DPO3A_STAAS RecName: Full=DNA polymerase III subunit alpha;       
    4::966     e-131  36% 1065 aa  DPO3A_STAAR RecName: Full=DNA polymerase III subunit alpha;       
    4::966     e-131  36% 1065 aa  DPO3A_STAA8 RecName: Full=DNA polymerase III subunit alpha;       
    4::966     e-130  35% 1065 aa  DPO3A_STAAC RecName: Full=DNA polymerase III subunit alpha;       
    3::1175    e-130  38% 1355 aa  DPO3A_SYNY3 RecName: Full=DNA polymerase III subunit alpha;        
    4::1053    e-129  35% 1065 aa  DPO3A_STAES RecName: Full=DNA polymerase III subunit alpha;       
    4::966     e-129  35% 1065 aa  DPO3A_STAAN RecName: Full=DNA polymerase III subunit alpha;       
    4::966     e-129  35% 1065 aa  DPO3A_STAAM RecName: Full=DNA polymerase III subunit alpha;       
    4::1053    e-129  35% 1065 aa  DPO3A_STAEQ RecName: Full=DNA polymerase III subunit alpha;       
    6::1034    e-128  33% 1177 aa  DPO3A_MYCLE RecName: Full=DNA polymerase III subunit alpha;       
    2::871     e-104  35% 1036 aa  DPO3A_STRP8 RecName: Full=DNA polymerase III subunit alpha;       
    2::871     e-104  35% 1036 aa  DPO3A_STRP6 RecName: Full=DNA polymerase III subunit alpha;       
    2::871     e-103  35% 1036 aa  DPO3A_STRP3 RecName: Full=DNA polymerase III subunit alpha;       
    2::871     e-103  34% 1036 aa  DPO3A_STRP1 RecName: Full=DNA polymerase III subunit alpha;       
    2::869     e-101  34% 1034 aa  DPO3A_STRPY RecName: Full=DNA polymerase III subunit alpha;       
    2::952     7e-99  32% 1060 aa  DPO3A_LACLA RecName: Full=DNA polymerase III subunit alpha;       
    2::755     1e-95  33%  874 aa  DPO3A_MYCGE RecName: Full=DNA polymerase III subunit alpha;        
    2::109     7e-94  39%  969 aa  DPO3A_UREPA RecName: Full=DNA polymerase III subunit alpha;        
    3::796     9e-89  30% 1097 aa  DNAE2_AGRVS RecName: Full=Error-prone DNA polymerase;       
  105::1092    8e-88  27% 1145 aa  DNAE2_RHOBA RecName: Full=Error-prone DNA polymerase;       
    2::93      5e-86  36%  872 aa  DPO3A_MYCPN RecName: Full=DNA polymerase III subunit alpha;        
    3::778     2e-85  29% 1087 aa  DNE23_AGRT5 RecName: Full=Error-prone DNA polymerase 3;       
    3::747     3e-85  31% 1085 aa  DNE22_AGRT5 RecName: Full=Error-prone DNA polymerase 2;       
    3::805     6e-85  30% 1087 aa  DNE22_RHIME RecName: Full=Error-prone DNA polymerase 2;       
    3::809     1e-83  30% 1085 aa  DNAE2_SYMTH RecName: Full=Error-prone DNA polymerase;       
   48::845     7e-81  31% 1134 aa  DNAE2_PROAC RecName: Full=Error-prone DNA polymerase;       
   65::868     9e-78  28% 1098 aa  DNAE2_MYCTU RecName: Full=Error-prone DNA polymerase;       
   58::861     9e-78  28% 1091 aa  DNAE2_MYCBO RecName: Full=Error-prone DNA polymerase;       
    7::1048    6e-77  28% 1116 aa  DNE21_RHIME RecName: Full=Error-prone DNA polymerase 1;       
    4::782     7e-76  29% 1091 aa  DNE21_AGRT5 RecName: Full=Error-prone DNA polymerase 1;       
   58::1088    3e-75  28% 1093 aa  DNAE2_MYCPA RecName: Full=Error-prone DNA polymerase;       
    7::1048    6e-75  28% 1116 aa  DNAE2_SINMW RecName: Full=Error-prone DNA polymerase;       
   16::792     1e-74  28% 1039 aa  DNAE2_IDILO RecName: Full=Error-prone DNA polymerase;       
    4::784     4e-74  29% 1027 aa  DNAE2_DECAR RecName: Full=Error-prone DNA polymerase;       
    5::1043    5e-74  27% 1117 aa  DNAE2_RHISN RecName: Full=Error-prone DNA polymerase;       
   25::949     2e-73  27% 1061 aa  DNAE2_BDEBA RecName: Full=Error-prone DNA polymerase;       
    4::777     9e-73  27% 1034 aa  DNAE2_PSEF5 RecName: Full=Error-prone DNA polymerase;       
    4::884     3e-72  33% 1174 aa  DPO3A_YERPE RecName: Full=DNA polymerase III subunit alpha;        
    3::777     6e-72  29% 1033 aa  DNAE2_TERTT RecName: Full=Error-prone DNA polymerase;       
  189::804     6e-72  34% 1170 aa  DNAE2_BRASO RecName: Full=Error-prone DNA polymerase;       
    2::822     8e-72  28% 1029 aa  DNAE2_SACD2 RecName: Full=Error-prone DNA polymerase;       
    1::778     5e-71  29% 1025 aa  DNAE2_PSEPF RecName: Full=Error-prone DNA polymerase;       
  213::817     6e-71  30% 1101 aa  DNAE2_SILPO RecName: Full=Error-prone DNA polymerase;       
    4::802     6e-71  30% 1077 aa  DNAE2_BRUSU RecName: Full=Error-prone DNA polymerase;       
    4::802     1e-70  30% 1077 aa  DNAE2_BRUME RecName: Full=Error-prone DNA polymerase;       
    4::802     1e-70  30% 1077 aa  DNAE2_BRUAB RecName: Full=Error-prone DNA polymerase;       
    1::781     2e-70  29% 1031 aa  DNAE2_PSE14 RecName: Full=Error-prone DNA polymerase;       
    1::781     1e-67  28% 1031 aa  DNAE2_PSEU2 RecName: Full=Error-prone DNA polymerase;       
   60::817     3e-67  29% 1055 aa  DNAE2_CORGL RecName: Full=Error-prone DNA polymerase;       
   15::1053    1e-66  26% 1118 aa  DNAE2_RHILO RecName: Full=Error-prone DNA polymerase;       
    4::795     2e-66  28% 1083 aa  DNAE2_CAUCR RecName: Full=Error-prone DNA polymerase;       
    4::795     2e-66  28% 1083 aa  DNAE2_CAUCN RecName: Full=Error-prone DNA polymerase;       
    4::1054    3e-66  27% 1110 aa  DNAE2_RHOPS RecName: Full=Error-prone DNA polymerase;       
  231::1098    3e-66  28% 1165 aa  DNAE2_RHOP2 RecName: Full=Error-prone DNA polymerase;       
   96::884     1e-65  29% 1153 aa  DNAE2_CORJK RecName: Full=Error-prone DNA polymerase;       
    3::779     1e-65  28% 1024 aa  DNAE2_VIBPA RecName: Full=Error-prone DNA polymerase;       
   53::164     2e-65  33% 1039 aa  DNAE2_CORDI RecName: Full=Error-prone DNA polymerase;       
    4::779     2e-65  30% 1025 aa  DNAE2_ALHEH RecName: Full=Error-prone DNA polymerase;       
  306::777     2e-65  35% 1033 aa  DNAE2_PSEPK RecName: Full=Error-prone DNA polymerase;       
    1::780     4e-65  28% 1031 aa  DNAE2_PSESM RecName: Full=Error-prone DNA polymerase;       
   77::834     4e-65  29% 1073 aa  DNAE2_COREF RecName: Full=Error-prone DNA polymerase;       
  226::1093    5e-65  29% 1153 aa  DNAE2_RHOP5 RecName: Full=Error-prone DNA polymerase;       
  173::783     5e-65  30% 1047 aa  DNAE2_METCA RecName: Full=Error-prone DNA polymerase;       
    5::277     7e-65  30% 1132 aa  DNAE2_ANADE RecName: Full=Error-prone DNA polymerase;       
  255::870     9e-65  31% 1195 aa  DNAE2_RHOPA RecName: Full=Error-prone DNA polymerase;       
  189::794     9e-65  31% 1151 aa  DNAE2_BRAJA RecName: Full=Error-prone DNA polymerase;       
   62::895     2e-64  27% 1146 aa  DNAE2_NOCFA RecName: Full=Error-prone DNA polymerase;       
    5::277     2e-64  31% 1142 aa  DNAE2_ANAD2 RecName: Full=Error-prone DNA polymerase;       
    3::783     4e-64  29% 1032 aa  DNAE2_HAHCH RecName: Full=Error-prone DNA polymerase;       
    5::266     6e-64  30% 1133 aa  DNAE2_ANASK RecName: Full=Error-prone DNA polymerase;       
  292::767     8e-64  33% 1024 aa  DNAE2_PSEA7 RecName: Full=Error-prone DNA polymerase;       
   11::774     1e-63  29% 1031 aa  DNAE2_PSEAE RecName: Full=Error-prone DNA polymerase;       
    9::113     3e-63  33% 1072 aa  DNAE2_BURPS RecName: Full=Error-prone DNA polymerase;       
    9::113     3e-63  33% 1063 aa  DNAE2_BURMA RecName: Full=Error-prone DNA polymerase;       
    3::779     8e-63  27% 1024 aa  DNAE2_VIBVU RecName: Full=Error-prone DNA polymerase;       
  154::710     2e-62  38%  842 aa  DPO3A_THEMA RecName: Full=DNA polymerase III subunit alpha;        
    3::779     9e-62  27% 1024 aa  DNAE2_VIBVY RecName: Full=Error-prone DNA polymerase;       
    3::779     1e-61  27% 1024 aa  DNAE2_VIBHB RecName: Full=Error-prone DNA polymerase;       
   12::822     8e-61  28% 1075 aa  DNAE2_RALSO RecName: Full=Error-prone DNA polymerase;       
  114::643     2e-58  30%  901 aa  DNAE2_GLUOX RecName: Full=Error-prone DNA polymerase;       
  316::846     9e-57  31% 1070 aa  DNAE2_AZOSE RecName: Full=Error-prone DNA polymerase;       
  332::809     2e-56  32% 1082 aa  DNAE2_XANCP RecName: Full=Error-prone DNA polymerase;       
  332::809     2e-56  32% 1082 aa  DNAE2_XANC8 RecName: Full=Error-prone DNA polymerase;       
   46::810     2e-56  27% 1083 aa  DNAE2_XANAC RecName: Full=Error-prone DNA polymerase;       
   11::821     3e-56  27% 1079 aa  DNAE2_RALPJ RecName: Full=Error-prone DNA polymerase;       
  332::809     2e-55  32% 1082 aa  DNAE2_XANCB RecName: Full=Error-prone DNA polymerase;       
  345::810     2e-54  32% 1083 aa  DNAE2_XANOR RecName: Full=Error-prone DNA polymerase;       
  345::810     2e-54  32% 1083 aa  DNAE2_XANOP RecName: Full=Error-prone DNA polymerase;       
    6::795     2e-53  26% 1052 aa  DNAE2_BORPA RecName: Full=Error-prone DNA polymerase;       
  329::812     2e-53  31% 1064 aa  DNAE2_AZOSB RecName: Full=Error-prone DNA polymerase;       
  285::789     8e-53  29% 1026 aa  DNAE2_PSEMY RecName: Full=Error-prone DNA polymerase;       
  357::809     1e-52  33% 1082 aa  DNAE2_XANC5 RecName: Full=Error-prone DNA polymerase;       
    6::795     2e-52  26% 1052 aa  DNAE2_BORBR RecName: Full=Error-prone DNA polymerase;       
   88::1045    8e-39  27% 1305 aa  YORL_BACSU RecName: Full=Probable DNA polymerase yorL;       
  616::1310    2e-11  24% 1442 aa  DPO3_STAES RecName: Full=DNA polymerase III polC-type;       
  612::1306    2e-11  24% 1438 aa  DPO3_STAEQ RecName: Full=DNA polymerase III polC-type;       
  619::1326    8e-08  29% 1444 aa  DPO3_LACS1 RecName: Full=DNA polymerase III polC-type;       
  614::1004    1e-07  25% 1437 aa  DPO3_PEDPA RecName: Full=DNA polymerase III polC-type;       
  610::1175    2e-07  27% 1435 aa  DPO3_BACCR RecName: Full=DNA polymerase III polC-type;       
  621::897     7e-07  26% 1464 aa  DPO3_STRT1 RecName: Full=DNA polymerase III polC-type;       
  621::897     2e-06  26% 1464 aa  DPO3_STRTD RecName: Full=DNA polymerase III polC-type;       
  621::897     4e-06  25% 1464 aa  DPO3_STRT2 RecName: Full=DNA polymerase III polC-type;       
  619::1010    9e-06  26% 1443 aa  DPO3_LACRD RecName: Full=DNA polymerase III polC-type;       
 1273::1440    2e-04  25% 1451 aa  DPO3_MYCGE RecName: Full=DNA polymerase III polC-type;       
 1265::1442    3e-04  23% 1443 aa  DPO3_MYCPN RecName: Full=DNA polymerase III polC-type;       
  616::876     4e-04  27% 1437 aa  DPO3_BACSU RecName: Full=DNA polymerase III polC-type;       
  624::827     7e-04  25% 1465 aa  DPO3_STRMU RecName: Full=DNA polymerase III polC-type;       
  124::237     9e-04  26%  307 aa  PPAC_METJA RecName: Full=Manganese-dependent inorganic
    1::1181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKGLQPIHGVILN
DPO3A_RICCN     MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKGLQPIHGVILN
DPO3A_RICFE     MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALYAVKKGLQPIHGVILN
DPO3A_RICTY     MQSEFIHLRTQSSYSFLESALTIEKVVELALLHKMPALCLSDRGNLFGSLEFALYAVKKKLQPIHGVILN
DPO3A_RICPR     MQPEFIHLRTQSSYSFLESALTIEKVVELALLHKMPALCLSDRGNLFGSLEFSLYAVKKKLQPIHGVILN
DPO3A_RICBR     MQTEFIHLRTQSSYSFLASALTTEKIVELASSYKMAAICLTDKENLFGSLEFALYAIKKGLQPIHGVILN
DPO3A_CAUCR     ----FVHLRVRSAYSLLEGAIKADQIGKLAAEAKMPAAGLADRANLFGALEYSSYAKDAGVQPIIGCAIP
DPO3A_CAUCN     ----FVHLRVRSAYSLLEGAIKADQIGKLAAEAKMPAAGLADRANLFGALEYSSYAKDAGVQPIIGCAIP
DPO3A_BORBU     -RSRFIHLHVHSDYSLLDGXXXXXXXXXXXXXCNMSHIALTDHGNLFGAIKFYXXXXXXXXXXXXXXFLK
DPO3A_ECO57     --PRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFTNLCGLVKFYGAGHGAGIKPIVGADFN
DPO3A_ECOLI     --PRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFTNLCGLVKFYGAGHGAGIKPIVGADFN
DPO3A_ECOL6     --PRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFTNLCGLVKFYGAGHGAGIKPIVGADFN
DPO3A_PSEFL     MPASFVHLRLHTEYSLVDGLVRIKPLVKALTGMGMPAVAVTDQNNMCSLVKFYKNAMGAGIKPICGLWLS
DPO3A_HAEIN     -QPRFIHLRTHTDFSMIDSIVKVKPLVKACAANEMVAMGLTDFTNFCGVVSFYSEMLSSGMKPIIGADVK
DPO3A_TREPA     -RMSFVHLHVHSNYSLLDGASSLQRLVRTAKSLGQEALALTDHGNMFGALHFQKVCSAEGIKAIIGCELY
DPO3A_VIBCH     --PKFIHLRIHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHNCGVKPIIGADFT
DPO3A_SALTY     --PRFVHLRVHSDYSMIDGLAKTGPLVKKAASLGMPALAITDFTNLCGLVKFYGAGHGAGIKPIVGADFN
DPO3A_BUCAI     --PKFIHLHVHSDYSMIDGLSKPEDLVKKAASLNMPAIAITDYNNLYGVIKFYNMAHKLGLKPIIGITVN
DPO3A_PSEAE     MTVSFVHLRLHTEFSLVDGLVRVKPLAKAVAGLGMPAVAVTDQSNMCSLVKFYKTAMGAGIKPICGIWLA
DPO3A_PASMU     --PRFVHLRVHSDFSMINGIAKVKPLIKACVDNHMVAMGLTDFTNFCGLVRFYGEALSAGVKPIIGADVL
DPO3A_NEIMB     --PTYIPLRLHTEFSITDGMVRIKKLIAKAQEYGLPALGISDLMNEFGLVKFYKACRSAGIKPIGAADVR
DPO3A_CAMJE     ---QFTHLHLHTEYSLLDGANKLKELALTLKEQGATSVAMTDHGNMFGAIDFYQTMKAQGLKPIIGIYLH
DPO3A_THEAQ     ---KFAHLHQHTQFSLLDGAAKLQDLLKWVKETEDPALAMTDHGNLFGAVEFYKKATAMGVKPIIGVAAE
DPO3A_NEIMA     --PTYIPLRLHTEFSITDGMVRIKKLIAKAQEYGLPALGISDLMNEFGLVKFYKACRSAGIKPIGAADVR
DPO3A_BUCAP     ---EFVHLHVHSDYSIVDGLSKPEDLIKKSVNLGMKALSITDFNNLYGAIKFYNAAHKWGLKPIIGVTVK
DPO3A_XYLFT     ----FVHLHIHTEFSLADSTIRVPEKPEQAHPKKLPALAVTDLNNLFALIKFYKAAETVGIKPISGADLL
DPO3A_HELPY     ----FTHLHLHTEYSLLDGANKIKILAKRVKELGMKSVSVTDHGNMFGAIDFYTSMKKEGIKPIIGMEAY
DPO3A_HELPJ     ----FTHLHLHTEYSLLDGANKIKILAKRIKELGMKSVSVTDHGNMFGAIDFYTSMKKEGIKPIIGMEAY
DPO3A_XYLFA     ----FVHLHIHTEFSLADSTIRVPEKPEQAHPKKLPALAVTDLNNLFALIKFYKAAETVGIKPISGADLL
DPO3A_BUCBP     ---KFVHLRVHSDFSMIDGLVKPNILAQHAKKLNMPAIAITDSSNLHGMIKFYRATFSQGIKPIIGVDFK
DPO3A_BACSU     ----FVHLQVHSGYSLLNXXXXXXXXXXXXDRLGYASLALTDDHVMYGAIQFYKACKARGINPIIGLTAS
DPO3A_BACHD     ---ESVHIHVHSEYTLLSSMCRIPALVEKAKAAQFSALALTDRHVMYGAVPFYKACKESGLKPIIGMETT
DPO3A_AQUAE     MSKDFVHLHLHTQFSLLDGAIKIDELVKKAKEYGYKAVGMSDHGNLFGSYKFYKALKAEGIKPIIGMEIT
DPO3A_CHLTR     ----WIPLHCHSQYSILDATCSIKKFVAKAVEYQIPALALTDHGNLFGAVEFYKTCKQNAIKPIIGCELY
DPO3A_CHLPN     ----WIPLHCHSQYSVLDAMSSIKDFVAKGQEFGIPALALTDHGNLYGAVDFYKECTQKGIQPIIGCECY
DPO3A_CHLMU     ----WIPLHCHSQYSILDATCSIKKFVAKAVEYHIPALALTDHGNLFGAVDFYKTCKQNAIKPIIGCELY
DPO3A_STRCO     -KPPFTHLHVHTQYSLLDGAARLKDMFDACNEMGMSHIAMSDHGNLHGAYDFFHSAKKAGVTPIIGIEAY
DPO3A_DEIRA     ---KFAHLHQHTQYSXXXXXXXXXXXXEVTPEGQTPALAMTDHGNMHGAVHFYNYAMGMEVKPIIGYEAY
DPO3A_MYCTU     ----FVHLHNHTEYSMLDGAAKITPMLAEVERLGMPAVGMTDHGNMFGASEFYNSATKAGIKPIIGVEAY
DPO3A_MYCBO     ----FVHLHNHTEYSMLDGAAKITPMLAEVERLGMPAVGMTDHGNMFGASEFYNSATKAGIKPIIGVEAY
DPO3A_STAAW     ------YLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKPIFGMTIY
DPO3A_STAAS     ------YLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKPIFGMTIY
DPO3A_STAAR     ------YLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDTCIANNIKPIFGMTIY
DPO3A_STAA8     ------YLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKPIFGMTIY
DPO3A_STAAC     ------YLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKPIFGMTIY
DPO3A_SYNY3     ----FVGLHIHSDYSLLDGASQLPALIDRAIELGMPAIALTDHGVMYGAVELLKVCRGKPIKPIIGEMYV
DPO3A_STAES     ------HLNIHTSFDLLDSSLRIDALIDKAKKEGYRALAITDTNVLYGYPKFYDACIAAHIHPIFGMTIY
DPO3A_STAAN     ------YLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKPIFGMTIY
DPO3A_STAAM     ------YLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKPIFGMTIY
DPO3A_STAEQ     ------HLNIHTSFDLLDSSLRIDALIDKAKKEGYRALAITDTNVLYGYPKFYDACIAAHIHPIFGMTIY
DPO3A_MYCLE     ----FVHLHNHTEYSMLDGAAKITPMFAEVERLQMPAVGMTDHGNMFGASEFYNTAIKAGIKPIIGVEAY
DPO3A_STRP8     ----FAQLDTKTVYSFMDSLIDLNHYFERAKQFGYHTIGIMDKDNLYGAYHFIKGCQKNGLQPVLGLEVE
DPO3A_STRP6     ----FAQLDTKTVYSFMDSLIDLNHYFERAKQFGYHTIGIMDKDNLYGAYHFIKGCQKNGLQPVLGLEVE
DPO3A_STRP3     ----FAQLDTKTVYSFMDSLIDLNHYFERAKQFGYHTIGIMDKDNLYGAYHFIKGCQKNGLQPVLGLEVE
DPO3A_STRP1     ----FAQLDTKTVYSFMDSLIDLNHYFERAKQFGYHTIGIMDKDNLYGAYHFIKGCQKNGLQPVLGLEIE
DPO3A_STRPY     ----FAQLDTKTVYSFMDSLIDLNHYFERAKQFGYHTIGIMDKDNLYGAYHFIKGCQKNGLQPVLGLEIE
DPO3A_LACLA     ----FAPLNTKTEYSFLDSVVKVDDYLETAHRLGYQTVGICDVGNLHAAFRFVRKAQKFNLQPIISIELN
DPO3A_MYCGE     ----FVNLHTNSYYNFLNSALSPKKLVNLAINDQQKAVAITDP-NLFGAVEFFITCKQNNIKPIIGLNLT
DPO3A_UREPA     ----FINLNVHSHYSLLNSTLSIDDLIKYALDNKQPYVCLTDLNNMYGCIEFYDKAKAHNLTPIIG--LE
DNAE2_AGRVS     ----YAELQVTTHFSFLRGASSAIELFETAKSLGIDAIGVVDRNSLAGIVRALEASRATGVR----LVVG
DNAE2_RHOBA     ----YVELHCRSNFSFLDGASHPDELVQRAAELGYEGLAITDRESIAGVVRGFSPAQELGLQYIVGTEV-
DPO3A_MYCPN     ----FVNLHTNSYYNFLNSTLSPXXXXXXXXXXXXXXXCLTDP-NLFGATEFFLACQKAHIKPLIGLSVT
DNE23_AGRT5     ----YAELQVTTHFSFLRGASSAQELFETAKALGIEALGVVDRNSLAGIVRALEASRATGLR----LVIG
DNE22_AGRT5     ----YAELQVTTHFSFLRGASSAQELFETAKALGIQAIGVVDRNSLAGIVR----ALEASRATDIRLVVG
DNE22_RHIME     ----YAELQVTTHFSFLRAASSAEELFATARLMGIEALGVVDRNSLAGIVRALEASRATGLR----LVVG
DNAE2_SYMTH     ----FVHLHVHSPFSFLDGASRLDDLIAEAALHGMPALALTDHNNVSGAVRFQRKAQEAGIQPIQGAELT
DNAE2_PROAC     VRPEYAELHCHSSYSFLDGASNPEDLVIRAVELGLSGLALTDHDGLYGVVRMAEAAEACGLSTIIGSELS
DNAE2_MYCTU     ----YAELHAHSAYSFLDGASTPEELVEEAARLGLCALALTDHDGLYGAVRFAEAAAELDVRTVFGAELS
DNAE2_MYCBO     ----YAELHAHSAYSFLDGASTPEELVEEAARLGLCALALTDHDGLYGAVRFAEAAAELDVRTVFGAELS
DNE21_RHIME     ----FCELGARTNFSFLEGAAPAEEMVVFXXXXXXXXXXIADRNSVAGVVRAHAKAKVEGYPFQPGARLV
DNE21_AGRT5     --PRYAELQVTTHFSFLRGASSCDELFEQAKNLGIEALGVVDRNSLAAIPRAYEAANNHGVR----LVIG
DNAE2_MYCPA     ----YAELHAHSAFSFLDGASTPEEMVEEXXXXXXXXXXXTDHDGLYGAVRFAEAAAELDVRTVFGAELS
DNAE2_SINMW     ----FYELGACTNFSFLEGAAPAEEMVVFAKKARLAGLGIADRNSVAGVVRAHAKAKMENYPFQPGARLV
DNAE2_IDILO     ----FAELHSLSHYSFLRSAASPEELVRRADDLGYAAIAITDECSVAGIVKAYQESKARDIK----LVVG
DNAE2_DECAR     --PEYAELHCLSNFSFLRGASHPEEXXXXXXXXXXXXXXXTDECSLAGVVRAHLAAKKHGLKFIVGSEMM
DNAE2_RHISN     --PTFHELGARTNFSFLEGAAPAEEMIVFAKKAGLSGLGVADRNSVAGVVRAHAKAKVEDFQPGARLVF-
DNAE2_BDEBA     ----FVELLGRSNFSFLQGASSPEEMVSQAVEFGYDGMALCDLNGLYGSLFTASPQVKENFHYLIGSELT
DNAE2_PSEF5     ----YAELHCLSNFSFQRGASSAAELFQRAKALGYQALAITDECTLAGIVRAWQASRDTGLK----LIVG
DPO3A_YERPE     -------LMVRTDFSLGESALKAENAVKIARDAGYTAVISADSMNIASVIPLQRAA-GDDMAVICGVKLN
DNAE2_TERTT     ----YAHLFTFSNFTFLRGASHPAEMVEQAYRLGYDAIALTDECSLAGAVKAHVMAEECGIKLIVGSYFK
DNAE2_BRASO     ----------------------------------------------------------------------
DNAE2_SACD2     ---QYTQLQTLTNYSFLKSASHPQELVEEAKILGYHALAITDECSLAGIVKAHVAAKELNLKLLVGSYFE
DNAE2_PSEPF     MNQGYAELHCLSNFSFQRGASSALELFQRAKKHGYQALAITDECTLAGIVR-AWQAAKSVELPL---IIG
DNAE2_SILPO     ----------------------------------------------------------------------
DNAE2_BRUSU     ----YFEMAAASNFSFLCGASHPQELVERAHALDLSGIGIADRNTLAGVVQWKDIRKESGFRLFIGCRLS
DNAE2_BRUME     ----YFEMAAASNFSFLCGASHPQELVERAHALDLSGIGIADRNTLAGVVQWKDIRKESGFRLFIGCRLS
DNAE2_BRUAB     ----YFEMAAASNFSFLCGASHPQELVERAHALDLSGIGIADRNTLAGVVQWKDIRKESGFRLFIGCRLS
DNAE2_PSE14     MTSEYAELHCLSNFSFQRGASSARELFERASRHGYQALAITDECTLAGIVRAWQASISTGLPLIIGSEMH
DNAE2_PSEU2     MTREYAELHCLSNFSFQRGASSARELFERALRHGYKALAITDECTLAGIVRAWQASKSTGLPLIVGSEMH
DNAE2_CORGL     ----FAELHATSSYNFLTGASDPSDVVVQAKKLGLVALSVMDRDGFYGAVRFXXXXXXXGMHTVYGAELS
DNAE2_RHILO     ----------QSNFSFLRGASKPEELVVAAKLMGFSAIGLADRNTVAGVVRAWQQAKVEKLAYHPGCRLV
DNAE2_CAUCR     --PVYAELQATTNFSFLRGASHXXXXXXXXXXXXXXXIGIVDRNSLAGVVRAWTAAKRRSIRVLTGCRLD
DNAE2_CAUCN     --PVYAELQATTNFSFLRGASHXXXXXXXXXXXXXXXIGIVDRNSLAGVVRAWTAAKRRSIRVLTGCRLD
DNAE2_RHOPS     --PAYAEIGVTTNFSFLEGGSHPQDYVHEASRLGLEAIGIADRNTLAGVVRAYSELGNEDL--IHKPRLL
DNAE2_RHOP2     ----------------------------------------------------------------------
DNAE2_CORJK     ----FAELHASSAYNFLRGASQPEQMVEAARELGLSALACVDRDGFYGAARFATAVAESGLATVFGAELS
DNAE2_VIBPA     ----YAELFCQSNFSFLTGASHAEELVLQAAFYRYHAIAITDECSVAGVVK-AHATIEQHKLDIKQIVGS
DNAE2_CORDI     ----FAELHAASYYHFLHGANSPQDMVAAACQQGMSALALIDRDGFYGAMEFAEAAATSGLPTVFGAELT
DNAE2_ALHEH     ---DYAELHCLSCFSFLRGASQPAELVQRAAELGYRALALTDACSVAGAVRAHQAAKETDLHLIHGSEIR
DNAE2_PSEPK     ----------------------------------------------------------------------
DNAE2_PSESM     MNTEYAELHCLSNFSFQRGASSARELFDRALRHGYAALAITDECTLAGIVRAWQASKDTGLPLIVGSEMH
DNAE2_COREF     ----FVELHATSSYNFLAGASDPGEMVDRAHELGLSALALVDRDGLYGAVRFAEAAAEVGLATVFGAELS
DNAE2_RHOP5     ----------------------------------------------------------------------
DNAE2_METCA     ----------------------------------------------------------------------
DNAE2_ANADE     --PRYAELRCKSCFSFLEGASHPEELVXXXXXXXXXXXXXXDVNGLYGIVRAHAEAKRQGLPLIVGAELV
DNAE2_RHOPA     ----------------------------------------------------------------------
DNAE2_BRAJA     ----------------------------------------------------------------------
DNAE2_NOCFA     ----YAELHAHSAYSFLDGASQPEELVEEAVRLGLEAIALTDHDGFYGTVRFAEAAKEWGIATVFGAELS
DNAE2_ANAD2     --PRYAELRCKSCFSFLEGASHPEELVGRXXXXXXXXXXXXDVNGLYGIVRAHAEAKRQGLPLIVGAELV
DNAE2_HAHCH     ----FVELHCISNYSFLKGASHPEELVRQAIAQGYEGLAITDECSVAG-------AVKAWRE-----LRR
DNAE2_ANASK     --PRYAELRCKSCFSFLEGASHPEELVGRXXXXXXXXXXXXDVNGLYGIVRAHAEAKRQGLPLIVGAELV
DNAE2_PSEA7     ----------------------------------------------------------------------
DNAE2_PSEAE     ----YAELHCLSNFSFQRGASSATEXXXXXXXXXXXXXXITDECSLAGIVRAWQAAREHQVQLIVGSEIR
DNAE2_BURPS     --PDYAELFCRSNFSFLHGASSAEELVERAAKQGYRGIAITDECSLAGAPRMHVAAKAVGLPLVVGAYFG
DNAE2_BURMA     --PDYAELFCRSNFSFLHGASSAEELVERAAKQGYRGIAITDECSLAGAPRMHVAAKAVGLPLVVGAYFG
DNAE2_VIBVU     ----YAELFCQSNFSFLTGASHPEELIVQANFLGYHSLAITDECSLAGIVR-AHSAIKQHQLSVKQIVGS
DPO3A_THEMA     ----------------------------------------------------------------------
DNAE2_VIBVY     ----YAELFCQSNFSFLTGASHPEELIVQANFLGYHSLAITDECSLAGIVR-AHSAIKQHQLSVKQIVGS
DNAE2_VIBHB     ----YAELFCQSNFSFLTGASHAEELVLQAAFYRYQAIAITDECSVAGVVK-AHATIEQHKLDIKQIVGS
DNAE2_RALSO     --PDYAELHCISNFTFLTGASHPHELVARAQAFGYRALALTDECSVAGTVRAHMAAKEAGLKLIIGSRFT
DNAE2_GLUOX     ----------------------------------------------------------------------
DNAE2_AZOSE     ----------------------------------------------------------------------
DNAE2_XANCP     ----------------------------------------------------------------------
DNAE2_XANC8     ----------------------------------------------------------------------
DNAE2_XANAC     --PAYAELHCLSDFSFLRGASSAEQLFARAQQCGYSALAITDECSLAGIVRGLEASRATGVR----LIVG
DNAE2_RALPJ     --PDYAELHCISNFTFLTGASHPSELVERAKLYGYQALALTDECSVAGTARALVASKEHELKLIIGSRFT
DNAE2_XANCB     ----------------------------------------------------------------------
DNAE2_XANOR     ----------------------------------------------------------------------
DNAE2_XANOP     ----------------------------------------------------------------------
DNAE2_BORPA     --PGYAELHCQSNFSFLQGASHPEELVTRAGELGYAALALTDECSLAGVVRAHVEAREQKLPLIIGSSFT
DNAE2_AZOSB     ----------------------------------------------------------------------
DNAE2_PSEMY     ----------------------------------------------------------------------
DNAE2_XANC5     ----------------------------------------------------------------------
DNAE2_BORBR     --PGYAELHCQSNFSFLQGASHPEELVTRAGELGYAALALTDECSLAGVVRAHVEAREQKLPLIIGSSFT
YORL_BACSU      ---------------------------------------------------------------------N
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
PPAC_METJA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVGKCL
DPO3A_RICCN     IKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVGKCL
DPO3A_RICFE     IKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKLCDHIDFEDLIEYQEGLIALCCYTDGIVGKCL
DPO3A_RICTY     IQYDINVFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHINFEDLIKYQEGLIALCCYTDGIVGKCL
DPO3A_RICPR     IQYDINAFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICEHIGFEDLIKYQEGVIALCCYTDGIVGKCL
DPO3A_RICBR     IQYETGVFAEILLIAKDETGYKNLLKLSSITFTTNDRKICNHITFEDLKEHQEGLITLCCYTEGVIGKCL
DPO3A_CAUCR     VVGPTERWARLMLLAQNERGYLNLSELSSIAYLDSAELPEPVVPWAKVAEHSEGLILLSGGTDGPVDALF
DPO3A_CAUCN     VVGPTERWARLMLLAQNERGYLNLSELSSIAYLDSAELPEPVVPWAKVAEHSEGLILLSGGTDGPVDALF
DPO3A_BORBU     KQDDLGKMSHLILLAKNELGYKNLLKLTSISYLEGFY-YRPRIDKDDLEKYSEGLICTSACIGGLIPRLI
DPO3A_ECO57     VQCDLDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSL
DPO3A_ECOLI     VQCDLDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSL
DPO3A_ECOL6     VQCDLDELTHLTVLAANNIGYQNLTLLISKAYQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSL
DPO3A_PSEFL     NKDPDGPLSRISLLVMNAQGYRNLTELISRGFIDGQRNGMVIIEREWVAEANEGLIMLSAAKEGEIGMAM
DPO3A_HAEIN     VKSPLDEYFDLTLLAKNNEGYRNITLLLSKAYQRGYNDL-PYIDQDWLIEHRDGVIILSGGTQGDVGKKL
DPO3A_TREPA     VAPESRFYYHLIVLAKNETGYRNLMVLSSKAYIEG-MYYKPRVDDELLAQHAEGLICLSSCLAGQLPYLL
DPO3A_VIBCH     LQSEEDELTKLTLLAKNNVGYKNLTLLISKAYLRGHVQHQPVIDKAWLVEHAEGLIVLSGGKSGEVGRAL
DPO3A_SALTY     VHNELDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIERDWLVELKEGLILLSGGRMGDVGRCL
DPO3A_BUCAI     FFSDLNQLTKLTLLASTQEGYKNLILLISRAYQKGYVHN-NHVTIEKFSEINKGLILLSGGPQGELGKVL
DPO3A_PSEAE     SREEDGPLSRLSLLAMNAKGYRNLTELISRGWSEGQRNGEIIIERDWVKEAAEGLIALSAAKEGEIGHAL
DPO3A_PASMU     VRSELDEPFELTLLAKNNIGYHNITLLLSKAYERGYQDL-PYLDQAWLAEHREGIIVLSGGHNGDVGKKL
DPO3A_NEIMB     IGNPDDKPFRAMLIIRNDAGYLRLSELLTAAYVGKDRNV-HHAELNP--EWLEGLICLSGAHYGEVGVNL
DPO3A_CAMJE     NHDELDDKSSLCLYAKNEIGYQNLMYLSSQSYIKG-LYYYPRINKKLLEDYSEGLICSSACLQGEVNWHL
DPO3A_THEAQ     SRFDRKRYFHLTLLAKDFTGYQNLVRLASRAYLEGFYEK-PRIDREILREHAQGLIALSGCLGAEIPQFI
DPO3A_NEIMA     IGNPDDKPFRAMLIIRNDAGYLRLSELLTAAYVGKDRNV-HHAELNP--EWLEGLICLSGAHYGEVGVNL
DPO3A_BUCAP     FFSELNXXXXXXXXATNQDGYKNLILLISRAYKKG--YFCEKIEKKWLSELNNGLILLSGGCQGEIGKTL
DPO3A_XYLFT     IAEPEHPPWGMTLLCRDHAGYLNLSQLISRGWLEGHRPVAVHPDW--VRDHHKNLFALIG-RHSLAGQLL
DPO3A_HELPY     IHNDDNLSSKLCLFAKNQEGYENLMFLSSMAYLEGFYYF-PRINKKLLKEHSKGIIASSACLQGEVNYHL
DPO3A_HELPJ     IHNDDNLSSKLCLFAKNQEGYENLMFLSSMAYLEGFYYF-PRINKKLLREHSKGIIASSACLQGEVNYHL
DPO3A_XYLFA     IAEPEHTPWGMTLLCRDHAGYLNLSQLISRGWLEGHRPVAVHPDW--VRDHHKNLFALIG-RHSLAGQLF
DPO3A_BUCBP     VKYSSNMFTKITLLAVNNSGYRNLLLLLSRAYKIGNNKVGVFITKEWLVEHRKGIILLSCYGD--IGXXX
DPO3A_BACSU     VFTDDSELEALVLLAKSNTGYQNLLKISSVLQSKSKGGLKP----KWLHSYREGIIAITPGEKGYIETLL
DPO3A_BACHD     VRFAEDRESDLLLYARSNKGYEHLLKLSTIIQCREEKE--KYVTWEELLAYKDDLLYVIPYSGGFVRACL
DPO3A_AQUAE     DKYN----HHLILIAKDDKGLKNLMKLSTLAY-KEGFYYKPRIDYELLEKYGEGLIALTACLKGVPTYYA
DPO3A_CHLTR     VRFDKKVANHLILLCKDEEGYRNLCLLSSLAYTEGFYYV-PRIDRDLLSQHSKGLICLSACLSGSVAQAA
DPO3A_CHLPN     IRFDKKAAHHLILLCKNEQGYRNLCILTSLAFTEGFYYF-PRIDKDLLRQYXXXXXXXXXXXXXXXXDAA
DPO3A_CHLMU     VRFDSQVANHLILLCKDEEGYRNLCLLSSLAYTEGFYYF-PRIDRELLKQHSKGLICLSACLSGSIXXXX
DPO3A_STRCO     VAPESDVYTHKTMWATNSKGLHNLFRLSSDAYAEGWLQKWPRMDKETISQWSEGIVASTGCPSGEVQTRL
DPO3A_DEIRA     VDGEKGIF-HLTLLARDFEGYQNLCRLSSRGYTEG-YYYKPRIDHELLQEHHKGIIAFSGCLGSEVQQLL
DPO3A_MYCTU     IRFDTDVYTHLTMMAENATGLRNLFKLSSHASFEGQLSKWSRMDAELIAEHAEGIIITTGCPSGEVQTRL
DPO3A_MYCBO     IRFDTDVYTHLTMMAENATGLRNLFKLSSHASFEGQLSKWSRMDAELIAEHAEGIIITTGCPSGEVQTRL
DPO3A_STAAW     VTNGLNTVETVVL-AKNNDGLKDLYQLSS----EIKMNALEHVSFELLKRFSNNMI--------------
DPO3A_STAAS     VTNGLNTVETVVL-AKNNDGLKDLYQLSS----EIKMNALEHVSFELLKRFSNNMI--------------
DPO3A_STAAR     VTNGLNNIETVVL-AKDNYGLKDLYQLSS----EIKMNALEHVSFELLKRFSNNMI--------IIFKNV
DPO3A_STAA8     VTNGLNTVETVVL-AKNNDGLKDLYQLSS----EIKMNALEHVSFELLKRFSNNMI--------------
DPO3A_STAAC     VTNGLNTVETVVL-AKNNDGLKDLYQLSS----EIKMNALEHVSFELLKRFSNNMI--------------
DPO3A_SYNY3     INGDIEIFHQVVL-AKNNQGYRNLVKLTTISNLKGIQRPC--INKELLEQYKEGLIVTSACLGGEVPQAI
DPO3A_STAES     LTDGLYTIETVVL-AKNNQGLKSLYQISSAIMMRNKEEVLKRYDEHLIIIFKEAELSHKQIIDAFEGKKE
DPO3A_STAAN     VTNGLNTVETVVL-AKNNDGLKDLYQLSS----EIKMNSMENVSFELLQQFSSNLI--------IIFKNV
DPO3A_STAAM     VTNGLNTVETVVL-AKNNDGLKDLYQLSS----EIKMNSMENVSFELLQQFSSNLI--------IIFKNV
DPO3A_STAEQ     LTDGLYTIETVVL-AKNNQGLKSLYQLSSAIMMRNKEEVLKRYDEHLIIIFKEAELSHKQVIDAFEGKKE
DPO3A_MYCLE     IRFDTGAYTHLTMVAENAAGLRNLFKLSSLASFEGQLSKWSRMDAELIGEYAEGIIVTTGCPSGEVQTRL
DPO3A_STRP8     ILYQE---RQVLLIAQNTQGYHQLLKIST---AKMSGKL--HMDY------------LCQHLEGIA----
DPO3A_STRP6     ILYQE---RQVLLIAQNTQGYHQLLKIST---AKMSGKL--HMDY------------LCQHLEGIA----
DPO3A_STRP3     ILYQE---RQVLLIAQNTQGYHQLLKIST---AKMSGKL--HMDY------------LCQHLEGIA----
DPO3A_STRP1     ILYQE---RQVLLIAQNTQGYHQLLKIST---AKMSGKL--HMDY------------FCQHLEGIA----
DPO3A_STRPY     ILYQE---RQVLLIAQNTQGYHQLLKIST---AKMSGKL--HMDY------------FCQHLEGIA----
DPO3A_LACLA     FEWR-GLPIAFSFIAKDTEGYKNLLRISTLH--NYGRR-----QFSDIQNHLSGIALIIPETYGSLSELT
DPO3A_MYCGE     VEYQKN-DVKLLLIAKSNKGFQTLNKIA---------LIQQKLEINSLVDQLTDIAVIICYKDVYQAKGI
DPO3A_UREPA     FEYQ---NATLVAYAKNYNGYLKLIKWSSWIMTSKEFEIQD--DFDDLI---------------------
DNAE2_AGRVS     CRLDLQDGMSILVYPTDRTAYSRLARLITLGKGRGGKDNCI-LMLDDIAQYGEGLLGILVPD--------
DNAE2_RHOBA     --HPTDA-PPMVLWPTDRAAYGRMCRMLSTGRMRCEKGRCE-LSFEDIAEHAQGILAGVIATDESRSEDQ
DPO3A_MYCPN     VRH-YEQNVNLLVIAQTNRGYQNLMCLA------------------------------------------
DNE23_AGRT5     CRLDLADGMSVLVYPTDRAAYSRLTRLITLGKSRGGKNNC-LLHWDDVV----------AYTDGMIGILV
DNE22_AGRT5     CRLDLTDGMSLLVYPTDRAAYSRLTRLITLGKSRGGKNNCI-LHWDDVIAYSRGMIGV------------
DNE22_RHIME     CRLDLQDGMSILVYPTDRAAYSXXXXXXXXXXXXXXXANCI-IHFDDVALYAEGLIGILVPD--------
DNAE2_SYMTH     LEGGY----HLTLLATGPKGYANLNRLITAAHLGQEPRATPGAMFHDRLQPACPLSALSHDTDGLIALSG
DNAE2_PROAC     IGVPDPVGSHLLVLANGPEGYRRLAELTDAYLVEGGRKGRPVHDLDHLAEVADGWTVLTGCRKGAVRQGL
DNAE2_MYCTU     LGATARTERHLLVLARGPEGYRRLSRQLAAAHLAGGEKGKPRYDFDALTEAAGGILTGC--RKGHVRQAL
DNAE2_MYCBO     LGATARTERHLLVLARGPEGYRRLSRQLAAAHLAGGEKGKPRYDFDALTEAAGGILTGC--RKGHVRQAL
DNE21_RHIME     FA---DGTPDILAYPKNRRGWGHLCRLLSAGNLRSKKGDCT-LHLADLLEWQEELLLIVMQGEG------
DNE21_AGRT5     CRXXXXXXXXXXXYPMDRAAYGRLCRLLSVXXXXXXXXXC-RLSWDDLVAYGEGLIVVXXXXXXXXXXXX
DNAE2_MYCPA     LGPSARTEAHLLVLARGPEGYRRLSRQLAAAHLAGGEKGKPRYDLDALTEAAGGILTGC--RKGHVRQAL
DNAE2_SINMW     FA---DGTPDVLAYPRNRRGWGHLCRLLSAGNLRSKKGDCT-LHLADLLEWQEELL-LIVMPDRV-----
DNAE2_IDILO     SEFRVPEVGTLVVLAPTREAYAELCKKITLFRSRSEKG-----------HYQANIDD---FFDGF-SQCL
DNAE2_DECAR     TVDGL----KLVFLACNRHGYGNLSALITLARRRAEKGTLHRNDLESISP------------SGALPDCL
DNAE2_RHISN     ----ADATPDILAYPKNRRGWGHLCRLLSVGNLRAKKGDCT-LYLADLLEWQEDLLLIVMPGEG------
DNAE2_BDEBA     LTDE----SSVVLIPMNKQGYSHLCEILTLG-KRQAAKGFSKLSLEQIEKYNQGLLCLALWTD-------
DNAE2_PSEF5     SEMQVEDGPRLVLLVEDLAGYQGLCRLITRA-RRRAEKGSYRLLREDFAEPLPGLLALWLTGAG------
DPO3A_YERPE     VVDDPTYEHRARLAKESERCMESLVRDRSYCFTKNEQGYRDVCELMTLANKREQFYFVAAYAKGNI---I
DNAE2_TERTT     LSNNCELIA----LAPDRAAYAELSGFITLARRRADKEYTAHMD--DLRFRLQTCLIIWLPTANTA----
DNAE2_BRASO     ----------------------------------------------------------------------
DNAE2_SACD2     LTNGFKIIA----IAPNRQAYAELSGFISLARRRASKG-----------EYEAHLSDLRFRLQQCLIIWL
DNAE2_PSEPF     SEIRIENGPKLVLLVENIEGYQALCGLITQA-RRRTQKGQYQILREDFSEPLPGLLVL--WVPEAVDEV-
DNAE2_SILPO     ----------------------------------------------------------------------
DNAE2_BRUSU     F---IDGTPDMVVYPRDRAAYGQLCRL--LTEGKHRAAIKGHLEWADLL-FRARQFQIAVFPP-------
DNAE2_BRUME     F---IDGTPDMVVYPRDRAAYGQLCRL--LTEGKHRAAIKGHLEWADLL-FRARQFQIAVFPP-------
DNAE2_BRUAB     F---IDGTPDMVVYPRDRAAYGQLCRL--LTEGKHRAAIKGHLEWADLL-FRARQFQIAVFPP-------
DNAE2_PSE14     IENG----PKAVLLVESQTGYEALCKLITVA-RRRARKGEYRLLREDFEPSSDGLLAI--WLPDIEG---
DNAE2_PSEU2     IENG----PKVVLLVENQAGYEALCKLITVA-RRRAGKGEYRVLREDFEPAPDGLLALWLPDDGNAQACL
DNAE2_CORGL     LQEGV-----LTVLCKNPEGYKKLSHLSDAKMATGEKGEVRYPPLPMVAEHAAGVLAGFQWLDKIDYVID
DNAE2_RHILO     FG---DGTPDILAYPRNRAGWGHLCRLTQANLRDETEKGATLLQRDDLLEWGD-LMSLAVLPD-------
DNAE2_CAUCR     F---MDGAPSLLCYPTDREAFGRLTRLLTIGQLRAEKGEC-HLTWRDFLDHSEGQLGL------IVPPRV
DNAE2_CAUCN     F---MDGAPSLLCYPTDREAFGRLTRLLTIGQLRAEKGEC-HLTWRDFLDHSEGQLGL------IVPPRV
DNAE2_RHOPS     IGARL-VFADVLAYPVDRAAYGRLCRLLSVGKLRGAKGEC-HLAVADLEAFSQGL-----------SLVL
DNAE2_RHOP2     ----------------------------------------------------------------------
DNAE2_CORJK     LDVPLTV------LCKGREGYTRLSRVIADARMADPDK--DSVRYPSLPQLAEAAGGHWLVTDAQLVDFF
DNAE2_VIBPA     MFW-LNEECQIVLLCPCRKAYAEMCRIITNARRRSEKGSYQLSEW-DLMSIRHCLV------------LW
DNAE2_CORDI     LAPD----RILTVLARGVEGYTSLSRLITQARMRGSKDVTIYPPLAEIVE--------------------
DNAE2_ALHEH     IHQG----PLLVLLAPCRRAWAELCALISLGRSQA-RKGDYRLEREQLEGTLPHCLALWVPDDA------
DNAE2_PSEPK     ----------------------------------------------------------------------
DNAE2_PSESM     LENG----PKIVLLVENLTGYQALCTLITVA-RRRAKKGEYRLLLEDFDHLPGGLLAILADIEGDAQACL
DNAE2_COREF     LREGV-----LTVLCRGVEGYRRLSHLITGAAMSAGEK--GSVDYPLLPQVAE---------QGAGHWVV
DNAE2_RHOP5     ----------------------------------------------------------------------
DNAE2_METCA     ----------------------------------------------------------------------
DNAE2_ANADE     VALAPGRPARLVLLAQDREGYAGLCRLVTRAHCGEGERDAVAVPFEAVAAGARGLFALYPGADGDA----
DNAE2_RHOPA     ----------------------------------------------------------------------
DNAE2_BRAJA     ----------------------------------------------------------------------
DNAE2_NOCFA     LGXXXXXXXHLLVLARGQEGYRRLSREIAAAHLAAGEKGVLRYDIDALTAARKGHLRTALADDLAAGETG
DNAE2_ANAD2     VALAPGRPARLVLLAQDREGYAGLCRLVTRAHCGEERRERDAVPFEAVAAGARGLFALYPGADGDA----
DNAE2_HAHCH     LRQEAPEASAFKLIIGSEFHYEGVLAPHKKAYGELCRFITDCRRKADKGDYQFSPDAL---NENIKQGLL
DNAE2_ANASK     VALAPGRPARLVLLAQDREGYAGLCRLVTRAHCGEERRERDAVPFEAVAAGARGLFALYPGADGDA----
DNAE2_PSEA7     ----------------------------------------------------------------------
DNAE2_PSEAE     LEQG----PKLVLLAEDLEGYQNLCRLITRGRRQADK---GHYRLEDLQQPLAGLLAIWLPND-------
DNAE2_BURPS     VTXXXXXXXXLVLLAQNREGYGNLSELIS-----------------------------------------
DNAE2_BURMA     VTXXXXXXXXLVLLAQNREGYGNLSELIS-----------------------------------------
DNAE2_VIBVU     F-FKLNTECQFVLLCPNREAYAELCRIIT-----NARRRCEKGQYQ-LSQWDVMSLKHCLLIWLPTGQT-
DPO3A_THEMA     ----------------------------------------------------------------------
DNAE2_VIBVY     F-FKLNTECQFVLLCPNREAYAELCRIIT-----NARRRCEKGQYQ-LSQWDVMSLKHCLLIWLPTGQT-
DNAE2_VIBHB     MFW-LNDECQVVLLCPCRKAYAELCRIITNARRRSEKGSYQLSEW-DLMSVRH------CFV------LW
DNAE2_RALSO     VRAQGEPWLRLVLLAQDIDGYGNLCECITQA-----RLAAPKGDYRLLADDLAAPAGELAHLRGMP-HCL
DNAE2_GLUOX     ----------------------------------------------------------------------
DNAE2_AZOSE     ----------------------------------------------------------------------
DNAE2_XANCP     ----------------------------------------------------------------------
DNAE2_XANC8     ----------------------------------------------------------------------
DNAE2_XANAC     SEFTLVDGTRFVLLVENAHGYPQLCGLIT-TARRAASKGAYRLDRAEVAQFRDVAPG--------VFALW
DNAE2_RALPJ     VRNDGEPWLRLVLLAQNIEGYGNLSEIARLAAPKGEYRLLA----DDLASPQGELAHLRGAPDCLA--IL
DNAE2_XANCB     ----------------------------------------------------------------------
DNAE2_XANOR     ----------------------------------------------------------------------
DNAE2_XANOP     ----------------------------------------------------------------------
DNAE2_BORPA     LQXXXXXXXXXXXXXQNREGYGNLAELITLGRGRKGQYLLTPADIEAPAGDNAHLRGMCXXXXXXXXXXX
DNAE2_AZOSB     ----------------------------------------------------------------------
DNAE2_PSEMY     ----------------------------------------------------------------------
DNAE2_XANC5     ----------------------------------------------------------------------
DNAE2_BORBR     LQXXXXXXXXXXXXXQNREGYGNLAELITLGRGRKGQYLLTPADIEAPAGDNAHLRGMCXXXXXXXXXXX
YORL_BACSU      YKSGVTKFPHFLMLAMDPKGHEQLRILSSQAWENSERVPTVKKDVEELLSKDPGHITACLGSEVNIHLLK
DPO3_STAES      --------SHVTLIVQNQEGLKNLFKIVSASLVKYYYRT-PRIPRSLLNEYREGLIGTAC-DEGELFTAV
DPO3_STAEQ      --------SHVTLIVQNQEGLKNLFKIVSASLVKYYYRT-PRIPRSLLNEYREGLIGTAC-DEGELFTAV
DPO3_LACS1      -----------IILAKTQEGLKNLFKLTSESMVKYFYRV-PRVPRSILEKYREGLIVGSACADGEVFTAM
DPO3_PEDPA      -----------ILIAKTQAGLKNLFKLVSMSNVKYYYRV-PRIPRSELEKLREGIIVGSACSSGDVFTAM
DPO3_BACCR      --------SHMTLLATSDVGLKNLYKLVSYSHLNYFYRV-PRVPRSLLKKYREGLVGTAC-DKGEVFEAM
DPO3_STRT1      ------------LYVQNQTGLKNIFKLVSLSNVSYFEGVA-RIPRKVLDEYREGIIVGSACADGEVFDTL
DPO3_STRTD      ------------LYVQNQTGLKNLFKLVSLSNVSYFEGVA-RIPRKVLDEYREGIIVGSACADGEVFDTL
DPO3_STRT2      ------------LYVQNQTGLKNIFKLVSLSNVSYFEGVA-RIPRKVLDEYREGIIVGSACADGEVFDTL
DPO3_LACRD      ----------VTIFAQTQAGLKNLFKLVSLSNVEYFYRV-PRIPRTVLTKYREGLLGTAC-SSGEVFTAM
DPO3_MYCGE      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3_BACSU      ------------LLAVNSTGLKNLFKLVSLSHIHYFYRV-PRIPRSQLEKYREGLIGSAC-DRGEVFEGM
DPO3_STRMU      ----------------NQKGLKNLFKLVSLSNVTYFAGVA-RIPRTILDQYRDGLLGTAC-SDGEVFDTV
PPAC_METJA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LARNEEQAMLFARKLQEILGDRFYFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAH
DPO3A_RICCN     LARNEEQAMLFARKLQEILGDRFYFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAH
DPO3A_RICFE     LARSEEQAMLFARKLQDILGDRFYFEIMRHDLPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKTMHDAH
DPO3A_RICTY     LARKQEHAIMFARRLQAILGDRFYFEIMRHDLPEEQFIENSYIQIASELSIPIVATNKVLFSEKSMHYAH
DPO3A_RICPR     LARKQEQAILFARRLQAILGDRFYFEIMRHDLPEEQFIENSYIQIASELSIPIVATNKVLFSEKSMHYAH
DPO3A_RICBR     LANKEEQAEMFARNLQEIFGDRFYFEIMRHDLPEEQLIEDNYIKIASKLNIPLVATNKVLFSKKSMHDAH
DPO3A_CAUCR     AAGKTAEASAALAEMHRVFGDRFYVELQRHGLPRQAAAEPGLVNWAYDHDVPLVATNDVYFAKPGFYDAH
DPO3A_CAUCN     AAGKTAEASAALAEMHRVFGDRFYVELQRHGLPRQAAAEPGLVNWAYDHDVPLVATNDVYFAKPGFYDAH
DPO3A_BORBU     LANRFEDAKNEILWFKKVFGNDFYLELQRHGIKDQDIVNERLVKYSRELGVPLTAANDSHYVNREDATAQ
DPO3A_ECO57     LRGNSALVDECVAFYEEHFPDRYFLELIRTGRPDEE----SYLHAAVELALPVVATNDVRFIDSSDFDAH
DPO3A_ECOLI     LRGNSALVDECVAFYEEHFPDRYFLELIRTGRPDEE----SYLHAAVELALPVVATNDVRFIDSSDFDAH
DPO3A_ECOL6     LRGNSALVDECVAFYEEHFPDRYFLELIRTGRPDEE----SYLHAAVELALPVVATNDVRFIDSSDFDAH
DPO3A_PSEFL     IGGNPAEAEALAREWMAVFPDRFYLEIQRTNRPNDEEQLHGAVALADKLGAPLVATNDVRFIKQEDFAAH
DPO3A_HAEIN     LKENVAEIESAVAFYQEFFADHFYLALSRTGRPNEERYIQAALKLAERCDLPLVATNDVMFLNTEDFEAH
DPO3A_TREPA     LQGRKREAEEHARKYRALFGDNYFIEVQDHGLDEEKKVAPLLIELACRLGIPLVVTNDVHYAEQEDSVAQ
DPO3A_VIBCH     LKGNQQQVERCIEFYQTHFADHFYLELIRTGRADEESYLHFALDVAEQYDLPVVATNEVVFITEESFEAH
DPO3A_SALTY     LRGNQALVEECVAFYEAHFPDRYFLELIRTGRQDEETYLHAAVELAEARGLPVVATNDVRFLESDDFDAH
DPO3A_BUCAI     LNGQSSLISICLSFYQKYFPDSYYLELFRTNRDNEE----TYLHLAVDLSVPIVATNDVCFLSQEDFKIH
DPO3A_PSEAE     LDGEEAKAEALLREWMEVFPERFYVEVQRTSRVNDEEHLHAAVALASRCNAPLVATNDVRFIKQEDFEAH
DPO3A_PASMU     LKGHAAEIESAVAFYQDFFPDHFYLSLSRTGRYEEERYVSLALTLAEEKGLPVVATNDVLFLHEDDFEAH
DPO3A_NEIMB     LNGNEDAARTAALKYAAWFPDAFYMELQRPERPEWEACVSGSVKLAEELGLPVVATHPTQFMSRDDFNAH
DPO3A_CAMJE     NTYSERNVRFXXXXXKKVFKDDFYFEIMRHGIGDQRMIDDDIIRLSKELNIKIIATNDTHYTFKERAAAH
DPO3A_THEAQ     LQDRLDLAEARLNEDLSIFGDRFFIEIQNHGLPEQKKVNQVLKEFARKYGLGMVATNDGHYVRKEDARAH
DPO3A_NEIMA     LNGNEDXXXXXXXXXXXWFPDAFYLELQRPERPEWEACVSGSVKLAEELGLPVVATHPTQFMSRDDFNAH
DPO3A_BUCAP     LRGQTSLISDCLHFYEKYFSGFYYLELIRTYRENEE----KYLSLAVDLSIPVVATNDVCFLNKEDFKIH
DPO3A_XYLFT     AKGRADLAEQQLADWQHVFGDGLHLELTRTGRDGEEPFNQFALQVAGIRGIPVIASNDVRFLVQSDFLAH
DPO3A_HELPY     NTNNEDEAKKIACEYQEIFEDDFYLEIMRHGILDQRFIDEQVIKMSLETGLKIIATNDTHYTMPNDAKAQ
DPO3A_HELPJ     NTNNEDEAKRIACEYQEIFEDDFYLEIMRHGILDQRFIDEQVIKMSLETGLKIIATNDTHYTMPNDAKAQ
DPO3A_XYLFA     AKGRADLAEQQLADWQHVFGNGLHLELTRTGRDGEEPFNQFALQVAGIRGIPVIASNDVRFLVPSDFLAH
DPO3A_BUCBP     XXXXXXXXXXXXXFYNRFFENFYYLEIMRGRSNEEQYI--SRIKISAREGIPVVATNEVCFLNKQDFEVH
DPO3A_BACSU     EGGLFEQAAQASLEFQSIFGKAFYFSYQPFK--GNQVLSEQILKLSEETGIPVTATGDVHYIRKEDKAAY
DPO3A_BACHD     EDEALERGERFIQFLKDHLGESVYLEIQGTDRSKVEPIN----QLAAKLAIPLVCSQHIQVLEREDLDAW
DPO3A_AQUAE     SINEVKKAEEWVKKFKDIFGDDLYLELQANNIPEQEVANRNLIEIAKKYDVKLIATQDAHYLNPEDRYAH
DPO3A_CHLTR     XXXXXXXXXXXXW-YQDLFQEDFFSEVQLHKSSEEQFIEEAVLATSKRLGIPSVATNDIHYLNPDDWLAH
DPO3A_CHLPN     L-KSPEALLLELQWFQDLFKDDYFTEVQLHKMSEESIVNTAVLEASKRLGIPTVATNDIHYINANDWQAH
DPO3A_CHLMU     XXXXXXXXXXXXW-YQDLFQEDFFSEVQLHKSSEEQFIEDAVLTVSKRLGISSVATNDIHYLDPDDWLAH
DPO3A_STRCO     RLGHFDEALKAAADYQDIFGDRYFLELMDHGIEIEHRVRDGLLEIGRKLGIPPLVTNDSHYTYAHEATAH
DPO3A_DEIRA     MQGREDDARARLLWYRELFGDNYFIEIQDHGLPEQKKNNPILKAWAQELGIGMVATNDGHYVKKSDATAH
DPO3A_MYCTU     RLGQDREALEAAAKWREIVGDNYFLELMDHGLTIERRVRDGLLEIGRALNIPPLATNDCHYVTRDAAHNH
DPO3A_MYCBO     RLGQDREALEAAAKWREIVGDNYFLELMDHGLTIERRVRDGLLEIGRALNIPPLATNDCHYVTRDAAHNH
DPO3A_STAAW     --------IIFKK-----VGDQHRDIVQVFETHNDTYMDHLSISIQGRKHVWI---QNVCYQTRQDADTI
DPO3A_STAAS     --------IIFKK-----VGDQHRDIVQVFETHNDTYMDHLSISIQGRKHVWI---QNVCYQTRQDADTI
DPO3A_STAAR     ADEHRDIVRVFDSH------------------------EDTYLRSVLVQGIKHVWIQDVCYQTR--HDA-
DPO3A_STAA8     --------IIFKK-----VGDQHRDIVQVFETHNDTYMDHLSISIQGRKHVWI---QNVCYQTRQDADTI
DPO3A_STAAC     --------IIFKK-----VGDQHRDIVQVFETHNDTYMDHLSISIQGRKHVWI---QNVCYQTRQDADTI
DPO3A_SYNY3     LKGDLDHARQVAKWYKNLFGDDYYLEIQDHGSVEDRLVNINLVKIAQELDIKIVATNDSHFISCNDVEAH
DPO3A_STAES     LYLNHNSNNTLTGKRVWMQSARYLNEDDAETIPALHAIRDN--------------TKLDLIHEKETLDEH
DPO3A_STAAN     ADEHRDIVQVF-------------------DSHEDTYLDHQSVLVQG---IKHVWIQNVCYQTRQDADTI
DPO3A_STAAM     ADEHRDIVQVF-------------------DSHEDTYLDHQSVLVQG---IKHVWIQNVCYQTRQDADTI
DPO3A_STAEQ     LYLNHNSNNTLTGKRVWMQSARYLNEDDAETIPALHAIRDN--------------TKLDLIHEKETLDEH
DPO3A_MYCLE     RLGHDREALESAAKWREIVGDNYFLELMDHGLSIEQRVREGLLNIGRKLNIPPLATNDCHYVTRDAVHNH
DPO3A_STRP8     -------VIIPSKGWSDTLVVPFDYYI-----GVDQYTDLSHMDSKRQL-IPLRTVR--YFAQDDMETLH
DPO3A_STRP6     -------VIIPSKGWSDTLVVPFDYYI-----GVDQYTDLSHMDSKRQL-IPLRTVR--YFAQDDMETLH
DPO3A_STRP3     -------VIIPSKGWSDTLVVPFDYYI-----GVDQYTDLSHMDSKRQL-IPLRTVR--YFAQDDMETLH
DPO3A_STRP1     -------VIIPSKGWSDTLVVPFDYYI-----GVDQYTDLSHMDSKRQL-IPLRTVR--YFAQDDMETLH
DPO3A_STRPY     -------VIIPSKGWSDTLVVPFDYY-----MGVDQYTDLSHMDSKRQL-IPLRTVR--YFAQDDMETLH
DPO3A_LACLA     LSSVADEAFIGIDQLTD-KGAKF-------NLPTLPFPAIRYLNFADNLAILHAVRDGVSFDES------
DPO3A_MYCGE     EINQTPIAILAAVNCEKTNSDQVVLTVLK-QMKQNQTGKITTFDWDLKQKLNQISINENLKVKSEI----
DPO3A_UREPA     ----------------------------------------------------------------------
DNAE2_AGRVS     LA--DDTCAVQLRKMAEVFGDLAYLSLCLRRRPNDQLRLHELSNMATRFKVKTVVTNDVLFHEPGRRQLQ
DNAE2_RHOBA     HAHVNDSRQFLRGPFRDVFDDRGYLLASFHRGVDDAAKATWLRNLSLATDVPLLACGDVRYHSAERMALH
DPO3A_MYCPN     ----------------------------------------------------------------------
DNE23_AGRT5     PDLPDDLCGIQLRKMAELFGDRAYVSLCLRRRQNDQLRLHEISNLATRFKVRTVVTNDVLFHEPGRRQLQ
DNE22_AGRT5     LVPDLPDATCAARRIAEAFGDRAYVSLCLRRRQNDQMRLHEISNLAARFKVKTVVTNDVLFHEPGRRQLQ
DNE22_RHIME     LA--DEVCAVQLRKIAEVFGDRAYVSLCLRRRPNDQLQLHELTNLAVKHRVKTIVTNDVLFHEHGRRQLQ
DNAE2_SYMTH     CRRGEIPSLILRGRLXXXXXXRFYLELHDERLPGEQALNRALRDLGEALGLPLVVTSNVHHRTREEFFVH
DNAE2_PROAC     V-KGMLQAEAELRRLVDLFGDNVLVELTDHRAPTDSRDNDLLAELASRHSLLTVATTAAHYAGAEQFELA
DNAE2_MYCTU     SQGGPAAAQALADLVDRFTPSRVSIELTHHGHPLDDERNAALAGLAPRFGVGIVATTGAHFADPSXXXXX
DNAE2_MYCBO     SQGGPAAAQALADLVDRFTPSRVSIELTHHGHPLDDERNAALAGLAPRFGVGIVATTGAHFADPSXXXXX
DNE21_RHIME     --RPEPESLVLLGTLKEHAGNRLYLGLAPHYDGFDRHDFAVLAAIARKAGIGLLATNDALYHDPHYRPLA
DNE21_AGRT5     XXXXXXXXXXXXX----------YMALSLRRRPNDQMRLFELSGMAQAAGVPTVVTNDVLFHVPERRMLQ
DNAE2_MYCPA     SDGGPXXXXXXXXXXXXXFGARVSIELTRHGQPLDDERNAALAALAPRFGVGVVATTGAHFAGPSRRR--
DNAE2_SINMW     --RPEPESLKLLGKLQEHAGNRLYLGLAPRYDGFDRHDFAVLATVARKAGIGLLATNDALYHDPDYRPLA
DNAE2_IDILO     LLWQPDQAQLLAEKLKSVWQQRFWLLYERHYQADDERAFQAMVELQQAVKVKVTCAGGVCMATIEQQPLY
DNAE2_DECAR     VVPGNNPSSADGEWLVSRFPGRSWIAVELHAGPEDAERLAGLQSLGEVCGLPLVATGDVHMHIKARRPVQ
DNAE2_RHISN     -RPQPEIXXXXXXXXXXSAGNRLYLGLAPRYDSFDRHDFAVLATVARSLDVRLLATNDALYHDPHYRPLA
DNAE2_BDEBA     -ERYE--------KLEKIFDNRLYLPLWRDLTWESQEFCRQGFALEEKYKAQLFVTQRPFMHSPERKPLF
DNAE2_PSEF5     ------EPLAQGRWLQQVFPQRLWLALELHCGXXXXXXXXXXXXXXXXXXXPAVACGDVHMHVRGRRALQ
DPO3A_YERPE     LLTSDIGSVFQRRDFAKIIGDNFYSVVYPHPTPFYDQINVRAMKVASALKIEPVAFYPAYYEAVDDADIK
DNAE2_TERTT     ---TEDNARIFSAAFKQ----RLWLGVGHQLAGGEQRLFQQWQNLAATYQLPMVASHLALMHSAERKPLQ
DNAE2_BRASO     --------------------------------------------------VPLIATNDVLYHHPQQRMLQ
DNAE2_SACD2     PYFNNHISDVDVTTLATAFKQRLWIGVSHTLIAAEQRLFSHLNKLANALHVPLVASGLTYMHNKNCKPLL
DNAE2_PSEPF     ----EE-----GRWLKQTFGERLWLAVQLHRGQNDQQRLAALLSLADELQIPAVASGDVHMHARGRRALQ
DNAE2_SILPO     ---------------------------------------------------PMVAVGDALMHRANRRQLA
DNAE2_BRUSU     ----DEDEPDFAARLTEIAGSVWLALTMPHQGQDGRRAE-RIARFAAQAGVPLIATNDVLYHHPDRRPLQ
DNAE2_BRUME     ----DEDEPDFAARLTEIAGSVWLALTMPHQGQDGRRAE-RIARFAAQAGVPLIATNDVLYHHPDRRPLQ
DNAE2_BRUAB     ----DEDEPDFAARLTEIAGSVWLALTMPHQGQDGRRAE-RIARFAAQAGVPLIATNDVLYHHPDRRPLQ
DNAE2_PSE14     ---DAQACLAHGRWLRERFAERLWLGVELHRGADDEQRLADLLALAQSLGIPAVASGDVHMHARGRRALQ
DNAE2_PSEU2     AG---------GRWLRERFAERLWLGVGLHRGPDDEQRLADLLALAQSLGVPAVASGDVHMHARGRRALQ
DNAE2_CORGL     CFKPENIVLEFGSTMTPEDADRN--EYLRRTQAKFQLILSTNPESAARGSVRLAGAKQALARKMPLADAE
DNAE2_RHILO     LAAGAEDSLALLGQIKDRFGRALRLGVSPCYAGYDRFRIEQAAALAQVAGIPLMATNDVLYHTAERRPLQ
DNAE2_CAUCR     LDDSFEQHLT---RMAGDLRGRSWLAASRAYAARDLQRLARLESLGRTSGAPIVATNDVLYHGPERRPLQ
DNAE2_CAUCN     LDDSFEQHLT---RMAGDLRGRSWLAASRAYAARDLQRLARLESLGRTSGAPIVATNDVLYHGPERRPLQ
DNAE2_RHOPS     MPPYRFQASAIAAALQRLTAGGVWLGLTPYYRGDDKRRLARLKRVAWAARVPGIATNDVLYHHPERRALQ
DNAE2_RHOP2     --------------------------------------------------VPGIATNDVLYHHPSRRALQ
DNAE2_CORJK     GADNVVVELQHTMNPADARNERLHALAVRHGLRE---IVSSAPTCATPKHSRLAGAKAALRERKDMAAAE
DNAE2_VIBPA     LPTHQASDHYWGRWLNQHHNNRLWVAIQRHLGGDDDAYTNHCEKLAHELQQPITACGGVLMHTAERLPLQ
DNAE2_CORDI     ----------------------------------------------------------------------
DNAE2_ALHEH     -PHDAEQGRWFARHF----GDRGHVAVALHHGPDDEXXXXXXXXXXXXXXXXXVAAGGVLMHRRGRRALQ
DNAE2_PSEPK     ----------------------------------------------------------------------
DNAE2_PSESM     AQGNW---------LRERFAERLWLGVELHRGXXXXXXXXXXXXXXXXXXIPAVASGDVHMHARGRRALQ
DNAE2_COREF     LAGVEWQKKI--DHLIECFGDNVVLEFPARMLPEDTDHHDILRSIQTRTGLRILSTMPTAATRDHVRLAG
DNAE2_RHOP5     --------------------------------------------------VPGIASNDVLYHHESRRALQ
DNAE2_METCA     --------------------------------------------LGERLGLPLVACNDVHMHARERQPLQ
DNAE2_ANADE     -----------VARLKDAFGXXXXXXXXXXXXXGEEARVLAARSAGRRLGVPVAVTNDVHTHARARQVLQ
DNAE2_RHOPA     ---------------------------------------------------PCIATNDVLYHHPRRRALQ
DNAE2_BRAJA     --------------------------------------------------VQLLATNEVLYHDPARRPLQ
DNAE2_NOCFA     LPRAEAAL----RDLVERFGDRVSVELTHHGVPADDERNALLIALADRVGLPVLATTGAHFAGPEQXXXX
DNAE2_ANAD2     -----------VARLKDAFGRRAALAVTRHRVAGEEARVLAARSAGRRLGVPVAVTNDVHTHARARQVLQ
DNAE2_HAHCH     LWRPKQSDQEFIPALTKIFSGXXXXXXXXXXXXXXXXXXXXIQTLSSAYNLPVVSSNGVKMHAPERKRLH
DNAE2_ANASK     -----------VARLKDAFGXXXXXXXXXXXXXGEEARVLAARSAGRRLGVPVAVTNDVHTHARARQVLQ
DNAE2_PSEA7     ----------------------------------------------------------------------
DNAE2_PSEAE     --HGDEQAAW----LRERFPQRLWLGVELHRGXXXXXXXXXXXXXXSHLRLPPVACGDVHMHARGRRALQ
DNAE2_BURPS     ----------------------------------------------------------------------
DNAE2_BURMA     ----------------------------------------------------------------------
DNAE2_VIBVU     ---SDEQWATWLSRYQQ---SRLWLGLQRHLRHDDEHYLHHCQTLANQFDLPITACGGVLMHRPERLPLQ
DPO3A_THEMA     ----------------------------------------------------------------------
DNAE2_VIBVY     ---SDEQWATWLSRYQQ---SRLWLGLQRXXXXXXXXXXXXCQTLANQFDLPITACGGVLMHRPERLPLQ
DNAE2_VIBHB     LPTHQESDHYWGRWLQQHHAHRLWVAIQRHLGGDDDAYTTHCELLANEFQLPIAACGGVLMHAVERLPLQ
DNAE2_RALSO     AILDPRHLLAQAQWCRQVFGDRLSMAL---ELPLRHADDRHRGTVAAQTDVPMVATGDVAMHSRQRKPLH
DNAE2_GLUOX     ----------------------------------------------------------------------
DNAE2_AZOSE     ----------------------------------------------------------------------
DNAE2_XANCP     ----------------------------------------------------------------------
DNAE2_XANC8     ----------------------------------------------------------------------
DNAE2_XANAC     LPGAQPQAEQGAW-LQQVFGERAFLAVELHREQDDVARLHVLQALAQQLGMTALASGDVHMAQRRERIVQ
DNAE2_RALPJ     LPDYDQQLLAQAWWCQRVFGDRLSIAL---ELPADDRHRGTVLAVSEQIDVPMVATGGVQMHTRQRKPLH
DNAE2_XANCB     ----------------------------------------------------------------------
DNAE2_XANOR     ----------------------------------------------------------------------
DNAE2_XANOP     ----------------------------------------------------------------------
DNAE2_BORPA     XERLAEQARWLAAQCP---GRAWIGLTLLHHCRDD--LHRAAVEHAAHASLPIVALGQAQMHRRSRKPLH
DNAE2_AZOSB     ----------------------------------------------------------------------
DNAE2_PSEMY     ----------------------------------------------------------------------
DNAE2_XANC5     ----------------------------------------------------------------------
DNAE2_BORBR     XERLAEQARWLAAQCP---GRAWIGLTLLHHCRDD--LHRAAVEHAAHASLPIVALGQAQMHRRSRKPLH
YORL_BACSU      IKAFEETGSIKQHKLKEVFGDKFFIELQPALSEEQIYCNKKLIDIANGYDLQMIVTTDAHYLRPEDRAIH
DPO3_STAES      MQKDQSEVEKIAKFYDEVQPPALYQDLMDRELRDNETLTQIYKRLGKSANIPVIATGNAHYLYEHDAIAR
DPO3_STAEQ      MQKDQSEVEKIAKFYDEVQPPALYQDLMDRELRDNETLTQIYKRLGKSANIPVIATGNAHYLYEHDAIAR
DPO3_LACS1      MQKGYTIAKQKAEDYLEVQPKPLYEPLLEQELVKDEEIITNMVKLAHELDKPIVATGDVHFMNKEDAIYR
DPO3_PEDPA      MQKGYADARRKAKDYLEVMPKPVYQPLIEQELVSDEEIIANIVKLGEDLDIPVVATGDVHYLNPQDYIYR
DPO3_BACCR      MQKAPEE-------VEEIAQFYDYIEVMPPELVERELVRDNLVKLGETLDKPVVATGNVHYLDPEDAMYR
DPO3_STRT1      LSHGIDKAVEVAKYYDEVMPPAIYAPLIAKDLIKEQLIRD-LIEVANRLDKPVLATGNVHYINPEDAIYR
DPO3_STRTD      LSHGIDKAVEVAKYYDEVMPPAIYAPLIAKDLIKEQLIKD-LIEVANRLDKPVLATGNVHYINPEDAIYR
DPO3_STRT2      LSHGIDKAVEVAKYYDEVMPPAIYADLIKDEEAIEQLIRD-LIEVANRLDKPVLATGNVHYINPEDAIYR
DPO3_LACRD      MEKGYDQALEKARYYDEVQPKPNYAPLLQHVIADEGHLEDNMVKLGDELEKTVVATGDVHYLDP--HDGI
DPO3_MYCGE      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3_BACSU      MQKSPEEVEDIASQPPEVYRHLLELELVRDEKALKEIIA-NITKLGEKLNKPVVATGNVHYLNDEDKIYR
DPO3_STRMU      LSKGVEDAVEVAKYYDEVMPPALYEPLLARELIKQQIIKD-LIEVGRRLDKPVLATGDVHYLEPEDEIYR
PPAC_METJA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DVLLCISAGVTKEYLDRKTVSENCYFKSPHEMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATE
DPO3A_RICCN     DVLLCISAGVTKEYLDRKTVSENCYFKSPHEMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATE
DPO3A_RICFE     DVLLCISAGVTKEYPDRKTVSENCYFRSPHEMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATK
DPO3A_RICTY     DVLLCISEGVTKEYPDRKTVSENCYFKSPAEMKKLFSDLPNAIQNTVNLRERCYFAAHPNPPMLPNFSTQ
DPO3A_RICPR     DVLLCISEGVTKEYPDRKTVSENCYFKSPAEMRKLFSDLPNAIQNTINLRERCYFAAHPNPPMLPNFSTQ
DPO3A_RICBR     DVLLCISAGVTKEYPDRKTVSENCYFKSAKEMIELFADLPSAIENTVNLTQRCYFAAHTNPPMLPNFATK
DPO3A_CAUCR     DALLCISDGAFVGQDERRRVTPEHWFKPAEEMRKLFADLPEACDNTLDIARRCAFMVHKRDPILPSFPTD
DPO3A_CAUCN     DALLCISDGAFVGQDERRRVTPEHWFKPAEEMRKLFADLPEACDNTLDIARRCAFMVHKRDPILPSFPTD
DPO3A_BORBU     DIIVCIGTGAKKSDENRLKMETNFYIKSQEEMCELFNDLPEALENTVRIAEKCDFKITFPGPILPDYQIP
DPO3A_ECO57     EIRVAIHDGFTLDDPKRRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQFPTG
DPO3A_ECOLI     EIRVAIHDGFTLDDPKRRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQFPTG
DPO3A_ECOL6     EIRVAIHDGFTLDDPKRRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQFPTG
DPO3A_PSEFL     ETRVCIGEGRALDDPRRKNYSDQQYLKSAEEMAELFSDLPDAIENTVEIAKRCNIDVKLGKHFLPDYPID
DPO3A_HAEIN     EIRVAIHDGYTLDDPKRKCYTSQQYFRSEEDMCKLFADIPSALENTLLIAQRCSVTLRLGQYFLPQFPTG
DPO3A_TREPA     DILLCIGTKKNRSDPNRKFKTDEFYLKSSEKMAQLFPHYPEMVLNTVRIAQRCNVRIPQPGPLLPLYQIE
DPO3A_VIBCH     EIRVAIHDGYTLEDPRRKNYSPKQYLRSEAEMCELFADIPEALANSVEIAKRCNVTVRLGEYFLPNFPTG
DPO3A_SALTY     EIRVAIHDGFTLDDPKRRNYSPQQYMRSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEYFLPQFPTG
DPO3A_BUCAI     KIRIAINEGEILQHSKQNNYSNQQFLKTTEEMSDLFSDIPEALINSVEIAKRCNVFIHSGKYFLPQFRTG
DPO3A_PSEAE     ETRVCIGEGRTLDDPRRRTYSDQQYLKSPAEMAELFSDLPEALENTVEIAKRCNIEVQLGKYFLPDFPTP
DPO3A_PASMU     EIRVAIHDSYTLDDPKRKLYTNQQYFRSEQEMCDLFADVPSALENTLLIAQRCNVTIRLGEYFLPQFPTG
DPO3A_NEIMB     EARVCIAGGVLTDKKRPRDFTPGQFFIPPETMAERFADLPEALENTVEIAKRCNLHITLGKNFLPLFPTD
DPO3A_CAMJE     EVFMCIAMGKKLNDPDRMRHSHEFYVKSPEQMSELFADIPEAIENTQEIAQKCNLELNLGNPTPPNFKDH
DPO3A_THEAQ     EVLLAIQSKTTLDDPERRFPCDEFYVKTPEEMRAMLPEAEEPFDNTVEIARMCDVDLPIGDKMIPRFPLE
DPO3A_NEIMA     EARVCIAGGVLTDKKRPRDFTPSQFFIPPETMAERFSDLPEALENTVEIAKRCNLHITLGKNFLPLFPTD
DPO3A_BUCAP     KIRIAINEGVRKESKIQNNYSKHQFLKTEKEMCFLFSDIPEAIINSVEISKRCNVFIKSGQYFLPQFNTR
DPO3A_XYLFT     EARVCIASGRMLDDPKRRTYSEQQYLRSSEEMAALFADIPDALDNTRTLAQRCNIEMRLGTYFLPNYPVP
DPO3A_HELPY     EVAMCVAMGKTLNDKGRKHSVHEFYIKSPEEMAKLFADIPEALENTQEIADKCVLEIDLNPPTPPSFKTK
DPO3A_HELPJ     EVAMCVAMGKTLNDKGRKHSVHEFYIKSPEEMAKLFADIPEALENTQEIADKCVLEIDLNPPTPPSFKTK
DPO3A_XYLFA     EARVCIASGRMLDDPKRRTYSEQQYLRSSEEMAALFTDIPDALDNTRTLAQRCNIEMRLGTYFLPNYPVP
DPO3A_BUCBP     KIRVFINLGCTKSNSAHYNYTPQQFMRTSNEMEELFLDFPDAISNTIEISKRCNVILKFNKYFLPKFQTG
DPO3A_BACSU     RCLKAIKAG-EKLTXXXXXXXXXXXXXXXXXMQNIYREHPEALQASVEIAEQCRVDVSLGQTRLPSFPTD
DPO3A_BACHD     KVIQAIREGVLVEELRIEQEEDVCFFTLT-EMEQTFRAYPEALQNTKKLADRCHVELTLGKPRLPKFQTP
DPO3A_AQUAE     TVLMALQMKKTIHELSSKCSNEDLHFAPPEYMXXXXXXXXXALLNTLEVMEKT-----ADSFEIFENSTY
DPO3A_CHLTR     EILLNVQSAKQNTYIPRKTYSREFYFKSPQEIAELFAAHPETITNTCIVAERCHLELDFETKHYPIYVPE
DPO3A_CHLPN     EILLNVQSGETVRIAKQNTHSREYYFKSPAQMAELFKDIPEVISNTLEVAKRCDFTFDFSKKHYPIYVPE
DPO3A_CHLMU     EILLNVQSAKQNTYVPRKTYSREFYFKSPQEMAELFADHPETISNTLIVADRCNFVTKHYPIYVPEDLQK
DPO3A_STRCO     DALLCIQTGKNLSDPDRRFDGTGYYLKSTDEMY--------AIDSSDAWQEGC-----ANTRLIAEMTTG
DPO3A_DEIRA     ETLLAIQTKATLADENRKFPCDEFYVKNLEEMVSEWGEEP--FDNTAHIAELC-----------------
DPO3A_MYCTU     EALLCVQTGKTLSDPNRKFDGDGYYLKSAAEMRQIWDDVPGACDSTLLIAERVQSYADVWTPRMPVFPVD
DPO3A_MYCBO     EALLCVQTGKTLSDPNRKFDGDGYYLKSAAEMRQIWDDVPGACDSTLLIAERVQSYADVWTPRMPVFPVD
DPO3A_STAAW     SALAAIRDN-TKLDLIHDQEDFGAHFLTEKEINQLDINQEYLTQVDV-IAQKCDAELKYHQSLLPQYETP
DPO3A_STAAS     SALAAIRDN-TKLDLIHDQEDFGAHFLTEKEINQLDINQEYLTQVDV-IAQKCDAELKYHQSLLPQYETP
DPO3A_STAAR     DTISALAAIRDNTKLDLIHDQEDAHFLTENEIHQLDVN-PEYFTQADRIAQKCNAELKYHQSLLPQYQTP
DPO3A_STAA8     SALAAIRDN-TKLDLIHDQEDFGAHFLTEKEINQLDINQEYLTQVDV-IAQKCDAELKYHQSLLPQYETP
DPO3A_STAAC     SALAAIRDN-TKLDLIHDQEDFGAHFLTEKEINQLDINQEYLTQVDV-IAQKCDAELKYHQSLLPQYETP
DPO3A_SYNY3     DALLCIQTGITEEKRLRYSGTE--YLKSAEEMHLLFRDIETAIANTLEVADKVEAYSILGEPRIPHYPIP
DPO3A_STAES     -------------------------FPSIEELLNLSEDM---ITNANEIEELCQAEIAYHQSLLPQFVTP
DPO3A_STAAN     SALAAIRDNAKLDLIHDQE-DFGAHFLTEKEIKQLDINQEYLTQVDV-IAQKCNAELKYHQSLLPQYQTP
DPO3A_STAAM     SALAAIRDNAKLDLIHDQE-DFGAHFLTEKEIKQLDINQEYLTQVDV-IAQKCNAELKYHQSLLPQYQTP
DPO3A_STAEQ     -------------------------FPSIEELLNLSEDM---ITNANEIEELCQAEIAYHQSLLPQFVTP
DPO3A_MYCLE     EALLCVQTGKTLSDPNRKFHGDGYYLKSAAEMRQLWDDVPGACDSTLLIAERVQSYADVWEPRMPVFPVP
DPO3A_STRP8     ---------MLHAIRDNLSLAETPVVESDQELADCQTHCPQALQNLEDLVSGIYYDFDTNLK-LPHFNRD
DPO3A_STRP6     ---------MLHAIRDNLSLAETPVVESDQELADCQTHCPQALQNLEDLVSGIYYDFDTNLK-LPHFNRD
DPO3A_STRP3     ---------MLHAIRDNLSLAETPVVESDQELTDCQTHCPQALQNLEDLVSGIYYDFDTNLK-LPHFNRD
DPO3A_STRP1     ---------MLHAIRDNLSLAETPVVESDQELADCQTHCPQALQNLEDLVSGIYYDFDTNLK-LPHFNRD
DPO3A_STRPY     ---------MLHAIRDNLSLAETPVVESDQELADCQTHCPQALQNLEDLVSGIYYDFDTNLK-LPHFNRD
DPO3A_LACLA     ---LTISSN---ELLQRPEAYETYFLKY----------FPQALKNLSALTAKIAYQFDEKLE-LPRFDKK
DPO3A_MYCGE     -----------QPFLDQKTAQ------------QLFSE--TELNNLNDLVNRC------------ELDLE
DPO3A_UREPA     ---------------------------------------------------------HDLPINIPVYDKQ
DNAE2_AGRVS     DIVTCIRNNTTIDTVERERHADR-YLKPPEEMERLFPRYRQALRRTMEIVDRCKFS-------LEELTYQ
DNAE2_RHOBA     DCVVAISQGKSVEQIQSRLVNSQHHLRSLEEIAELYRDVPDAVARTIEVAQRCTFTLDQLKYEYPELAPE
DPO3A_MYCPN     ----------------------------------------------------------------------
DNE23_AGRT5     DIVTCIRTRTTIDEVERERHADR-YLKPPEEMERLFPRYRQALARTMEIVRRCTFS-------LEELTYQ
DNE22_AGRT5     DIVTCIRHNTTIDDVERERHADR-YLKPPEEMERLFSRYSEALARTLEIVRRCKFS-------LEELTYQ
DNE22_RHIME     DVVTCIRTGMTIDDVERERHADR-YLKPPEEMARLFPAYPEALARTMEIVERCRFS-------LEELVYQ
DNAE2_SYMTH     DLLTCVR---TLTRIDQRPLNDQRYLKPPEVMIERFREFPEAVKNTLAIAERCRPVLDLDARLHPEFQTP
DNAE2_PROAC     CALSAVRARRSLDEMDGLPPGPVARLRSGAEMADLFSRHRDAVDNTVAVAERTAFHLKSVRPRLPDKVPD
DNAE2_MYCTU     XXXXXXXXXXSLDSAAGWLAPGGAHLRSGEEMARLFAWCPEAVTAAAELGERCAFGLQLIAPRLPPFVPD
DNAE2_MYCBO     XXXXXXXXXXSLDSAAGWLAPGGAHLRSGEEMARLFAWCPEAVTAAAELGERCAFGLQLIAPRLPPFVPD
DNE21_RHIME     DVVTSIREHVPAGFLLQKNAER--HLKGPREMARLFSDYPEAIANTRKFFRELAFSLDELSHQYPDENAD
DNE21_AGRT5     DVVTCIRHNCTIDEAGRRERHADRYMKPPEEMHRLFARYPEALSRSLEIAKRCKFS-------LKELVYQ
DNAE2_MYCPA     -LAMAMGAIRARESLDSAAPLGGSHLRSGAEMARLFAWRPQAVTAAAELGEQCAFGLALIAPRLPPFVPD
DNAE2_SINMW     DVVTAIREHVPVAFLLQKNAER--HLKSPREMARLFSDYPEAIANTQKFFRHLAFSLDELRHQYPDENAG
DNAE2_IDILO     DILNAIQHGGSLAH--QPGLASNNAEHHLRSLSELQQCYPQKLAETLVIAQQCQFCLSELRYEYPELVPE
DNAE2_DECAR     DVLTALRL--------KSTVFEAGYALFPNGERHXXXXXPELLAETLNIAARCEFLLDELRYEYPEIIPS
DNAE2_RHISN     DVVTAIREHVSAGFLLQKNAER--HLKGPKEMVRLFRDYPEAIVNANKFFKRLSFSLDELSHQYPDENAE
DNAE2_BDEBA     DVLTCTLHHTTLAEAKNKLISERC-LKSLEDISWLWQDRLDLVEKTVEISARVTFSLNEIRYRYPSSLPS
DNAE2_PSEF5     DTMTAIRHHLPVAEAGQRLFANGERHLRPVEVLQGL--YPQALDESLAIAGRCAFDLGQLRYQYPR----
DPO3A_YERPE     DIAHMVTNNIKIDQPHRLRIPDNAVNGRRHEALKAFSDVPSTTQDTII--EACTWRWHELPPALPKMADD
DNAE2_TERTT     DVLTAINHNTSVSQLGTRLQSEN-YLKAIDEVFYLYP--PGLIKQTLLIAERCNFSLNELKYQYPQ----
DNAE2_BRASO     DVLTCIREKASIESIGRRLANAERHLKPGHEMARLFRDHPEAIAETLRFTDRIVFSLYPDEPVPPGKTAQ
DNAE2_SACD2     DILTAIRENTPIQQLGTRLHSNEVNLKPLHELNQLYPE--ALIQQTQVIAQLCNFSLDELRYQYPKLVPS
DNAE2_PSEPF     DTMTAIRHHVVAEAGLRLHPNGERHLRSLDVLRELYPQ--TLLDESLKLARRCTFDLGELRYQYPK----
DNAE2_SILPO     DVLTCMREHITIDRIGTRALNAERRLKGHADMARLFRDHPAALRRTLDIAARCSFCLSELSYEYPDEVAE
DNAE2_BRUSU     DVLTATRHHTTV-FAAGRLLEKNAHLKPPHEMVRLFRDYPEAIAATADFVAPITFQAYPDEPIPPG-KTA
DNAE2_BRUME     DVLTATRHHTTV-FAAGRLLEKNAHLKPPHEMVRLFRDYPEAIAATADFVAPITFQAYPDEPIPPG-KTA
DNAE2_BRUAB     DVLTATRHHTTV-FAAGRLLEKNAHLKPPHEMVRLFRDYPEAIAATADFVAPITFQAYPDEPIPPG-KTA
DNAE2_PSE14     DTMTAIRHHTTVAEAGHLLFANGERHLRPLDALEHYPDW--LLAESVRIARRCTFDLKQLKYEYPHLVPK
DNAE2_PSEU2     DTMTAIRHHTTVAEAGHLLFANGERHLRPLDALEHYPDW--LLAESVRIARRCTFDLGDLKYEYPHLVPK
DNAE2_CORGL     SELHPM--GTT-------------WMRSGDTLLKAHPDYADLIATTVELAAECAFTLDLVAPNLPKWDTP
DNAE2_RHILO     DVLTAINTPVAEVGLELSANAER-HLKPPLEMARLFRRHPQALAETLRFAEELTFSLSDLQYNYPDEPTE
DNAE2_CAUCR     DVISCVREHCAQEAGFRLEANAERHIKSPEEMARLFDRWPRAVERTVEIVERIGFD-------LKDIREQ
DNAE2_CAUCN     DVISCVREHCAQEAGFRLEANAERHIKSPEEMARLFDRWPRAVERTVEIVERIGFD-------LKDIREQ
DNAE2_RHOPS     DVLSCVREKTTIDKIGRRLANAERHLKPAAEMARLFRADPDAIAETLRFAAGISFTLYPDEPVPPGKTAQ
DNAE2_RHOP2     DVLTCVRDKTTIDKAGRRLEGNERHLKPAAEMARLFRADLDAVAETLRFADRISFTLYPDEPVPPGKTAQ
DNAE2_CORJK     PTTHPVGGS---------------WLRSGEEMLQLAGDLARAVETSVQVAEECAFTLDLVAPNLPHFPVE
DNAE2_VIBPA     HILTAIKHGCSVDQLGFERLSNAERALRPNKLVRIYK--PEWLEESKYIADLCEFKLSDLKYEYP-----
DNAE2_CORDI     ---------------------------------------------SVEVARDCAFALDLVAPNLPRWPVE
DNAE2_ALHEH     DTL---SALRHRRTLAAMGTALECSGEXXXXXXXXXXXXXXXXXXSVHLADQCRFS-------LDKLRYE
DNAE2_PSEPK     ----------------------------------------------------------------------
DNAE2_PSESM     DTITAIRHHTTVAEAGHLLFANGRHLRSLDALAEHYPDW--LLAESLRIARRCTFTFDQLQYEYPHLVPK
DNAE2_COREF     AKCXXXXXXXXXXXXXXXHPMGGTWLRSGGALARAYPQCGDLLATTVEIASGCAFTFDLVAPELPRWDTE
DNAE2_RHOP5     DVLTCVRDKTTIDKAGRLLESNERYLKPTEEMARLFRADPDAIAETLRFADRISFTLDELKYQYPDEPVP
DNAE2_METCA     DTLTAIRLGRPLAELGYALFPNGERHLRPIEFLARI--YPRALEESLRIAERCRFSLDELRYEYPELVPD
DNAE2_ANADE     DVLTCVRHGTTVDRAGRRLFNAERTLKGPEELARLWSDFPEGLAAAADIADQCRFGEHPLPPVV------
DNAE2_RHOPA     DVLTCVREKTSIDKAGRRLEGNERHLKPAAEMARLFRHDPEAIAETLRFADRISFTLHYPDEPVPPGKTA
DNAE2_BRAJA     DVLTCIREKTTIEAVGRKLANAERFLKTPREMSRLFRDFPDAIAETMRFANKIDFSLYPDEPVPPGKTAQ
DNAE2_NOCFA     XXXXXXXXXXSDEMAGWLAPAGGAHLRSGAEMARLFXXXXXXXXXXXXLSRECAFDLRLIAPQLPPFAVD
DNAE2_ANAD2     DVLTCVRHGTTVDRAGRRLFNAERTLKGPEELARLWSDFPEGLAAAADIADQCRFGEHPLPPVV------
DNAE2_HAHCH     DALTAIRFNQSVDSIDRLAPNAENYLRPLNEIHEIYPSF--TIQESLRIAAKCAFELNEIRYQYPK---E
DNAE2_ANASK     DVLTCVRHGTTVDRAGRRLFNAERTLKGPEELARLWSDFPEGLAAAADIADQCRFRMEA-----------
DNAE2_PSEA7     ----------------------------------------------------------------------
DNAE2_PSEAE     DCMTAIR--------NHLPVSEAGAYLFPNRTLEALQGIPQALAETLKIAERCRFDLEQLKYQYPR----
DNAE2_BURPS     ----------------------------------------------------------------------
DNAE2_BURMA     ----------------------------------------------------------------------
DNAE2_VIBVU     HTLTAIRHGCTVEQLGTQLLTNEQSLRSEKKLRKLFK--PQWLAESLYIASLCSFDLDSPSELIPDGYTP
DPO3A_THEMA     ----------------------------------------------------------------------
DNAE2_VIBVY     HTLTAIRHGCTVEQLGTQLLTNEQSLRSEKKLRKLFK--PQWLAESLYIASLCSFDLDSPSELIPDGYTP
DNAE2_VIBHB     HVLTAVKHGCSVDKLGFSRLSNAERALRPNKLSRIYKS--KWLEESTHIADLCEFKLEYPTELIPNGYTP
DNAE2_RALSO     DVLTAISRPIAECGLALAPSAEQA-MRTRMQLAFFYQGERGALRRSVELASLCDFS-------LDEIAYE
DNAE2_GLUOX     -------------------------------------------------------------PLIPG--RF
DNAE2_AZOSE     ----------------------------------------------------------------------
DNAE2_XANCP     ----------------------------------------------------------------------
DNAE2_XANC8     ----------------------------------------------------------------------
DNAE2_XANAC     DTLTAIRHTLPLAECGAHLFRNGRHLRTRRALGNIYPD--ALLQATVELAQRCTFDISKISYTYPRLVPE
DNAE2_RALPJ     DVLTAISKPLSECGLELAPSAEQA-MRTRMQLAFLYQGEEKILRRTVELAALCNFSLDEIEYEYPSVVPE
DNAE2_XANCB     ----------------------------------------------------------------------
DNAE2_XANOR     ----------------------------------------------------------------------
DNAE2_XANOP     ----------------------------------------------------------------------
DNAE2_BORPA     DTLAAIRTGRSVGQCGYD-LAANAEXXXXXXXXXXXXYPAQALAQTLAIARRCTFSLDELQYEYPDIVPA
DNAE2_AZOSB     ----------------------------------------------------------------------
DNAE2_PSEMY     ----------------------------------------------------------------------
DNAE2_XANC5     ----------------------------------------------------------------------
DNAE2_BORBR     DTLAAIRTGRSVGQCGYD-LAANAEXXXXXXXXXXXXYPAQALAQTLAIARRCTFSLDELQYEYPDIVPA
YORL_BACSU      QAFLNAKDG------EREVDSEACFVQNVDEIHERMDYIDKAIKNTMLIGEMIEDYTIEHEPILPNFKLR
DPO3_STAES      KILIASQPG---NPLNRSTLPE-AHFRTTDEMLDDFHFLGE---------EKAYEIVVTNTNELANKIEK
DPO3_STAEQ      KILIASQPG---NPLNRSTLPE-AHFRTTDEMLDDFHFLGE---------EKAYEIVVTNTNELANKIEK
DPO3_LACS1      KILIHSQAGANP--LNRLKKLPDAHFRTTDEMLEEFSFLGEDIAKEI-----------------------
DPO3_PEDPA      KILINSQGGANP--LNRSELPD-VHFRTTDEMLEDFSFLGPEVAHKIVVE---------NSNKIADSVDD
DPO3_BACCR      KILVSSQGGANP--LNRHSLPP-VHFRTTDEMLECFSFLDKAKEVVVTNTQKIASLIGDVHPVKDDLYTP
DPO3_STRT1      EIIVMINRPIGKEENAQPAPLPEAHFRTTNEMLDEFAFLG---------KDLAYEIVVANTQAMAN----
DPO3_STRTD      EIIVMINRPIGKGENAQPAPLPEAHFRTTNEMLDEFAFLG---------KDLAYEIVVANTQAMAN----
DPO3_STRT2      EIIVMINRPIGKGENAQPAPLPEAHFRTTNEMLDEFAFLG---------KDLAYEIVVANTQAMAN----
DPO3_LACRD      YRKILINSQGGANPLNR-TERPEVHFRTTDEMLNEFAFLGEEKAHELVVENSNKIAAEIDDNIRP--VKD
DPO3_MYCGE      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3_BACSU      KILISSQGGANP--LNRHELPK-VHFRTTDEMLEAFSFLEKAKEIVVTNTQKVASLVDDIKPIKDDLYTP
DPO3_STRMU      EIIVMINRPIGRGENAQPAPLPKAHFRTTNEMLDEFAFLGEDLARDIVIKN-------------PNEMVE
PPAC_METJA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NISETDLIKKDAKEGLLARLATKFKSENIALENQEALKTEYFARLNYELDIICNMNFAGYFLIVSDFIKW
DPO3A_RICCN     NISETDLIKKDAKEGLLARLATKFKSENIALENQEALKTEYFARLNYELDIICNMNFAGYFLIVSDFIKW
DPO3A_RICFE     DISETDLIRKDAKEGLLARLATKFKSENIPLQNQEELKTEYFARLNYELDIICNMNFAGYFLIVSDFIKW
DPO3A_RICTY     DISETYLIRKYAKEGLLARLVTKFKAENISREHQEKLKTEYFTRLNYELDIICNMNFAGYFLIVSDFIKW
DPO3A_RICPR     DISETYLIRKYATEGLLARLVTKFKAENISLEHQEKLKTEYFTRLNYELDIICNMNFAGYFLIVSDFIKW
DPO3A_RICBR     DISETDLIRKEAKDGLLARLDTKFKSEHISIEHQESIKTEYFARLDYELNIICSMNFAGYFLIVSDFIKW
DPO3A_CAUCR     GRNEAEELEHQAREGLKMRL------EGLTLSAPEE---EYWKRLDFELGIIKKMGFPGYFLIVSDFIKW
DPO3A_CAUCN     GRNEAEELEHQAREGLKMRL------EGLTLSAPEE---EYWKRLDFELGIIKKMGFPGYFLIVSDFIKW
DPO3A_BORBU     VEFNTEYLEHLTLEGL------KFRYKNLTSKIKD--------RAFYELSVIIGMGFEGYFLIVWDFIKF
DPO3A_ECO57     DMSTEDYLVKRAKEGLEERLAFLFPDE----EERVKRRPEYDERLETELQVINQMGFPGYFLIVMEFIQW
DPO3A_ECOLI     DMSTEDYLVKRAKEGLEERLAFLFPDEEERLKR----RPEYDERLETELQVINQMGFPGYFLIVMEFIQW
DPO3A_ECOL6     DMSTEDYLVKRAKEGLEERLAFLFPDEEERLKR----RPEYDERLDTELQVINQMGFPGYFLIVMEFIQW
DPO3A_PSEFL     GMTIDEYFRKVSFDGLEERLSVLLPKDTT--EDYEAKRQVYVDRLNFELDIIIQMGFPGYFLIVMDFIQW
DPO3A_HAEIN     DLSTEDFLVQKSKEGLEERLVFLFPDEKVRLEK----RPKYDERLQVELDVINQMGFPGYFLIVMEFIQW
DPO3A_TREPA     FSSKEHYIRHLVHRGLYDRYAV--------------VSEEIKARADYELDVIVRMDFVGYFLIVWDFITW
DPO3A_VIBCH     GMAIEDFLVMKSXXXXXXXXXXXXPDPEVRAKR----RPEYDERLQVELDVINQMGFPGYFLIVMEFIQW
DPO3A_SALTY     DMTTEDYLVKKAKEGLEERLAFLFXXXXXXXXXXXXXXXX----LDIELQVINQMGFPGYFLIVMEFIQW
DPO3A_BUCAI     KISVEKYLIKEAYKGIKKRLNSRY----LDIEKYKDIYSQYINRLDMELTVINKMGFPGYFLIVMEFIQW
DPO3A_PSEAE     NMGIDDYLRHASFEGLEERLEVLLPKDT---PDYEAKRQVYVDRLNFELDIIIQMGFPGYFLIVMDFIKW
DPO3A_PASMU     DLSTEDFLVKKSKEGLEERLKFLFPDEKV----RQARRPEYDERLQVELDVINQMGFPGYFLIVMEFIQW
DPO3A_NEIMB     GLSLDDYLIKLSNEGLQERMVQLYPDE----AERAAKMPEYQERLDFELNIIIQMKFPGYFLIVQDFINW
DPO3A_CAMJE     NIEETKEFSFDNDDMVFEELCKKGLEERLKFID-ESKHEEYKQRLEVEINIIKNMKFSGYMLIVHDFIKV
DPO3A_THEAQ     GRTEAQYLRELTFLGLLRRITEAFYREVLRLLGREWTAEAILHRALYELSVIERMGFPGYFLIVQDYINW
DPO3A_NEIMA     GLSLDDYLVKLSNEGLQERMVQLYPDE----AERAAKMPEYQERLDFELNIIIQMKFPGYFLIVQDFINW
DPO3A_BUCAP     KISIENYLIQKSNKGLKKRLESNFKKVD------KEIFLKYKNRLDTELGIINKMGFPSYFLIVMEFIQW
DPO3A_XYLFT     NDETLDSIRKQSHEGLEARLLKHPLAPGQTRE-------DYVTRLEFELDTIIKMGFSGYFLIVADFIQW
DPO3A_HELPY     AYAQNEGLNFEDDASYFAYKAREGLKERLVLVPKEK-HDQYKERLEKEIEVITNMKFPGYMLIVWDFIRY
DPO3A_HELPJ     AYAQNEGLSFEDDASYFAHKAREGLRERLILVPEEKHE-QYKERLEKEIEVITNMKFPGYMLIVWDFIRY
DPO3A_XYLFA     NDETLDSIRKQSHEGLEARLLKHPLAPGQTRE-------DYVTRLEFELDTIIKMGFSGYFLIVADFIQW
DPO3A_BUCBP     NMNTTDFLVMKAKKGMQKRLIQLFPNKQDRINNVN----RYYTRLLSELNVINKMGFPGYFLIVMEFINW
DPO3A_BACSU     GTSADDYLTDICMEGLRSRFGKPDE--------------RYLRRLQYELDVIKRMKFSDYFLIVWDFMKH
DPO3A_BACHD     NESAEDYLRKLCEQGAKERYGEEWTKEKAQ-------------RLGEELAVIERMGFSDYFLIVWDFMRF
DPO3A_AQUAE     LLPKYDVPPDKTLEEYLRELAYKGLRQRI--ERGQAKDTEYWERLEYELEVINKMGFAGYFLIVQDFINW
DPO3A_CHLTR     ELCEQGLTSKYTPE-LLGHIAKKFPGEDPLTLVKE--------RLKLESSIIISKGMCDYLLIVWDIINW
DPO3A_CHLPN     SLSYTEEDRYQASAVFLKQLAEKYSSEVLAHIAKKFPHRDPIERMDMEMAIIIPKGMCDYLLIVWDIIHW
DPO3A_CHLMU     KGSYSEEERYNASSAFLEQLCTKYTPELLGHIAQKFPEKDPLTRLSLESTIIISKGMCDYLLIVWDIINW
DPO3A_STRCO     MFEKRDLMPKDIPEGFTE--ITWFQEEGMERRFPGGVPEDRQKQAEYEMDVIIQMGFPGYFLVVADFIMW
DPO3A_DEIRA     -------------------------------------------RAEYELSVINNMGFPDYFLIVADYINW
DPO3A_MYCTU     GHDQASWLRHEVDAGLRRRFPA-------------GPPDGYRERAAYEIDVICSKGFPSYFLIVADLISY
DPO3A_MYCBO     GHDQASWLRHEVDAGLRRRFPA-------------GPPDGYRERAAYEIDVICSKGFPSYFLIVADLISY
DPO3A_STAAW     N-------DESAKKYLWRVLVTQLKKLELNYD-------VYLERLKYEYKVITNMGFEDYFLIVSDLIHY
DPO3A_STAAS     N-------DESAKKYLWRVLVTQLKKLELNYD-------VYLERLKYEYKVITNMGFEDYFLIVSDLIHY
DPO3A_STAAR     N-------DESAKKYLWRVLVTQLKKLELNYD-------VYLERLKYEYKVITNMGFEDYFLIVSDLIHY
DPO3A_STAA8     N-------DESAKKYLWRVLVTQLKKLELNYD-------VYLERLKYEYKVITNMGFEDYFLIVSDLIHY
DPO3A_STAAC     N-------DESAKKYLWRVLVTQLKKLELNYD-------VYLERLKYEYKVITNMGFEDYFLIVSDLIHY
DPO3A_SYNY3     NHTPETYVEDIAWDGLLERLKCRERAD---------ITPVYKERLEYELRMLEKMGFCTYFLVVWDYIKY
DPO3A_STAES     N-GET------SKDYLWTILIHR-------LREWELNDKTYFNRLKHEYKIITDMGFEDYFLIVSDLIHF
DPO3A_STAAN     N-------DESAKKYLWRVLVTQLKKLELNYD-------VYLERLKYEYKVITNMGFEDYFLIVSDLIHY
DPO3A_STAAM     N-------DESAKKYLWRVLVTQLKKLELNYD-------VYLERLKYEYKVITNMGFEDYFLIVSDLIHY
DPO3A_STAEQ     N-GET------SKDYLWTILIHR-------LREWELNDKTYFNRLKHEYKIITDMGFEDYFLIVSDLIHF
DPO3A_MYCLE     GHDQASWLRHEVDAGLKRRFP-------------DGPPNGYVERAAYEIDVICDKGFPAYFLIVADLVNH
DPO3A_STRP8     KSAKQEL--QDLTEA--------------GLKEKGLWKEPYQSRLLHELVIISDMGFDDYFLIVWDLLRF
DPO3A_STRP6     ---------KSAKQELQELTEAGLKEKGL-------WKEPYQSRLLHELIIISDMGFDDYFLIVWDLLRF
DPO3A_STRP3     ---------KSAKQELQELTEAGLKEKGL-------WKEPYQSRLLHELVIISDMGFDDYFLIVWDLLRF
DPO3A_STRP1     KSAKQEL--QDLTEA--------------GLKEKGLWKEPYQSRLLHELVIISDMGFDDYFLIVWDLLRF
DPO3A_STRPY     KSAKQEL--QDLTEA--------------GLKEKGLWKEPYQSRLLHELVIISDMGFDDYFLIVWDLLRF
DPO3A_LACLA     R-QAVEHLREEATLGLSARLEEKNLLTEVSSVNLQDLSV-YQERLEKELSVIHQMGFDDYFLIVADLLRY
DPO3A_MYCGE     HLKAASLSLTDNDAAVLESLC-QTNLKQFLDKNQDLNKKAYQLRLEKELNVINKLNFASYFLVVNDLVNY
DPO3A_UREPA     NIISSEILKQLCISGLKKRLNA----------NDGQVNKIYVQRLKYELDVINEKQFDDYFLIVYDFINF
DNAE2_AGRVS     YPEEAIVPRKTAQESL-----EHYVWQCVPDRYPQGLPPKTLQIIRHELDLIHKMKYAPYFLTVFSIVRF
DNAE2_RHOBA     GMTPIEHLKRLTWEGARGRWPN-------------GVPEKVIETLRHEVTLIEDLQYEAYFLTVWDLVRF
DPO3A_MYCPN     --SQWDLTKLKASSLQVSHNDAQMLSEQCQLALTEFLKLNYEERLAKELEIINSLHFASYFLVVSDLVQF
DNE23_AGRT5     YPEEAIVPGKDAQASL-----EHYVWQCVPDRYPEGLPPDVLKVVRHELDLIRTMKYAPYFLTVFSIVRY
DNE22_AGRT5     YPEEAIVPGKDAQASL-----EHYVWECAPDRYPEGLPQDVLKTVRHELDLIRTMKYAPYFLTVFSIVRF
DNE22_RHIME     YPEEALILGMTAQQSL-----QHYTWEGVRARYPEGLPTHVEKTIRHELALIETMKYAPYFLTVFSIVRY
DNAE2_SYMTH     DGSHTHLVYDGA--------AXXXXXXXXXXXXXXXXXXXXXTRLGYE----------DYFLLVWDVVRF
DNAE2_PROAC     GHTPISWLRHLVEEGRRA----CYGDDPVAKD-----------RLATELDLIEDRGFAGYFLIVSDIVEF
DNAE2_MYCTU     GHTEDSWLRSLVMAGARERYGPPKSAPRA------------YSQIEHELKVIAQLRFPGYFLVVHDITRF
DNAE2_MYCBO     GHTEDSWLRSLVMAGARERYGPPKSAPRA------------YSQIEHELKVIAQLRFPGYFLVVHDITRF
DNE21_RHIME     GETPAESLRRLVAEGAAERYP-------------EGVPEKVMRQIDYELELIHDKKYEPYFLTVHKLVKF
DNE21_AGRT5     YPEERSLPGLTAQQAL-----EKMVWEAVPGRYPNGLPEKVEKALHHELDVVGRLQYASYFLTVNAIVRY
DNAE2_MYCPA     GHTEDSWLRQLTMTGARDRYGSPEHAPRA------------YAQIEHELKVIAQLQFPGYFLVVHDIARF
DNAE2_SINMW     GETPAESLRRLVSEGAAERYP-------------EGVPEKVQRQIEYELELINDKKYEPYFLTVHKLVKF
DNAE2_IDILO     GMSASGYLKQLTEQGARWRYPQGVP---------ESIKALYLK----ELSLIKEQSYEPFFLTIHDLVRF
DNAE2_DECAR     GETPASWLRSETERGLQRRYPA-------------GVPGSVRERIEHELGLIAEMAYEAYFLTVYDIVCY
DNAE2_RHISN     GETPAESLRRLVAEGALERYPS-------------GVPEKVTRQIEYELELIHDKKYEPYFLTVHKLVKF
DNAE2_BDEBA     GMTPTEYMRHLTLKGAESRYP-------------EGIPDKALKQIEHELELIKDLQYEDYFLTLKEICDF
DNAE2_PSEF5     -----ELVPEGHDAGSWLRVLTQ---RGIVRRWPTGARAEVLKQIDKELTLICDLGYESYFLTVHDIVDF
DPO3A_YERPE     ---EPATLMKLAVAGLRKRLTTKFGYTPPASEHRV-----YVDRLKYEMDTLTRLGFCGYFLMVRDLMNH
DNAE2_TERTT     -----ELVPKGLSP--IAHLRALVDSGK-ARRWPGGVPAQXXXXXXXXXXXXXXXHYEYYFLTVYDIVAF
DNAE2_BRASO     GHLE-DLTWAGAKTYFGDKLDDRLR-----------------AVLNKELALIAELNYAHYFLTVHDIVRY
DNAE2_SACD2     NTTPIAHLKKLVKEGEAKRWGTPEHAQKI---------------IAMELGLIEEMQYEYYFLTVHDIVHF
DNAE2_PSEPF     -----ELVPEEHSASSWLRHLTE---QGIAWRWPKGAQPKVLKQIDDELELIAELGYESYFLTVHDVVRF
DNAE2_SILPO     GETPQARLERLTAEGIVRRYAPQRVHELVAKE----------------LKLVAELGFPAYFLTVHDIVQF
DNAE2_BRUSU     QQHLYDLVWEGA--------ARHYGADIIPPKVQ--------GLINKELALIARLEYEPYFLTVYDIVTH
DNAE2_BRUME     QQHLYDLVWEGA--------ARHYGADMIPPKVQ--------GLINKELALIARLEYEPYFLTVYDIVTH
DNAE2_BRUAB     QQHLYDLVWEGA--------ARHYGADMIPPKVQ--------GLINKELALIARLEYEPYFLTVYDIVTH
DNAE2_PSE14     GQTPTSWLRELTERGARKRWPN-------------GLTPATRAQVEKELALITEKKFDSYFLTVHDIVEF
DNAE2_PSEU2     GQTSTSWLRELTERGVRRRWPG-------------GLTPATRAQVEKELALIAEKKFDSYFLTVHDIVEF
DNAE2_CORGL     G--------EHTEMSWLAHLVST-RIDTRYVGRSADIKARAATQIDYELGVIEKLGFPGYFLVVNDLVEF
DNAE2_RHILO     S-------------GLGPQXXXXXXXXXXXXXXYPSVPHSVIKXXXXXXXXXXXXNYARYFLTVYDIVKY
DNAE2_CAUCR     YPDEPVPPGKTAMQHL-----TDLTWKGAAWRYPNGVSPKVTAQIQEELRLIEKMDYPNYFITVHDIVRE
DNAE2_CAUCN     YPDEPVPPGKTAMQHL-----TDLTWKGAAWRYPNGVSPKVTAQIQEELRLIEKMDYPNYFITVHDIVRE
DNAE2_RHOPS     QHLE-DLTWEGVAEYFPAGISDKLH-----------------ATIDKELGIIAHRGYAQYFLTVHDIVRY
DNAE2_RHOP2     QHLE-DLTR-----------------EGIATYFPNGISDRLRATIAKELTLIAKRDYAHYFLTVHDIVRY
DNAE2_CORJK     GYTEMTWLRAITERGGAQRYGPRGSS---------AAANQAWATIDRELETIEQLGFPGYFLIVHDIVSF
DNAE2_VIBPA     ----TELIPNGYTPNSYLRMLVEQGKER---RFPEGVPEDINQTIENELRLIEDLKYHYYFLTIHDIVMF
DNAE2_CORDI     MAHLTGLVN--------ARFDARYRGRSEDVKNQAR------AQIHHELAVIKELGFPGYFLIVDDIVSF
DNAE2_ALHEH     YPAEL-VPAGETPASYLRRLTL----EGARRHWPQGMPDKVAHQVDHELALIAEMGYEPFFLTVHDVVAF
DNAE2_PSEPK     -----------------------------------------------ELGLIEELGYESYFLTVHDIVAF
DNAE2_PSESM     GQTSTSWLRELTERGIRRRWP-------------RGLSVAARAQVEKELALITEKKFDSYFLTVHDIVEF
DNAE2_COREF     MTWLTHLVE--------SRFDRRYRSRPAEVRERAR------AQIRHELGVIEQLGFPGYFLIVDDLVQF
DNAE2_RHOP5     PGKTAQQHLKDLTE------------QGIAEYFPNGIDAKLRATIDKELTIIAHRQYAPYFLTVHDIVRY
DNAE2_METCA     GYTAIAWLRELTRQGMAERWP-------------EGAPDKVRRQVEHELELIGAMAYEPFFLTVHDVVRF
DNAE2_ANADE     -------------------------------------------QLARELDLVESLGYASYFLTVWDVVRF
DNAE2_RHOPA     QAHLQDLTEQGIKQYFPNGISDRLR-----------------ATIAKELAIIERRGYAHYFLTVHDIVRY
DNAE2_BRAJA     GHLE-DLTWAGVDKYFAGKIDDKLRXXXXXXXXXXXXXXXXH-----------------YFLTVHDIVHY
DNAE2_NOCFA     GHDENSWLRELVLRGAARRYGPPHANPPA------------YRQLEHELEVIATLGFPGYFLVVHDIVSF
DNAE2_ANAD2     -------------------------------------------QLARELDLVESLGYASYFLTVWDVVRF
DNAE2_HAHCH     VVPEGD-----DPSAYLRRLTY----EGAHLRYPQGIPENVLATLEKELNIISELQYEYYFLTIFDIVDY
DNAE2_ANASK     -------------------------------------------QLARELELVESLGYASYFLTVWDVVRF
DNAE2_PSEA7     -------------------------------------------QIEKELKLISELGYESYFLTVQDIVGF
DNAE2_PSEAE     -----ELVPAGHDPASWLRHLTE---QGIARRWPNGASAKVRKQIERELELIAELGYESYFLTVQDIVAF
DNAE2_BURPS     -------------------------------------------RIEFELALIADLKYEPYFLTVYDIVKY
DNAE2_BURMA     -------------------------------------------RIEFELALIADLKYEPYFLTVYDIVKY
DNAE2_VIBVU     DSYLEHLVEQGKK-----------------LRFPEGVPDAIEQTIQKELALIKEQKYPFFFLTIHDIVMF
DPO3A_THEMA     ------------------RFPTPPKNWNLLIKKAEPLGEEYISRLKRELEVIKRKGFTPYIYTVEKVVEI
DNAE2_VIBVY     DSYLEHLVEQGKK-----------------LRFPEGVPDAIEQTIQKELALIKEQKYPFFFLTIHDIVMF
DNAE2_VIBHB     TSYLRMLVERGKK-----------------LRFPEGIPADIHQTXXXXXXXXXXXXYHYYFLTIHDIVMF
DNAE2_RALSO     YPHEVVPEGQTPAGYLLAEVMA-----GAARRYGKDIPSKVRAQLDEELALIAELRYEPFFLTVYDVVRF
DNAE2_GLUOX     NPTETERTGESAQETL-----TRLVQAALPRRYPAGAPPEVETQIAHELRLIGSLSYAPYFLTVNTIVRH
DNAE2_AZOSE     ------------------------------------------AQVEHELALIAELGFEAYFLTVEDLVRF
DNAE2_XANCP     ----------------------------------EGAPAQVVAQIDSELELIAYKGYEAFFLTVQDVVRF
DNAE2_XANC8     ----------------------------------EGAPAQVVAQIDSELELIAYKGYEAFFLTVQDVVRF
DNAE2_XANAC     GHTPTSYLRQLTEAGIRRRWPG-----GITAKVREDIEKE--------LALIALKKYEAFFLTVQDVVRF
DNAE2_RALPJ     GMTPAEYLRAETFAGAARRYPN-------------GVSEKVHAQXXXXXXXXXXXXXXPFFLTVYDVVKF
DNAE2_XANCB     ----------------------------------EGAPANVVAQIDSELELIAYKGYEAFFLTVQDVVRF
DNAE2_XANOR     -----------------------------------------------ELALIALKKYEAFFLTVQDVVRF
DNAE2_XANOP     -----------------------------------------------ELALIALKKYEAFFLTVQDVVRF
DNAE2_BORPA     GHTPASYLRQQTYLGARQRFP-------------EGMTPAVAAQVEKELALINELRYEAYFLTVYDIVGY
DNAE2_AZOSB     -----------------------------------------------ELALIIELGYEPFFLTVYDIVCF
DNAE2_PSEMY     ----------------------------------DGASTKVRTQVEHELQLITELKYESYFLTVHDIVSW
DNAE2_XANC5     -----------------------------------------------------------FFLTVQDVVRF
DNAE2_BORBR     GHTPASYLRQQTYLGARQRFP-------------EGMTPAVAAQVEKELALINELRYEAYFLTVYDIVGY
YORL_BACSU      HLDQYEYIKKDEQDRYLLKLIEDGFEEK--LKTSELTREAFHKILNWEISQKLNQSMSSYYITVREIINW
DPO3_STAES      VVPIKDKLFTPRMDGANEEIRELSYSNAKKLYGED-LPQIVIDRLEKELDSIIGNGFSVIYLISQRLVKK
DPO3_STAEQ      VVPIKDKLFTPRMDGANEEIRELSYSNAKKLYGED-LPQIVIDRLEKELDSIIGNGFSVIYLISQRLVKK
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_PEDPA      GISPVDKLYTPKMPGAEDRIKQLSMDRAHALYG-EVLPEIVQERLDKELTSIIGNGFSVIYLIAQRLVHK
DPO3_BACCR      KIEGAD----DETRDMSYKMARSIYGEELP----EIVE----ARLEKELKSIIGHGFAVIYLISHKLVKK
DPO3_STRT1      QIEEVEVVKKDLYTPYIDRAEEQVAEMTYAKAFENPLPDIIDLRIEKELSSILGNGFAVIYLASQMLVNR
DPO3_STRTD      QIEEVEVVKKDLYTPYIDRAEEQVAEMTYAKAFENPLPDIIDLRIEKELSSILGNGFAVIYLASQMLVNR
DPO3_STRT2      QIEEVEVVKKDLYTPYIDRAEEQVAEMTYAKAFENPLPDIIDLRIEKELSSILGNGFAVIYLASQMLVNR
DPO3_LACRD      KLYPPHM--KGAEQEIQDRTARKWYGDPLPQLVQD--------RIELELNSIVKNGFSVHYLIAQRLVAK
DPO3_MYCGE      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3_BACSU      KIEGAD---EEIREMSYQRARSIYGEE---------LPEIVEARIEKELKSIIGHGFAVIYLISHKLVKR
DPO3_STRMU      RFEDVEVVKTD-----------------------------------------------------------
PPAC_METJA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS
DPO3A_RICCN     SKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS
DPO3A_RICFE     SKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS
DPO3A_RICTY     SKKHGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVCS
DPO3A_RICPR     SKKQGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS
DPO3A_RICBR     SKKQGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPDRISMPDFDIDFCQERREEVINYVRS
DPO3A_CAUCR     GKAHGIPVGPGRGSGAGSLVAWVLTITDLDPLRFGLLFERFLNPERVSMPDFDVDFCQERREEVISYVQE
DPO3A_CAUCN     GKAHGIPVGPGRGSGAGSLVAWVLTITDLDPLRFGLLFERFLNPERVSMPDFDVDFCQERREEVISYVQE
DPO3A_BORBU     AHDNDIPVGAGRGSGAGSIVAYALRITDIDPLKYNLLFERFLNPERISMPDFDIDFCFEGRDEIIKYVTN
DPO3A_ECO57     SKDNGVPVGPGRGSGAGSLVAYALKITXXXXXXXXXXXXXXXNPERVSMPDFDVDFCMEKRDQVIEHVAD
DPO3A_ECOLI     SKDNGVPVGPGRGSGAGSLVAYALKITXXXXXXXXXXXXXXXNPERVSMPDFDVDFCMEKRDQVIEHVAD
DPO3A_ECOL6     SKDNGVPVGPGRGSGAGSLVAYALKITXXXXXXXXXXXXXXXNPERVSMPDFDVDFCMEKRDQVIEHVAD
DPO3A_PSEFL     AKNNGVPVGPGRGSGAGSLVAYVQKITDLDPLEYDLLFERFLNPERVSMPDFDVDFCMDGRDRVIDYVAE
DPO3A_HAEIN     SKDNDIPVGPGRGSGAGSLVAYALKITXXXXXXXXXXXXXXXNPERVSMPDFDVDFCMDGRDRVIEHVAE
DPO3A_TREPA     AKEHDIPVGPGRGSGASSIVAYALKITDIDPLRYKLLFERFMNPERISMPDFDIDFCFERRQEVIEYVRA
DPO3A_VIBCH     SKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFDVDFCMDKRDQVIDHVAE
DPO3A_SALTY     SKDNGVPVGPGRGSGAGSLVAYALKITXXXXXXXXXXXXXXXNPERVSMPDFDVDFCMEKRDQVIEHVAD
DPO3A_BUCAI     AKDNNIPVGPGRGSGAGSLVAYALNITEVDPLSFNLLFERFLNPERISMPDFDIDFCMEKRDQVIDHVSE
DPO3A_PSEAE     AKNNGVPVGPGRGSGAGSLVAYVLKITDLDPLAYDLLFERFLNPERISMPDFDVDFCMEGRDRVIDYVAD
DPO3A_PASMU     SKDNDIPVGPGRGSGAGSLVAYALKITXXXXXXXXXXXXXXXNPERVSMPDFDVDFCMDGRDRVIDHVAE
DPO3A_NEIMB     AKTHGCPVGPGRGSGAGSLVAYSLKITDLDPLKYALLFERFLNPERVSMPDFDVDFCQSNRGRVIEYVRE
DPO3A_CAMJE     AKDKGIPVGPGRGSAAGSLVSYCLRITDLDPIPYSLLFERFLNPERVSMPDIDVDFCQDRRAEVIDYVID
DPO3A_THEAQ     ARGHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRERDRVIQYVRE
DPO3A_NEIMA     AKTHGCPVGPGRGSGAGSLVAYSLKITDLDPLKYALLFERFLNPERVSMPDFDVDFCQANRGRVIEYVRE
DPO3A_BUCAP     AKDNNIPVGPGRGSGAGSLVAYVLNITEVDPLFFDLLFERFLNPERISLPDFDIDFCMEKRDRVIEHVVH
DPO3A_XYLFT     GKQQGIPIGPGRGSGAGSLVAWALLITDLDPLPYNLLFERFLNPERVSMPDFDIDFCMERRDEVISYVAR
DPO3A_HELPY     AKEMGIPVGPGRGSAAGSLVAFALKITDIDPLKYDLLFERFLNPERISMPDIDTDFCQRRRKEIIEYMIE
DPO3A_HELPJ     AKEMGIPVGPGRGSAAGSLVAFALKITDIDPLKYDLLFERFLNPERVSMPDIDTDFCQRRRKEIIEYMIE
DPO3A_XYLFA     GKQQGIPIGPGRGSGAGSLVAWTLLITDLDPLPYNLLFERFLNPERVSMPDFDIDFCMERRDEVISYVAR
DPO3A_BUCBP     AKKNDIPVGPGRGSGAGSLVSYVLNITELDPLSFDLLFERFLNPERVFMPDLDVDFCMDKRDKVIEHVSK
DPO3A_BACSU     AHEKGIVTGPGRGSAAGSLVAYVLYITDVDPIKHHLLFERFLNPERVSMPDIDIDFPDTRRDEVIQYVQQ
DPO3A_BACHD     AREASIVTGPGRGSVAGSLVAYVLFITDVDPLHYDLLFERFLNPERISLPDIDLDFPDHRREEVIVYVKK
DPO3A_AQUAE     AKKNDIPVGPGRGSAGGSLVAYAIGITDVDPIKHGFLFERFLNPERVSMPDIDVDFCQDNREKVIEYVRN
DPO3A_CHLTR     AKDHGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERISYPDIDIDICMIGRERVINYAIE
DPO3A_CHLPN     AKANGIPVGPGRGSGAGSVLLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICMAGRERVINYAIE
DPO3A_CHLMU     AKDHGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICMIGREKVINYAIE
DPO3A_STRCO     AKNQGIAVGPGRGSAAGSIVAYAMGITDLDPIPHGLIFERFLNPERVSMPDVDIDFDERRRVEVIRYVTE
DPO3A_DEIRA     AKDHDISVGPGRGSGAGSLVAYAIRITNLDPXXXXXXXXXXXNPDRISMPDFDIDFNDARRTEVIGYVQE
DPO3A_MYCTU     ARSAGIRVGPGRGSAAGSLVAYALGITDIDPIPHGLLFERFLNPERTSMPXXXXXXXXXXXGEMVRYAAD
DPO3A_MYCBO     ARSAGIRVGPGRGSAAGSLVAYALGITDIDPIPHGLLFERFLNPERTSMPXXXXXXXXXXXGEMVRYAAD
DPO3A_STAAW     AKTNDVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERVIQYVQE
DPO3A_STAAS     AKTNDVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERVIQYVQE
DPO3A_STAAR     AKTNDVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRREKVIQYVQE
DPO3A_STAA8     AKTNDVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERVIQYVQE
DPO3A_STAAC     AKTNDVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERVIQYVQE
DPO3A_SYNY3     ARDHGIPVGPGRGSAAGSLVAYCMKITNIDPVHHGLIFERFLNPERKSMPDVDTDFCIDRRDEMIEYVTQ
DPO3A_STAES     AKTHEVMVGPGRGSSAGSLVSYLLGITTIDPLKYNLLFERFLNPERVTMPDIDIDFEDTRREKVIKYVQD
DPO3A_STAAN     AKTNDVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERVIQYVQE
DPO3A_STAAM     AKTNDVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERVIQYVQE
DPO3A_STAEQ     AKTHEVMVGPGRGSSAGSLVSYLLGITTIDPLKYNLLFERFLNPERVTMPDIDIDFEDTRREKVIKYVQD
DPO3A_MYCLE     ARSVGIRVXXXXXXXXXXXXXXXXXITDIDPIPHGLLFERFLNPERTSMPXXXXXXXXXXXGEMVRYAAD
DPO3A_STRP8     GRSKGYYMGMGRGSAAGSLVAYALDITGIDPVQHDLLFERFLNKERYSMPDIDIDLPDIYRSEFLRYVRN
DPO3A_STRP6     GRSKGYYMGMGRGSAAGSLVAYALNITGIDPVQHDLLFERFLNKERYSMPDIDIDLPDIYRSEFLRYVRN
DPO3A_STRP3     GRSKGYYMGMGRGSAAGSLVAYALNITGIDPVQHDLLFERFLNKERYSMPDIDIDLPDIYRSEFLRYVRN
DPO3A_STRP1     GRSKGYYMGMGRGSAAGSLVAYALNITGIDPVQHDLLFERFLNKERYSMPDIDIDLPDIYRSEFLRYVRN
DPO3A_STRPY     GRSKGYYMGMGRGSAAGSLVAYALNITGIDPVQHDLLFERFLNKERYSMPDIDIDLPDIYRSEFLRYVRN
DPO3A_LACLA     AREQDIYCGMGRGSAAGSLVAYVLGITQVDPVQHNLFFERFLNPERVXXXXXXXXXXXXXXXELLAYMKN
DPO3A_MYCGE     AFKKDILIGSGRGSAVGSLVAFLLNITKIDPVQHQLIFERFISTHRQDLPDIDIDIMENKRAEMINYLFE
DPO3A_UREPA     AKSNGIIVGPGRGSAAGSLVAYCLHITDIDPIKHNLIFERFLNPTRKSMPDIDTDIMDEKRDLVIEYLFE
DNAE2_AGRVS     ARAKGILC-QGRGSAANSAVCYILGVTSIDPETNNLLFERFVSQERDEPPDIDVDFEHERREEVIQWIYK
DNAE2_RHOBA     ARSQEILC-QGRGSAANSVVCYCLGITSVDPTHTDLLFERFISRERGEAPDIDVDFEHQRREEVLQYLYE
DPO3A_MYCPN     AHNNDILIGPGRGSAVGSLVAFLLKITQIDPVANNLIFERFISRHRQGLPDIDIDIMETKRDLVIDYVMQ
DNE23_AGRT5     ARSQGILC-QGRGSAANSAVCYILGITSIDPSTNDLLFERFVSQERDEPPDIDVDFEHERREEVIQWIYR
DNE22_AGRT5     ARSQGILC-QGRGSAANSAVCYILGITSIDPSTNDLLFERFVSQERDEPPDIDVDFEHERREEVIQWIYK
DNE22_RHIME     ARSQGILC-QGRGSAANSAVCYVLGITSIDPETNDLLFERFVSQERDEPPDIDVDFEHERREEVIQWIYK
DNAE2_SYMTH     ARERGIRCA-GRGSAADSAVAYCLFITDVDAIERGLLFERFMSLERAQKPXXXXXXXXXXXXEVAAYVYR
DNAE2_PROAC     AQSQGILC-QGRGSAAASAVCYVLGITVVDPVFYGLPFERFLSVLREEEPDIDVDFDARRREEVIQYVYA
DNAE2_MYCTU     CRDNDILC-QGRGSAANSAVCYALGVTAVDPVANELLFERFLSPARDGPPDIDIDIESDQREKVIQYVYH
DNAE2_MYCBO     CRDNDILC-QGRGSAANSAVCYALGVTAVDPVANELLFERFLSPARDGPPDIDIDIESDQREKVIQYVYH
DNE21_RHIME     ARSVNILC-QGRGSAANSSVCFCLGITDVDPQKFTLLFDRFLSKDRDEPPDIDVDFEHERREEVIQYIYR
DNE21_AGRT5     ARSKDILC-QGRGSAANSVICFVLGITAIDPALFSLVFERFVSENRGEPPDIDVDFEHQRREEVIQWVYD
DNAE2_MYCPA     CRENNILC-QGRGSAANSAVCYALGVTAVDPVANELLFERFLSPARDGPPDIDMDIESDQREKVIQYVYD
DNAE2_SINMW     ARSEKILC-QGRGSAANSSVCFCLGITDVDPQKFTLLFDRFLSKDRDEPPDIDVDFEHERREEVIQYIYR
DNAE2_IDILO     AREQGILF-QGRGSAANSVVCYCLGITAVNPAQIQVLFERFISKERNEPPDIDVDFEHERREEVIQYIYR
DNAE2_DECAR     ARSQDILC-QGRGSAANSAVCYALGVTEVDPARSALLFERFVSKERGEPPDIDVDFEHERREDVIQYIYT
DNAE2_RHISN     ARSVNILC-QGRGSAANSSVCFCLGITDVDPQKFTLLFDRFLSRDRDEPPDIDVDFEHERREEVIQYIYR
DNAE2_BDEBA     ASERKILY-QGRGSAANSVVCFCLGLTAIDPVKMDXXXXXXXXXXXXXPPDIDIDFEHSRREEVIQHIYE
DNAE2_PSEF5     ARRQHILC-QGRGSAANSVVCFALGITEIDPDRSTLLFERFLSRERNEPPDIDVDFEHERREEVLQYLFQ
DPO3A_YERPE     SRETGIPVGPGRGSSAGSLVAWCIGITNVDPIRHGLLFERFINPERLDLPDADLDFSQARRHEVIEYLNE
DNAE2_TERTT     ARQQNILC-QGRGSAANSVVCYCLFITEIAPGQINVLFERFISKERDEPPDIDVDFEHQRREDVIQYIYT
DNAE2_BRASO     ARSEGILC-QGRGSAANSAVCYVLGITSVDPTKIDLLFERFISKERLEPPDIDVDFEHSRREEVMQYVYH
DNAE2_SACD2     ARSKNILC-QGRGSAANSVVCYCLFITEIAPGQINVLFERFISKERNEPPDIDVDFEHQRREEVIQYIYQ
DNAE2_PSEPF     AREQKILC-QGRGSAANSAVCFALGITEIDPDRTTLLFERFMSRERNEPPDIDVDFEHERREEVLQYVFR
DNAE2_SILPO     ARSQGILC-QGRGSAANSILCYLLGITDVSPDQIAMVFERFISKYRGEPPDIDVDFEHERREEVIQWIYQ
DNAE2_BRUSU     AREKGILC-QGRGSAANSVVCFCLGITGVNPTQVDLLFERFISAERKEPPDIDVDFEHERREEVMQYVYD
DNAE2_BRUME     AREKGILC-QGRGSAANSVVCFCLGITGVNPTQVDLLFERFISAERKEPPDIDVDFEHERREEVMQYVYD
DNAE2_BRUAB     AREKGILC-QGRGSAANSVVCFCLGITGVNPTQVDLLFERFISAERKEPPDIDVDFEHERREEVMQYVYD
DNAE2_PSE14     ARSQHILC-QGRGSAANSAVCYALGITELNPEKSNLLFERFISRERNEPPDIDVDFEHDRREEVIQYIFR
DNAE2_PSEU2     ARSQHILC-QGRGSAANSAVCYALGITELNPEQSNLLFERFISRERNEPPDIDVDFEHDRREEVIQYIFR
DNAE2_CORGL     CRDSNILC-QGRGSAANSAVCFVLGITNAEPISAGLLFERFLSXXXXXXXXXXXXXESGRREEVIQYVYE
DNAE2_RHILO     ARSQDILC-QGRGSAANSIVCFCIGITEVGPDRIDTLFERFISEERNEPPDIDVDFEHEKRETVIQYIYE
DNAE2_CAUCR     ARSMGILC-QGRGSAANSSVCFCLGVTAIDPTEHRLLFTRFISENRGEPPDIDVDFEHDRREEVMQYVFQ
DNAE2_CAUCN     ARSMGILC-QGRGSAANSSVCFCLGVTAIDPTEHRLLFTRFISENRGEPPDIDVDFEHDRREEVMQYVFQ
DNAE2_RHOPS     ARSQDILC-QGRGSAANSAVCYVLGITCVDPTEIDLLFERFVSEERDEPPDIDVDFEHSRREEVMQYIYR
DNAE2_RHOP2     ARSQNILC-QGRGSAANSAVCYVLGITCVDPTEIDLLFERFVSEERDEPPDIDVDFEHSRREEVMQYIYR
DNAE2_CORJK     CHENNIFC-QGRGSAANSAVCFALGITTVDAVASGLLFERFLSPERDGPPDIDLDIESGRREEAIQYVYS
DNAE2_VIBPA     AKQQGILY-QGRGSAANSVVCYCLEITAVDPRQISVLFERFISKERKEPPDIDVDFEHERREEVIQYIYK
DNAE2_CORDI     CHTNNILC-QGRGSAANSVVCFVLGITNVEPISTGLLFERFLSRDREGPPDIDIDIESGRRDAVITYVYD
DNAE2_ALHEH     ARRRGILC-QGRGSSANSAVCFCLGITAVDPARQSLLFERFISKERGEPPDIDVDFEHERREEVIQYIYR
DNAE2_PSEPK     ARSQRILC-QGRGSAANSVVCFVLGITELDPMKHHLLFERFLSRERNEPPDIDVDFEHDRREEVIQYVFR
DNAE2_PSESM     ARSQHILC-QGRGSAANSAVCYALGITELNPEKSNLLFERFISKERDEPPDIDVDFEHDRREEVIQYIFR
DNAE2_COREF     CHNATILC-QGRGSAANSAVCFVLGITNAEPITAGLLFERFLSXXXXXXXXXXXXXESGRREEVIQYVYT
DNAE2_RHOP5     ARSQNILC-QGRGSAANSAVCYVLGITCVDPTEIDLLFERFVSEERDEPPDIDVDFEHSRREEVMQYIYR
DNAE2_METCA     ARSRGILC-QGRGSAANSAVCYCLGITEVDPARLDLLFERFISRERNEPPDIDVDFEHERREEVIQYIYR
DNAE2_ANADE     ARSRGILC-QGRGSAANSAVCYVLGITSIDPVRMGLLFERFISAERGEPPDIDVDFEHERREEVLQYVYQ
DNAE2_RHOPA     ARSQDILC-QGRGSAANSAVCYVLGITCVDPTEIDLLFERFVSEERDEPPDIDVDFEHSRREEVMQYIYR
DNAE2_BRAJA     ARSQNILC-QGRGSAANSAVCYVLGITSVDPTKVDLLFERFISKERLEPPDIDVDFEHSRREEVMQYVYR
DNAE2_NOCFA     CERNGILC-QGRGSAANSAVCFAIGITNVDPVANELLFERFLSXXXXXXXXXXXXXXXXXXXXAIQHVYA
DNAE2_ANAD2     ARSRGILC-QGRGSAANSAVCYVLGITSIDPVRMGLLFERFISAERGEPPDIDVDFEHERREEVLQYVYQ
DNAE2_HAHCH     AKKSQILC-QGRGSAANSVVCYCLGITAVDPTRASLLFERFISKGRDEPPDIDVDFENARREEVIQYLYR
DNAE2_ANASK     ARSRGILC-QGRGSAANSAVCYVLGITSIDPVRMGLLFERFISAERGEPPDIDVDFEHERREEVLQYVYQ
DNAE2_PSEA7     ARRQKILC-QGRGSAANSAVCFALGITELDPERINLLFERFLSRERNEPPDIDVDFEHERREEVIQYVFN
DNAE2_PSEAE     ARGRKILC-QGRGSAANSAVCFALGITELDPDRTNLLFERFLSRERNEPPDIDVDFEHERREEVIQYVFT
DNAE2_BURPS     ARSKDILC-QGRGSAANSVVCYCLGVTEVNPQQSTLLFERFLSRERGEPPDIDVDFEHQRREEVIQYLYE
DNAE2_BURMA     ARSKDILC-QGRGSAANSVVCYCLGVTEVNPQQSTLLFERFLSRERGEPPDIDVDFEHQRREEVIQYLYE
DNAE2_VIBVU     AKQQGILY-QGRGSAANSVVCYCLQITSVDPRQIAVLFERFISKERDEPPDIDVDFEHERREEVIQYIYQ
DPO3A_THEMA     AKKMGIKVGPGRGSAVGSLVAYLCGITEVDPIKYDLLFERFLNEERQEPPDIDVDVEDRRRKDLIKELSK
DNAE2_VIBVY     AKQQGILY-QGRGSAANSVVCYCLQITSVDPRQIAVLFERFISKERDEPPDIDVDFEHERREEVIQYIYQ
DNAE2_VIBHB     AKQQGILY-QGRGSAANSVVCYCLEITAVDPRQISVLFERFISREREEPPDIDVDFEHERREEVIQYIYK
DNAE2_RALSO     ARSQSILC-QGRGSAANSAVCYCLGITEVNPESGNTLFARFLSRARNEPPDIDVDFEHQRREEVIQYIYK
DNAE2_GLUOX     ARSLGI-VCQGRGSAANSAVCYVLGITSIDPVRSGLLFERFISTERQEPPDIDVDFESDRREEVIQWIYR
DNAE2_AZOSE     ARGRGILC-QGRGSAANSVICWALGITEVDPELGIMLVERFISKERDEPPDIDVDFEHERREEVIQYVYR
DNAE2_XANCP     ARAQGILC-QGRGSSANSAVCYALGITAVNPSETRLLMARFLSKERDEPPDIDVDFEHERREEVLQYVYT
DNAE2_XANC8     ARAQGILC-QGRGSSANSAVCYALGITAVNPSETRLLMARFLSKERDEPPDIDVDFEHERREEVLQYVYT
DNAE2_XANAC     AREQNILC-QGRGSSANSAVCYALGITAVNPDETRLLMARFLSEKRDEPPDIDVDFEHERREEVLQYVYS
DNAE2_RALPJ     ARNEGILC-QGRGSAANSAVCYCLGITEVNPDSGNTLFARFLSRARNEPPDIDVDFEHQRREEVIQYIYK
DNAE2_XANCB     ARAQHILC-QGRGSSANSAVCYALGITAVNPSETRLLMARFLSKERDEPPDIDVDFEHERREEVLQYVYT
DNAE2_XANOR     AREQNILC-QGRGSSANSAVCYALGITAVNPDETRLLMARFLSEKRDEPPDIDVDFEHERREEVLQYVYR
DNAE2_XANOP     AREQNILC-QGRGSSANSAVCYALGITAVNPDETRLLMARFLSEKRDEPPDIDVDFEHERREEVLQYVYR
DNAE2_BORPA     ARSQGILC-QGRGSAANSAVCYCLGITAVDPARGNTLFERFISKERNEPPDIDVDFEHQRREEVIQYIYE
DNAE2_AZOSB     ARDEGILC-QGRGSAANSIVCYALGITEVDPARASLLFGRFISRERDEPPDIDVDFEHDRRETVIQYIYG
DNAE2_PSEMY     ARKQHILC-QGRGSAANSTVCFALGITELNPDNSGXXXXXXXXXXXXEPPDIDVDFEHERREEVIQYVFR
DNAE2_XANC5     ARSKDILC-QGRGSSANSAVCYALSITSVDPSKTRLLISRFLSKARNEPPDIDVDFEHERREEVLQYVYA
DNAE2_BORBR     ARSQGILC-QGRGSAANSAVCYCLGITAVDPARGNTLFERFISKERNEPPDIDVDFEHQRREEVIQYIYE
YORL_BACSU      DDECGSLVGAARGSAAGYLVNYLLDNTQINPMQYDLPHWRHIHKSRPDLPDIDIDTEGSKRQKILKALRE
DPO3_STAES      SLDDGYL-XXXXXXXXXXXXATMTEITEVNPIKEGIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKV
DPO3_STAEQ      SLDDGYL-XXXXXXXXXXXXATMTEITEVNPIKEGIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKV
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_PEDPA      SNKDGYLXXXXXXXXXXXXATMS-GITEVNPLEYGIPFETFLGFKGDKVPDIDLNFSGDYQPIAHNYMQV
DPO3_BACCR      SLVDGYL-XXXXXXXXXXXXATMMEITEVNPVKDGIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKV
DPO3_STRT1      SNERGYL---------------------------------------------------------------
DPO3_STRTD      SNERGYL---------------------------------------------------------------
DPO3_STRT2      SNERGYL---------------------------------------------------------------
DPO3_LACRD      SNKDGYLXXXXXXXXXXXXATLS-GITEVNPLKCGTLFQTFLGFKGNKVPDIDLNFSGDYQPIAHNYMKV
DPO3_MYCGE      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3_BACSU      S---------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
PPAC_METJA      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREVPELANAAKGN
DPO3A_RICCN     KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREVPELANAAKGN
DPO3A_RICFE     KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREVPELANAAKGN
DPO3A_RICTY     KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKCADYLTELVPFSAVNPVSLEQAIREVPELANAAKGK
DPO3A_RICPR     KYGPNRVGQIITFGKMQAKAVIKDVARVLSLPYKLADYLTELVPFSAINPVSLEQAIREVPELANAAKGN
DPO3A_RICBR     KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAINPVTLEQAIREVPELANAAKXX
DPO3A_CAUCR     KYGRDRVAQIITFGSLQARAVLRDVGRVMQLPLGLVDRLCKMVPNNPAAPVTLAQAIDLEPRLKQAKK--
DPO3A_CAUCN     KYGRDRVAQIITFGSLQARAVLRDVGRVMQLPLGLVDRLCKMVPNNPAAPVTLAQAIDLEPRLKQAKK--
DPO3A_BORBU     KYGEDKVAQIITFGTLKPKAVVKDVARVLDIPFAESNELTKFIPDGP--KVSLKEVLDD----------N
DPO3A_ECO57     MYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDP--GMTLAKAFEAEPQLPE-----
DPO3A_ECOLI     MYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDP--GMTLAKAFEAEPQLPE-----
DPO3A_ECOL6     MYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDP--GMTLAKAFEAEPQLPE-----
DPO3A_PSEFL     KYGRNAVSQIITFGSMXXXXXXXXXXXXQGKSFGLADRLSKMVPFEV--GMTLEKAYEQEEILRDFIK--
DPO3A_HAEIN     TYGRGAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDP--GMTLAKAFETEPQLQTA----
DPO3A_TREPA     RYGNDNVGQIITFGTLKPKAAIRDVGRVLDIPLSEVLMITKLMP---DDPKLTFKKAYESEQLAQ-MKQE
DPO3A_VIBCH     MYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLVPPDP--GMTLEKAFIAEPALQE-----
DPO3A_SALTY     MYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLVPPDP--GMTLAKAFEAEPQLPE-----
DPO3A_BUCAI     IYGKNAVAQIITFGTLTAKAVIRDVGRVLGYPYGFINKLSKLVPLDP--GITLKEAFSKESELFNLYKNN
DPO3A_PSEAE     AYGRNAVSQIITFGTMXXXXXXXXXXXXQGKSYGLADRLSKMIPFEV--GMTLDKAYEQEEMLRDFLKS-
DPO3A_PASMU     TYGRGAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDP--GMTLAKAFAAEPQL------Q
DPO3A_NEIMB     KYGAEAVSQIVTFGTMSSKAVIRDVGRVLELPFMLCDKLSKLIPLEANKPLSLEKAMETXXXXXXXXXXX
DPO3A_CAMJE     KYGADKVAQVITFGKLLAKGVIRDVARVCDMSIQDADELAKLVPEEL--KITLDAAYEKEPKIKEF----
DPO3A_THEAQ     RYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKPLQEAIQVVPELRAEME--
DPO3A_NEIMA     KYGAEAVSQIVTFGTMSSKAVIRDVGRVLELPFTLCDKLSKLIPLEANKPLGLDDAMKXXXXXXXXXXXX
DPO3A_BUCAP     TYGRESVAQIITFGTMTAKAVIRDVGRVLGYPYGFINNLSKLVPLDP--GITLKDAF---------SKNS
DPO3A_XYLFT     KYGRERVSQIITYGTMAAKAVVRDVGRVLGFPYGLVDSVAKLIP--STLGITLKDAMGE-GETNDNASAE
DPO3A_HELPY     KYGKYNVAQVITFNKMLAKGVIRDVARVLDMPYKEADDFAKLIPNREKNGEFIEGAWELEPKIKELVESN
DPO3A_HELPJ     KYGKYNVAQVITFNKMLAKGVIRDVARVLDMPYKEADDFAKLIPNREKNGEFIEGAWELEPKIKELVESN
DPO3A_XYLFA     KYGRERVSQIITYGTMAAKAVVRDVGRVLGFPYGLVDSIAKLIPNTL--GITLKDAMGE-GETNDNASAE
DPO3A_BUCBP     IYGEESVSQIISFGTLTAKSVIRDVGRVFGFPYGFLNRLSKLIPLDL--GMTLEKAISQKVELLE-----
DPO3A_BACSU     KYGAMHVAQIITFGTLAAKAALRDVGRVFGVSPKEADQLAKLIP--SRPGMTLDEARQQSPQLDKRLR--
DPO3A_BACHD     KYGANRVAQILTFGTLAARASVRDVGKALAIPPNVIEKISKEI--SGRPGMTLVKAYNENERLRQ-----
DPO3A_AQUAE     KYGHDNVAQIITYNVMKAKQTLRDVARAMGLPYSTADKLAKLIPQGDVQGLSLEEMYKTPVEELLQKYGE
DPO3A_CHLTR     RHGKDNVAQIITFGTMKAKMAIKDVGRTLDTPLAKVNFIAKHIP--DLN-ATITSALEADPELRQ-----
DPO3A_CHLPN     RHGKDNVAQIITFGTMKAKMAVKDVGRTLDMALSKVNHIAKHIP--DLN-TTLSKALETDPDL------H
DPO3A_CHLMU     RHGKENVAQIITFGTMKAKMAIKDVGRTLDTPLSKVNLIAKKIP--DLN-ATIASALESDPDLRQ-----
DPO3A_STRCO     KYGADKVAMIGTYGKIKAKNAIKDSARVLGYPYAMGDRLTKAMPADVLGKIDLNGITDPTPRYSEAGEIR
DPO3A_DEIRA     KYGTDKVAQIATFGTMASKACLKDVARVMGLEYAKVDKVSKLIPIKFGKSYSLEQAREAVPDIQQM----
DPO3A_MYCTU     KWGHDRVAQVITFGTIKTKAALKDSARIYGQPFAIADRITKAIPLSGITDPSHER-------YKEAAEVR
DPO3A_MYCBO     KWGHDRVAQVITFGTIKTKAALKDSARIYGQPFAIADRITKAIPLSGITDPSHER-------YKEAAEVR
DPO3A_STAAW     KYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKL--GITLDEAY-QIDDFKKFVHRN
DPO3A_STAAS     KYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKL--GITLDEAY-QIDDFKKFVHRN
DPO3A_STAAR     KYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKL--GITLDEAY-QIDDFKKFVHRN
DPO3A_STAA8     KYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKL--GITLDEA--------------
DPO3A_STAAC     KYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKL--GITLDEAY-QIDDFKKFVHRN
DPO3A_SYNY3     KYGEDKVAQIITFNRMTSKAVLKDVARVLDIPYAESDKMAKMIPVSRGKPAKLKVMISQTPEPQFKAR--
DPO3A_STAES     KYGEHHVSGIVTFGHLLARAVARDVGRIMGFDETSLNEISKLIPHKL--GITLEEAYQK-PEFKAFVHRN
DPO3A_STAAN     KYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKL--GITLDEAY-QIDDFKKFVHRN
DPO3A_STAAM     KYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKL--GITLDEAY-QIDDFKKFVHRN
DPO3A_STAEQ     KYGEHHVSGIVTFGHLLARAVARDVGRIMGFDETSLNEISKLIPHKL--GITLEEAYQK-PEFKAFVHRN
DPO3A_MYCLE     KWGHDRVAQVITFGTIKTKAALKDSARIYGQPFAMADRITKLPPAIMAKDIPLSGITDPAHEFKEAAEVR
DPO3A_STRP8     RYGSDHSAQIVTFSTFGPKQAIRDVFKRFGVPEYELTNLTKKIGFKDSLATVYEKSIRQV----------
DPO3A_STRP6     RYGSDHSAQIVTFSTFGPKQAIRDVFKRFGVPEYELTNLTKKIGFKDSLATVYEKSIRQV----------
DPO3A_STRP3     RYGSDHSAQIVTFSTFGPKQAIRDVFKRFGVPEYELTNLTKKIGFKDSLATVYEKSIRQV----------
DPO3A_STRP1     RYGSDHSAQIVTFSTFGPKQAIRDVFKRFGVPEYELTNLTKKIGFKDSLATVYEKSIRQV----------
DPO3A_STRPY     RYGSDHSAQIVTFSTF--GQAIRDVFKRFGVPEYELTNLTKKIGFKDSLATVYEKSIRQV----------
DPO3A_LACLA     RYGSDHVAQIVTFSTLGKRQALRDVGKAFGMTEAELSNLTRML-------------VRRFGTLADEYENN
DPO3A_MYCGE     KYGKENCAQIVTFQRFKTRSAVKEVAKLFN-DYGISDMILGVLPDQTITFTDLKATEDSALQLCLQQFG-
DPO3A_UREPA     KYGNDHVAYILTFQRLKAKMAIRDVGRILGIDLKVIDKICK-----NIKPEYDE-------DLDLAIKKN
DNAE2_AGRVS     TYGKEKAALCATVNRYRAKGAIRDVGKALGLPEDLIKALS-----SGMWSWSQETSDRNVREL-------
DNAE2_RHOBA     KYGRDRAGMTAVVTCYRAKSAIREVGKALAISPDIIDAVAKLAGSYSRNP--------ELPERCRDA---
DPO3A_MYCPN     KYGREQCAQIVTFQKFKTRSALRDVGKVFNHIEGAEDLLGKLPKDKSLLELDVNGVTDPVLQLS------
DNE23_AGRT5     TYTREKAALCATVTRYRARGAIRDVGKALGLPEDVIKALS-----SGMWSWSEEVCDRNVREL-------
DNE22_AGRT5     TYTKDKAALCATVTRYRAKGAIRDVGKALGLPEDVIKALS-----SGMWSWSEEVPDRNIREL-------
DNE22_RHIME     TYGHDKAALCSTVTRYRAKGAIRDVGKALDLPEDLIRTLS-----SGIWSWSETVGERQVREL-------
DNAE2_SYMTH     KYGADHVASVCTYNTFQARSAVRDLGKAMGFQEADLDYLAKRIPWHA-GADEILTVMARYPEL----RQS
DNAE2_PROAC     KYGRRNAAQVADVITYRPRSAVRDMAKALGYSQGQQDAWSRQMERRSVPPLPHDPDGPEIP---------
DNAE2_MYCTU     KYGRDYAAQVANVITYRGRSAVRDMARALGF-----------------SPGQQDAWSKQVSHWTGQAD--
DNAE2_MYCBO     KYGRDYAAQVANVITYRGRSAVRDMARALGF-----------------SPGQQDAWSKQVSHWTGQAD--
DNE21_RHIME     TYGKEHAGLTAAVISYRSRSAGREVAKAFGLSEDVQSALVSSIWGWGTSPFTEEQ-----------AKGA
DNE21_AGRT5     TYGRDKAALCSVVTRYRGRGALRDVGKVLGLP----EDLTKLLS-SQVWRWSEGVGEKQVKEL-------
DNAE2_MYCPA     RYGRDYAAQVANVITYRGKIAVRDMARALGYSQGQQDAWSKQIS-SWSGPADSPDVEGIPPQ--------
DNAE2_SINMW     TYGKEHAGLAAAVISYRSRSAGREVAKAFGFSEDVQSALVSSIWGWGNSPFTEEQ-----------ARGA
DNAE2_IDILO     KYGRQRAALAATVITYRFKSAFRDVGKALGFSEQQLQYFRRNLDRRDKEQSWQQQLVQQHPEVTNSVRGQ
DNAE2_DECAR     KYGRERAALAAALITYRTKGALRDAGRALGFGIAQINALTASLAWWD----KREQLPERFAEL-------
DNAE2_RHISN     TYGKEHAGLTAAVISYRSRSAGREVAKAFGLSEDVQSALVSSVWGWGTSPFTEEQ-----------AKGA
DNAE2_BDEBA     KYNERHAAMVCTVIRYRSRMAIRETAKVFGMP---------LAKINAMIKFMGRDGMKRLLDPAVAA---
DNAE2_PSEF5     RYGRHRAALTAVVSTYHGAGAVRDVAKALGLPPDQVNALADCCGHWSDTPPSVERLQEA-----------
DPO3A_YERPE     RYGEDYVAGIPNFTYLGAASALRDTARIYGVD-------------AADMAVSKEFKNXXXXXXXXXXXXX
DNAE2_TERTT     KYSRQRAALAATVISYRSRSAIRDVGKALGLDPALVDHLAKSLAW-----------WDRTGDLVKRIEAA
DNAE2_BRASO     RYGRHRAAIIATVIHYRPRSAIRDVGKALGLTEDVTSVLADTVWGSWGDGLSDMQVRQA-----------
DNAE2_SACD2     KYGRERAALAATVITYRSRSAIRDVGKAMGLEAGLVGQLAKSLAW-----------WDRTGDLIKRMESF
DNAE2_PSEPF     RYGRRRAALTAVVSTYHASGAIRDVAKALGLP---PDQINALADCCG-------HWSDETPPVERLREG-
DNAE2_SILPO     RYGRHRAGLCATVIHFRSRAAIREVGKVMGLSQDVTASLSGQI-WGQSNGGADPERMREL----------
DNAE2_BRUSU     RYSRDRAAIVATVISYRSRSAIRDVGKALGLSEDVTAALANTVWGLSGGGID-RQHIRQA----------
DNAE2_BRUME     RYSRDRAAIVATVISYRSRSAIRDVGKALGLSEDVTAALANTVWGLSGGGID-RQHIRQA----------
DNAE2_BRUAB     RYSRDRAAIVATVISYRSRSAIRDVGKALGLSEDVTAALANTVWGLSGGGID-RQHIRQA----------
DNAE2_PSE14     RYGRGRAALTAVASTYHGSGAMRDVAKVLGLPPDQINALAEAFSRWSDSLPSPER-LRE-----------
DNAE2_PSEU2     RYGRGRAALTAVASTYHGSGAMRDVAKVLGLPPEQINALAEAFSRWSDSLPSPER-LRE-----------
DNAE2_CORGL     KYGRDNAAQVANVITYRTKGAMRDAARALGYPQGAADAWAK-----------------------------
DNAE2_RHILO     KYSSKRTALAAAVISYRGRSALREVSKAMGLSEDVRASLSGSIWGWSTSEVGEKE-----------ARAG
DNAE2_CAUCR     RYGRAYAAICGTVIHYRPRSAIRDVGKALGLTEDVTSLLAGTVWGSWGDGLPED-------HLRNA----
DNAE2_CAUCN     RYGRAYAAICGTVIHYRPRSAIRDVGKALGLTEDVTSLLAGTVWGSWGDGLPED-------HLRNA----
DNAE2_RHOPS     RYGRHRAAIVATVIHYRPRSAIRDVGKALGLSEDVTAALADTVWGSGLNEMQVKQA--------------
DNAE2_RHOP2     RYGRHRAAIVSTVIHYRPRSAIRDVGKALGLSEDVTAALADTVWGSWGKGLS-EMQVRQA----------
DNAE2_CORJK     RYGRENAAQ---------------VANVIT--YXXXXXXXXXXXXXXYAPGQIDAWTRHPEQTPDVVQNL
DNAE2_VIBPA     KYGRERAALAATVISYRFKSAVREVGKALGIEETQLDFF-----IKNVNRRDRSQGWQQIIEL-----GL
DNAE2_CORDI     TYGRDNAAQVANVITYRTKAALRDAARALGYPNTSADAW-------STNPDEAPNAVRFLAEQ-------
DNAE2_ALHEH     KYGRHRAALAATVIRYRPRSALRDAGRALGLDAATIDRLAGSIQWKRVDPERLREA--------------
DNAE2_PSEPK     RYGRHRAALTAVVNTYHAAGAVRDVARALGLPADQVDALAKCCGRWS-DRIPDDQRLAEAGFEAGSPSLR
DNAE2_PSESM     RYGRGRAALTAVASTYHGSGALRDVAKVLGLPPDQINALADAFSRWSDSLPSPER-LRE-----------
DNAE2_COREF     RYGRDNAAQVANVITYRTKGALRDAARALGYPQGTVDAWSR----------GASEPPADVVELAGQLKGQ
DNAE2_RHOP5     RYGRHRAAIVSTVIHYRPRSAIRDVGKALGLSEDVTAALADTVWGSGLNEMQVRQA--------------
DNAE2_METCA     KYGRHRAALAASLITYXXXXXXXXXXXXLGFSPSRIDTLARVLDRHGVAETLPER-------LAEAG---
DNAE2_ANADE     RYGRDRAGMVCEVITYRGKSALRDVGKALGLSLGQVDRLAKLVG-------SYEDLGQVGPELLAQA---
DNAE2_RHOPA     RYGRHRAAIVATVIHYRPRSAIRDVGKALGLSEDVTAALADTVWGSGLNEMQVRQA--------------
DNAE2_BRAJA     RYGRHRXXXXXXXXHYRPRSAIRDVGKALGLTEDVTAALADTVWGSGLNDMQVKQA--------------
DNAE2_NOCFA     RYGREYAAQVANVITYRGKSAVRDAAKALGF-----------------SPGQQDAWSKQVSRWTGVGAET
DNAE2_ANAD2     RYGRDRAGMVCEVITYRGKSALRDVGKALGLSLGQVDRLAKLIG-------TYEDLGQVGPELLAQA---
DNAE2_HAHCH     RYGRERCAIAATVITYRPKSAIRDLGKALGVDYRGQDWIDEVITPQVSQDNHILTCFKELPELL------
DNAE2_ANASK     RYGRDRAGMVCEVITYRGKSALRDVGKALGLSLGQVDRLAKLIG-------TYEDLGQVGPELLAQA---
DNAE2_PSEA7     RYGRQRAALTAVVSTYHGAGAVRDVAKALGLPPDQVDALANCCGRWSDRAPSAERLMEA-----------
DNAE2_PSEAE     RYGRQRAALTAVVSTYHGAGAVRDVAKALGLPPEQVDVLANCCSDQAPSAERLEEA--------------
DNAE2_BURPS     KYGHDRAALAAAVSTYRPRGALRETGKAL-----------------GVDPMLVERVAKEFDGSRDLLARF
DNAE2_BURMA     KYGHDRAALAAAVSTYRPRGALRETGKAL-----------------GVDPMLVERVAKEFDGSRDLLARF
DNAE2_VIBVU     KYGRQRAALAATVISYRFKSAVRQVGKALGIEETQLDFFLKNIN-RRDRQAGWQAQLVELGLQPDSLKGQ
DPO3A_THEMA     SF---QVYQVSTFGNLTEK--------------------------------SLKNLINSVLPDASLEEKN
DNAE2_VIBVY     KYGRQRAALAATVISYRFKSAVRQVGKALGIEETQLDFFLKNIN-RRDRQAGWQVQLVELGLRPDSLKGQ
DNAE2_VIBHB     KYGRERAALAATVISYRFKSAVREVGKALGIEETQLDFF-----IKNVNRRDRTQGWQQIIEL-----GL
DNAE2_RALSO     KYGVTRTALAAALITYRTRSALRDVGRALG------------IDLGVIEQVAKAQAWWDGRH--EFAQRA
DNAE2_GLUOX     HYGRHRAALCATVQRYQPKGALREVGKVLGLPEDLTGQLSKHIASSLAD-----------PDLCKARAAD
DNAE2_AZOSE     KYGRERAALAATVIRYRARSALRDVGRALGLPPGQLERLADRFWFDAIRPERLREA--------------
DNAE2_XANCP     KYGRERAALAATVICYRGKSAVRDVAKAFGLPPDQIALLANCYGWGN-GDTPMEQRIAEAGDLAN-----
DNAE2_XANC8     KYGRERAALAATVICYRGKSAVRDVAKAFGLPPDQIALLANCYGWGN-GDTPMEQRIAEAGDLAN-----
DNAE2_XANAC     KYGRERAALAATVICYRGKSAVRDVAKAFGLPPDQIALLANCYGWGN-GETPMDQRIEEAGDLAN-----
DNAE2_RALPJ     KYGVTRTALAAALITYRTRSALRDVGRALG------------IDLGIVEQVAKGQAWWD--SRKEFAQRA
DNAE2_XANCB     KYGRERAALAATVICYRGKSAVRDVAKAFGLPPDQIALLANCYGWGN-GDTPMEQRIAEAGDLAN-----
DNAE2_XANOR     KYGRERAALAATVICYRGKSAVRDVAKAFGLPPDQIALLANCYGWGN-GETPMEQRIEEAGDLAN-----
DNAE2_XANOP     KYGRERAALAATVICYRGKSAVRDVAKAFGLPPDQIALLANCYGWGN-GETPMEQRIEEAGDLAN-----
DNAE2_BORPA     KYGRQRAALTAVVISYRPRSVLRDTGRALGVDNGIIDAVARA-----------HQWWDGKKEMLRSLAAC
DNAE2_AZOSB     KYGRDRAALAATVIRYRTRGALRDAGRALGFGQPQIDALARSLAWWD----KRDQLPARLIEL-------
DNAE2_PSEMY     RYGRQRAALTAVASTYHGAGALRDVAKALGLPPDQVGALADCCGRWSDHMPDAER-LREA----------
DNAE2_XANC5     KYGRERAALAATVICYRGKSAVRDVAKAFGLPPDQIALLANCYGWGN-GETPMEQRIEEAGDLAN-----
DNAE2_BORBR     KYGRQRAALTAVVISYRPRSVLRDTGRALGVDNGIIDAVARA-----------HQWWDGKKEMLRSLAAC
YORL_BACSU      RFGDKRVLQIATFGTEGSKSALQTACRGLGIDNDISQYLSGMIPFERGSNWPLKHCFYGDKETGR----K
DPO3_STAES      LFGEDKVFRAGTIGTVAEKTAFGFVKGYL-------------------NDQGIHKRGAEIDRLVKGC---
DPO3_STAEQ      LFGEDKVFRAGTIGTVAEKTAFGFVKGYL-------------------NDQGIHKRGAEIDRLVKGC---
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_PEDPA      LFGKDNVFRAGTIGTVADK---------------------------------------------------
DPO3_BACCR      LFGEDRAGTIGTVAEKTAYGYVKGYANDHNLTIR------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_LACRD      LFGEKNVFRAGTIGTVADK---------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
PPAC_METJA      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA
DPO3A_RICCN     GLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA
DPO3A_RICFE     GLYNLEGEAELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLVVGYSMKYSEIA
DPO3A_RICTY     GLYNLEGDAELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA
DPO3A_RICPR     GLYNLEGDAELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANADMLIVGYSMKYSEIA
DPO3A_RICBR     XXXXXXXXXXXIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLVVGYSMKYCELA
DPO3A_CAUCR     -------EDANVSACLDVALQLEGLFRNASTHAAGLVIGDRPLTQLTPLYKDPRSDLPATQFNMKWVESA
DPO3A_CAUCN     -------EDANVSACLDVALQLEGLFRNASTHAAGLVIGDRPLTQLTPLYKDPRSDLPATQFNMKWVESA
DPO3A_BORBU     SLKECFTSKPVYKELMNAALVLEGMNRHASTHAAGIVISKTPLTDYVPLYKDYKQGSVSTQYTMDLLEEC
DPO3A_ECO57     -IYEADEE---VKALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYA
DPO3A_ECOLI     -IYEADEE---VKALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYA
DPO3A_ECOL6     -IYEADEE---VKALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYA
DPO3A_PSEFL     ----VDEEAAEI---WEMARKLEGVVRNVGKHAGGVVIAPTKLTDFSPIYCDEAGDGLVTQFDKDDVEAA
DPO3A_HAEIN     --YDSDEE---VRALINMARKLEGVTRNAGKHAGGVVISPTLITDFAPLYCDNEGLHPVTHFDKNDVEYA
DPO3A_TREPA     PRY-----AELFQIAEK----LEDTNRNTSLHAAGIVIGKTALTDYVPLYKDSKTGKISTQFGMDLIEDC
DPO3A_VIBCH     -LYDADEE---VKELIDKCRILEGCTRNAGKHAGGVVISPTAITDFAPIYCDAEGNFPVTQFDKNDVETA
DPO3A_SALTY     -IYEADEE---VRALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYA
DPO3A_BUCAI     ---------EDVKNLIDIAKKLEGTNRNIGKHAGGVVISPTKITDFCPLYCDEKGNNPVTQFDKNDIEYI
DPO3A_PSEAE     -----DEEAAEI---WEMALKLEGITRGTGKHAGGVVIAPTKLTDFSPIACDEEGGGLVTQFDKDDVEAA
DPO3A_PASMU     AVYDSDEE---VKALIDMARKLEGVTRNAGKHAGGVVISPGLITDFSPLYCDSEGKHPVTHFDKNDVEYA
DPO3A_NEIMB     XXXXXXXXXKK----------LEDLTRGLGMHAGGVLIAPGKISDYSPVYQADESASPVSMYDKGDVEDV
DPO3A_CAMJE     ----IDRHPKGLE-VWEYARALEGLNRNAGMHAAGVVISNESLWKKTPLFRQSKNDHLVTQYSKDHLEDV
DPO3A_THEAQ     -------KDERIRQVIEVAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMRD-QEGRPVTQYDMGAVEAL
DPO3A_NEIMA     XXXXXXXXXKK----------LEDLTRGLGMHAGGVLIAPGKISDYSPVYQADESASPVSMYDKGDVEDV
DPO3A_BUCAP     ELYTLYKSDEDIQNLIDVSKKLEGVNRNVGKHAGGVVISPSKITDFCPVYCDEKGNNPVTQFDKNDIEYV
DPO3A_XYLFT     LIQRYQAEEDVQEL-LNLARQLEDLTRNAGKHAGGVVIAPNPLTEFCPLFENGRGKNPVTQFDKNDVEEV
DPO3A_HELPY     ---------ELAKQVWEYSLNLENLNRNAGVHAAALVVSQKELWHKTPLFASEKTGGIVTQYSMKYLEPV
DPO3A_HELPJ     ---------EVAKQVWEYSLNLENLNRNAGVHAAALVVSQKELWHKTPLFASEKTGGIVTQYSMKYLEPV
DPO3A_XYLFA     LIQRYQAEEDVQEL-LNLARQLEDLTRNAGKHAGGVVIAPNPLTEFCPLFENGRGKNPVTQFDKNDVEEV
DPO3A_BUCBP     -LYKFDKD---VRELINIAKRLEGITRNVSKHAGGVVISPKKITDFVPLYYDENGNNPVTQFDKNDIGYT
DPO3A_BACSU     -------ESSLLQQVYSIARKIEGLPRHASTHAAGVVLSEEPLTDVVPL-QEGHEGIYLTQYAMDHLEDL
DPO3A_BACHD     -LVHASDEAQ---KVMKLARKVEGLPRHTSTHAAGVVISEQPLTEVIALQHGQGEVPLTQG-TMETVEDV
DPO3A_AQUAE     HRTDIEDESPEIKQLVETALKLEGLTRHTSLHAAGVVIAPKPLSELVPLYYDKEGE-VATQYDMVQLEEL
DPO3A_CHLTR     -LYVDDAEA---AEVIDMAKKLEGSIRNTGVHAAGVIICGDPLTNHIPICVPKDSSMISTQYSMKPVESV
DPO3A_CHLPN     QLYINDAES---AQVIDMALCLEGSIRNTGVHAAGVIICGDQLTNHIPICISKDSTMITTQYSMKPVESV
DPO3A_CHLMU     -LYXXXXXXXXXXXMAKK---LEGSIRNTGVHAAGVIICGDPLTNHIPICVPKDSSMISTQYSMKPVESV
DPO3A_STRCO     SMYESEPD---VKKVIDTAKGVEGLVRQMGVHAAGVIMSSEPIVDHAPIWVRHTDGVTITQWDYPQCESL
DPO3A_DEIRA     ----LAEDAQLLE-AYEFAQKLEGLTRHASVHAAGVVIGREELTNLVPVMRDTSGEGQVCQYDMKSVEDI
DPO3A_MYCTU     GLIETDPD---VRTIYQTARGLEGLIRNAGVHACAVIMSSEPLTEAIPLWKRPQDGAIITGWDYPACEAI
DPO3A_MYCBO     GLIETDPD---VRTIYQTARGLEGLIRNAGVHACAVIMSSEPLTEAIPLWKRPQDGAIITGWDYPACEAI
DPO3A_STAAW     HRH---------ERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTG--LLTQWTMTEAERI
DPO3A_STAAS     HRH---------ERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTG--LLTQWTMTEAERI
DPO3A_STAAR     HRH---------ERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTG--LLTQWTMTEAERI
DPO3A_STAA8     --YQIDDFKEFVERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTG--LLTQWTMTEAERI
DPO3A_STAAC     HRH---------ERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTG--LLTQWTMTEAERI
DPO3A_SYNY3     ----YDNE-PWVKKWIDMAIRIEGTNKTFGVHAAGVVISSEPLDQIVPLQKN-NDGAVITQYYMEDVEAM
DPO3A_STAES     ---------HRNERWFEVSKKLEGLPRHTSTHAAGIIINDQPLFKFAPL--TTGDTGLLTQWTMTEAERI
DPO3A_STAAN     HRH---------ERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTG--LLTQWTMTEAERI
DPO3A_STAAM     HRH---------ERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTG--LLTQWTMTEAERI
DPO3A_STAEQ     ---------HRNERWFEVSKKLEGLPRHTSTHAAGIIINDQPLFKFAPL--TTGDTGLLTQWTMTEAERI
DPO3A_MYCLE     SLIETDSD---VRIIYQTARGLEGLIRNAGVHACAVILSSEPLTEAIPLWKRPQDGAIITGWDYPACEAI
DPO3A_STRP8     ----INSRTEFQKAFAIAKRI-EGNPRQTSIHAAGIVMSDDTLTNHIPL--KSGDDMMITQYDAHAVEAN
DPO3A_STRP6     ----INSRTEFQKAFAIAKRI-EGNPRQTSIHAAGIVMSDDTLTNHIPL--KSGDDMMITQYDAHAVEAN
DPO3A_STRP3     ----INSRTEFQKAFAIAKRI-EGNPRQTSIHAAGIVMSDDTLTNHIPL--KSGDDMMITQYDAHAIEAN
DPO3A_STRP1     ----INSRTEFQKAFAIAKRI-EGNPRQTSIHAAGIVMSDDALTNHIPL--KSGDDMMITQYDAHAVEAN
DPO3A_STRPY     ----INSRTEFQKAFAIAKRI-EGNPRQTSIHAAGIVMSDDALTNHIPL--KSGDDMMITQYDAHAVEAN
DPO3A_LACLA     QRFKAEVKNGKLKRIYEVARRIEGMPRQTSTHASGVVLSEESLVNYVSL--KPSEDLALTQYEAPDVEAI
DPO3A_MYCGE     -------------LIVELALAIVDFPRQSSIHASGIVIASNSLIKTIPLLQLDNNHFL-TQVSMEWLSFF
DPO3A_UREPA     TI--LKEMYLLHKELFEISKKLINAPRQIGTHAAGXXXXXXXXXXXXXXQLGIN-DRPLSQYSMEYLERF
DNAE2_AGRVS     ---NLNPDDRRXXXXXXXXXXXMGAPRHLGQHPGGFVLTHDRLDDLVPIEPSTMEDRQIIEWDKDDVEAL
DNAE2_RHOBA     ---GLDPDTPLGRRFLYLTETLIGFPRHLSQHVGGMVMTAGSLCELCVTENAAMPGRSVIQWNKDDLDDI
DPO3A_MYCPN     --------LKSFRLLWEVAREIINFPRQPSIHASGVVIVTEPLITTIPLMV-GNNNNYVTQVSMDWLEWY
DNE23_AGRT5     ---NLNPDDRRLVLTLKLAQQLMGAPRHLGQHPGGFVLTHDRLDDLVPIEPATMKDRQIIEWDKDDVEAL
DNE22_AGRT5     ---NLNPDDRRLALTLKLAQQLMGAPRHLGQHPGGFVLTHDRLDDLVPIEPATMKDRQIIEWDKDDVEAL
DNE22_RHIME     ---GLNPDDXXXXXXXXXAQQLMGAPRNLSQHPGGFVLTHDRLDDLVPIEPATMADRQVIEWDKDDIEAL
DNAE2_SYMTH     GI-----PWHKFEQLVQAAERVARFPRFIGTHLGGLVISRRPLLEVTPLQMAAKG-QVVCQFDKEYVEDX
DNAE2_PROAC     -----DDVTTLAQQVM-------GLPRHLGIHSAGMVLTREPVGRICPIEPARMFGRTVLQWDKEDCAWM
DNAE2_MYCTU     ---DVDGIPE---QVIDLATQIRNLPRHLGIHSGGMVICDRPIADVCPVEWARMANRSVLQWDKDDCAAI
DNAE2_MYCBO     ---DVDGIPE---QVIDLATQIRNLPRHLGIHSGGMVICDRPIADVCPVEWARMANRSVLQWDKDDCAAI
DNE21_RHIME     G---LDAADPLTRRVLAYASLLMNFPRHLSQHVGGFVITRDRLDEVVPIMNTAMPDRYMXXXXXXXXXXX
DNE21_AGRT5     ---NLNMEDRRLKLAFELANQLVGTPRHHSQHPGGFVLSHDRLDELVPIEPAAMNDRQIIEWDKDDIDIV
DNAE2_MYCPA     --------------VIDLANQVRNLPRHLGIHSGGMVICDRPIADVCPVEWARMENRSVLQWDKDDCAAI
DNAE2_SINMW     G---LDAADPSTRRVLAYASLLMNYPRHLSQHVGGFVITRDRLDEVVPIMNTAMPDRYMXXXXXXXXXXX
DNAE2_IDILO     HLLQFTEQ-------------LMGTPRHLSQHVGGFVIAADDLSRLVPVENASMTDRTVIQWDKTDLESL
DNAE2_DECAR     ---GLDPHAPRVEKWLAIAEALRGFPRHLTQHVGGFVISRGPLSRLVPVENAAMSARSVIQWDKDDLDAM
DNAE2_RHISN     G---LDMADPLTRRVLAYASLLMNFPRHLSQHVGGFVITRDRLDEVVPIMNTAMPDRYMIEWXXXXXXXX
DNAE2_BDEBA     ---DFGMEPGPWKMFMALAQQLHGFPRHLGIHTGGFLITQDPITEMVPVEKATMNGRYVIQWNKDDVDFL
DNAE2_PSEF5     ---GFDPQSPVLRRVLSLTGQLIGFPRHLSQHPGGFVISEQPLDHLVPVENATMAERTVIQWDKDDLDMV
DPO3A_YERPE     XXXXXDKYATKYPEAFKAACKLQSLMRGFGRHAAGMIVAGVPLVERTPV--ELRGNARCIAFDKRYCEAM
DNAE2_TERTT     GVQT---ERXXXXXXXXXXXXXXGFPRHLSQHVGGFVITQDKVSDLVPVENASMPGRTVIQWDKEDLEAM
DNAE2_BRASO     ---GLDPHNPMIRRAVELASELITFPRHLSQHVGGYVLTQDRLDSYVPIGNAAMDDRTFIEWDKDDVDAL
DNAE2_SACD2     GL-NPETQKTMQHFFALVQQIL-GFPRHLSQHVGGFIITQDKVSDLVPLENASMPDRTIIQWDKYDIEAM
DNAE2_PSEPF     ---GFDPESPLLHRVLSLTGQLIGFPRHLSQHPGGFVISEQPLDTLVPVENAAMADRTIIQWDKDDLDAV
DNAE2_SILPO     ---GLDPEDRRLALTIRLIGEIIGFPRHLSQHVGGFVITRGRLDELAPIENAAMEDRTLIEWDKDDIDTL
DNAE2_BRUSU     ---GLDPDNPIIQRAVELAITLIGFPRHLSQHVGGFVLARDRLDETVPIGPAAMDKRSFIEWDKDDIDEV
DNAE2_BRUME     ---GLDPDNPIIQRAVELAITLIGFPRHLSQHVGGFVLTRDRLDETVPIGPAAMDKRSFIEWDKDDIDEV
DNAE2_BRUAB     ---GLDPDNPIIQRAVELAITLIGFPRHLSQHVGGFVLTRDRLDETVPIGPAAMDKRSFIEWDKDDIDEV
DNAE2_PSE14     --YGFDADTPILKRVLALTGELIGFPRHLSQHPGGFVISEHPLETLVPVENAAMADRTIIQWXXXXXXXX
DNAE2_PSEU2     --YGFDADTPILKRVLALTGELIGFPRHLSQHPGGFVISEHPLETLVPVENAAMADRTIIQWXXXXXXXX
DNAE2_CORGL     ------GTSEPPDDVLELAAQFKGQPRHLGIHSGGMVICDRPIADVVPVEWARMDNRSVVQWDKDDCATA
DNAE2_RHILO     GLDRSDPTS---RHVMERANEIMGFPRHLSQHVGGFVITKDRLDEIVPIVKTAMDERKMVEWDKDDLDAV
DNAE2_CAUCR     ---GLDPKAPEIARAVGLANDLIGFPRHLSQHVGGFVLTKRRLDETVPIGKAAMKDRTFIEWDKDDIDSL
DNAE2_CAUCN     ---GLDPKAPEIARAVGLANDLIGFPRHLSQHVGGFVLTKRRLDETVPIGKAAMKDRTFIEWDKDDIDSL
DNAE2_RHOPS     ---GLDPHNPLIGRAVELATELIGFPRHLSQHVGGYVLTQDRLDSYVPIGNAAMEGRTFIEWXXXXXXXX
DNAE2_RHOP2     ---GLDPTNPMIGRAVELATELIGFPRHLSQHVGGYVLTQDRLDSYVPIGNAAMADRTFIEWDKDDIDAV
DNAE2_CORJK     AEQMLDHP------------------RHLGIHSGGMVICDRPIAQVVPTEWARMEGRSVVQWDKDDCAAV
DNAE2_VIBPA     QPESLKGQ-QFIQLVNE----IIGFPRHLSQHVGGFVISSGPLYELVPVENAAMEDRTIIQWXXXXXXXX
DNAE2_CORDI     ---------------------LKGQPRHLGIHAGGMVICDRPIADVVPTEWARKHGRSVVQWDKESCASA
DNAE2_ALHEH     GL-NPD-DPRLARTVAIAGQLL-GLPRHLSQHVGGFVISEGPISELVPTENAAMAGRTIIQWDKDDLEAL
DNAE2_PSEPK     RVLVLAGE-------------LIGFPRHLSQHPGGFVISQQPLDQLVPVENAAMPERTVIQWDKDDLDMV
DNAE2_PSESM     --YGFDAETPILKRVLALTGELIGFPRHLSQHPGGFVISEHPLDTLVPVENAAMAERTIIQWXXXXXXXX
DNAE2_COREF     -------------------------PRHLGIHSGGMVICDRPIADVVPTEWARMEGRSVVQWDKDDCAAA
DNAE2_RHOP5     ---GLDPTNPMIVRAIDLATELIGFPRHLSQHVGGYVLTQDRLDEFVPIGNAAMEERTFIEWDKDDIDAV
DNAE2_METCA     ----LASENPAVRRLLALMQMLVGFPRHLSQHVGGFVIAAEDLSHWVPVENAAMPERTVIQWDKDDLESL
DNAE2_ANADE     ---GLDADSERVRMTLALARELQGFPRHLSIHVGGFVITRRPLCETVPIEPAAMPGRTIVQWXXXXXXXX
DNAE2_RHOPA     ---GLDPHNPMIGRAVELATELIGFPRHLSQHVGGYVLTQDRLDSYVPIGNAAMADRTFIEWDKDDIDAV
DNAE2_BRAJA     ---GLDPQNPMINLAVELATELIEFPRHLSQHVGGYVLTQDRLDTYVPIGNAAMDDRTFIEWDKDDVDAL
DNAE2_NOCFA     GT---DIPEQVLRLAAD----LEGLPRHMGIHSGGMVICDRPIADVCPVEWARMAGRSVLQWDKDDCAAV
DNAE2_ANAD2     ---GLDADSERVRMTLALARELQGFPRHLSIHVGGFVITRRPLCETVPIEPAAMPGRTIVQWXXXXXXXX
DNAE2_HAHCH     -----------------------GFPRHLSQHVGGFVLSAGPLVELVPIENAAMEDRTVIQWDKDDLESL
DNAE2_ANASK     ---GLDADSERVRMTLALARELQGFPRHLSIHVGGFVITRRPLCETVPIEPAAMPGRTIVQWXXXXXXXX
DNAE2_PSEA7     ---GFDPQSAVLRRVLALTGELVGFPRHLSQHPGGFVISEQPLDTLVPVENASMVERTVIQWDKDDLDAV
DNAE2_PSEAE     ---GFDPQSPILRRVLALTDELIGFPRHLSQHPGGFVISEQPLDTLVPVENASMAERTVIQWDKDDLDAV
DNAE2_BURPS     ASVGLDPEVPLIRTWAEIAARLLNFPRHLSQHSGGFVVSRGKLTRLVPVENAAMEGRRVIQWDKDDLEAL
DNAE2_BURMA     ASVGLDPEVPLIRTWAEIAARLLNFPRHLSQHSGGFVVSRGKLTRLVPVENAAMEGRRVIQWDKDDLEAL
DNAE2_VIBVU     HFIQLVEE-------------IIGFPRHLSQHVGGFVISSGPLYELVPVENAAMPERTIIQWXXXXXXXX
DPO3A_THEMA     EIYKT----------------VYGLPHHPSVHAAGVVISENPL----PLPTRTEEDIPITDYDMYDLQEI
DNAE2_VIBVY     HFIQLVEE-------------IIGFPRHLSQHVGGFVISSGPLYELVPVENAAMPERTIIQWXXXXXXXX
DNAE2_VIBHB     QPESLKGQ-QFIQLVNE----ITGFPRHLSQHVGGFVISSGPLYELVPVENASMEDRTIIQWXXXXXXXX
DNAE2_RALSO     GQQGLDPESPLVQRWAGLIEQLRGFPRHLSQHVGGFVIAQGKLSRLVPIENAAMPERRVIQWDKDDLESL
DNAE2_GLUOX     LGLNL--KDRRLSLTFHLARLLLGFPRQLGTHPGGFVLTEDRLDELVPLMPTAMDGRQIIVWDKDDIDVL
DNAE2_AZOSE     ---GFDPASPGVQRLATLTEALVGFPRHLSQHVGGFVIARGRLDELVPVENAAMPERTVIQWXXXXXXXX
DNAE2_XANCP     ---------PLINKILAVTEHLRDHPRHLSQHVGGFVISDEPLSMLVPVENAAMADRTIIQWDKDDLETM
DNAE2_XANC8     ---------PLINKILAVTEHLRDHPRHLSQHVGGFVISDEPLSMLVPVENAAMADRTIIQWDKDDLETM
DNAE2_XANAC     ---------PLINKILAVTEHLRDHPRHLSQHVGGFVISDEPLSLLVPVENAAMANRTIIQWDKDDLETM
DNAE2_RALPJ     GQQGLDPESPLVLRWAQLVDQLRGFPRHLSQHVGGFVIAQGKLSRLVPIENAAMENRRVIQWDKDDLESL
DNAE2_XANCB     ---------PLINKILAVTEHLRDHPRHLSQHVGGFVISDEPLSMLVPVENAAMADRTIIQWDKDDLETM
DNAE2_XANOR     ---------PLINKILLVTEHLRDHPRHLSQHVGGFVISDEPLSLLVPVENAAMADRTIIQWDKDDLETM
DNAE2_XANOP     ---------PLINKILLVTEHLRDHPRHLSQHVGGFVISDEPLSLLVPVENAAMADRTIIQWDKDDLETM
DNAE2_BORPA     GL---DPASRVARQWAELAETLMGFPRHLSQHPGGFVISRGKLSRLVPIENAAMPGRSVVQWXXXXXXXX
DNAE2_AZOSB     ---GLDPASPRVAKWLDLTGMLIGFPRHLSQHVGGFVISRGPLGRLVPIENAAMPERSVIQWDKEDLEAL
DNAE2_PSEMY     ---GFDPDSPSLHRILTLAGELIGFPRHLSQHPGGFVISEHPLQTLVPVENASMAERTVIQWXXXXXXXX
DNAE2_XANC5     ---------PLINKILLVTDHLRDHPRHLSQHVGGFVISDEPLSLLVPVENAAMADRTIIQWDKDDLETM
DNAE2_BORBR     GL---DPASRVARQWAELAETLMGFPRHLSQHPGGFVISRGKLSRLVPIENAAMPGRSVVQWXXXXXXXX
YORL_BACSU      PIKEFIREVEQYPNLKETALKIEGLTNKRSSHAAGVIIFNDEYTKSNAMMKTPKG-AYITQFNMGDSEAM
DPO3_STAES      ----------------------TGVKRTTGQHPGGIIVVPMDIYDFTPIQADDQSAAWMTTHFDFHSIHD
DPO3_STAEQ      ----------------------TGVKRTTGQHPGGIIVVPMDIYDFTPIQADDQSAAWMTTHFDFHSIHD
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_BACCR      -------NAEIDRLVAGCT----GVKRTTGQHPGGIIVVPMDIFDFSPIQYPADS----IGAEWRHSIHD
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
PPAC_METJA      --------------------LIGGKKKELKPDLAGLLLSA--IISDTVLFKSPTTTDLDKEMAKKLAEIA


                         .         .         .         *         .         .         .:630
query           GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLK
DPO3A_RICCN     GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLK
DPO3A_RICFE     GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLK
DPO3A_RICTY     GLIKFDFLGLQTLTVITNCKKLLKEQGIEIDFDDMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLK
DPO3A_RICPR     GLIKFDFLGLQTLTVITNCKKLLKEQGXXXXXXXXXXXXXXXYQMLCKGKGVGVFQFESIGMKDALRRLK
DPO3A_RICBR     GLIKFDFLGLQTLTVITDCKKLLKEQNIEIDFNDMTFDDEKTYQMLCKGKGVGVFQFESVGMKDALRRLK
DPO3A_CAUCR     GLVKFDFLGLKTLTVLDRAVKHLKKRGFEIDLGKLPFDDAKTYELLASGQTVGVFQLESQGMRDTLRKMR
DPO3A_CAUCN     GLVKFDFLGLKTLTVLDRAVKHLKKRGFEIDLGKLPFDDAKTYELLASGQTVGVFQLESQGMRDTLRKMR
DPO3A_BORBU     GLVKMDFLGLKTLTLIKNAENLIRSVNPDFKIKNIPDNDVKTFNMLGEGRSASVFQFESEGMQQILKDAK
DPO3A_ECO57     GLVKFDFLGLRTLTIINWALEMINKRRAKLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQ
DPO3A_ECOLI     GLVKFDFLGLRTLTIINWALEMINKRRAKLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQ
DPO3A_ECOL6     GLVKFDFLGLRTLTIINWALEMINKRRAKLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQ
DPO3A_PSEFL     GLVKFDFLGLRTLTIIDWALKTINRDRAKVDIAFIPLDDKPTYQLLQKAETTAVFQLESRGMKELIKKLK
DPO3A_HAEIN     GLVKFDFLGLRTLTIIKWAVRMVREGKPRVDIAAIPLDDPESFELLKRSETTAVFQLESRGMKDLIKRLQ
DPO3A_TREPA     GLVKMDFLGLKTLTLIQRTQNLVRRKGTTFSISDISDQDPTTFSMLAEGKSAAVFQFESRGMQGILKRAK
DPO3A_VIBCH     GLVKFDFLGLRTLTIIDWALGLLKKAGPPVRIEAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQ
DPO3A_SALTY     GLVKFDFLGLRTLTIINWALEMINKRRAKLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQ
DPO3A_BUCAI     GLVKFDFLGLRTLTIISYATKLNLNKKRTININSIPLDDAKCFKLLKNSETTGVFQLESYGMKDLIKRLQ
DPO3A_PSEAE     GLVKFDFLGLRTLTIIKWAMEIINKKGLEVNIDFIPLDDKPTYSLLQKAETTAVFQLESRGMKELIKKLK
DPO3A_PASMU     GLVKFDFLGLRTLTIIKWATRLAKEGKPPVDIATIPLDDPASFELLKRSETTAVFQLESRGMKDLIKRLQ
DPO3A_NEIMB     GLVKFDFLGLRNLTIIEMAQNNIKNTGDIIDVGKIPLDDQVAYQIFRDANTTAVFQFESTGMKKMLKTAH
DPO3A_CAMJE     DLIKFDFLGLKTLTVINNAIKLIKKRNKDIIWETIDVNDSKVYKTIQSGNTLGIFQIESGGMQSLNARLK
DPO3A_THEAQ     GLLKMDFLGLRTLTFLDEARRIVKEKGVELDYDRLPLDDPKTFELLSRGETKGVFQLESGGMTATVRGLK
DPO3A_NEIMA     GLVKFDFLGLRNLTIIEMAQNNIKNTGDIVDVGTIPLDDQTAYQIFRDANTTAVFQFESTGMKKMLKTAH
DPO3A_BUCAP     GLLKFDFLGLRTLTII-NCKNLLLSNKKTININSIPLNESKCFLLLKKCETTGIFQLESYGMKDLVKRLQ
DPO3A_XYLFT     GLVKFDFLGLRTLTIIDWAVKAINKRHARVDITALPLDDIPTYKVFASGNTSAVFQFESSGMRRLLKDAR
DPO3A_HELPY     DLIKFDFLGLKTLTVIDDALKIIKTQKISVDFLSLDMDDPKVYKTIQSGDTVGIFQIESGMFQGLNKRLR
DPO3A_HELPJ     DLIKFDFLGLKTLTVIDDALKIIKTQNIDVDFLSLDMDDPKVYKTIQSGDTVGIFQIESGMFQGLNKRLR
DPO3A_XYLFA     GLVKFDFLGLRTLTIIDWAVKAINKRHARVDITALPLDDIPTYKIFASGNTSAVFQFESSGMRRLLKDAR
DPO3A_BUCBP     GLVKFDFLGLKTLTVIHGTVKMINNQKKLININTISLKDKNCFKFLQTAQTIAVFQLESNGMKDLIRRLK
DPO3A_BACSU     GLLKMDFLGLRNLTLIESITSMIKEENIKIDLSSISYSDDKTFSLLSKGDTTGIFQLESAGMRSVLKRLK
DPO3A_BACHD     GLIKMDFLGLRNLTLLEMVVKRVREYGHSLNVKQLPLNDAKTFALLAKGETTGVFQLESGGMRKVLRELK
DPO3A_AQUAE     GLLKMDFXXXXXXXXXXXXXXXXXRHGVDINFLELPLDDPKVYKLLQEGKTTGVFQLESRGMKELLKKLK
DPO3A_CHLTR     GMLKVDFLGLKTLTGIIATQAIYKKTGILLRAATIPLDDQNTFSLLHQGKTMGIFQMESRGMQDLAKNLR
DPO3A_CHLPN     GMLKVDLLGLKTLTSINIAMSAIKKTGQSLAMATLPLDDATTFSLLHQGKTMGIFQMESKGMQELAKNLR
DPO3A_CHLMU     GMLKVDFLGLKTLTSIVATKAIYKKTGILLQAATLPLNDRNTFSLLHQGKTMGIFQMESRGMQELAKNLR
DPO3A_STRCO     GLLKMDFLGLRNLTIMDDAVKMVKNKGIXXXXXXXXXXXXTTFELLQRGDTLGVFQFDGGPMRSLLRLMK
DPO3A_DEIRA     GLIKMDFLGLRTLSFLDEAKRILRESGTDFDFDHIPFDDEKTYELMSRGDTKGVFQLEGAGIADASRRLK
DPO3A_MYCTU     GLLKMDFLGLRNLTIIGDADNVRANRGIDLDLESVPLDDKATYELLGRGDTLGVFQLDGGPMRDLLRRMQ
DPO3A_MYCBO     GLLKMDFLGLRNLTIIGDADNVRANRGIDLDLESVPLDDKATYELLGRGDTLGVFQLDGGPMRDLLRRMQ
DPO3A_STAAW     GLLKIDFLGLRNLSIIHQITQVKKDLGINIDIEKIPFDDQKVFELLSQGDTTGIFQLESDGVRSVLKKLK
DPO3A_STAAS     GLLKIDFLGLRNLSIIHQITQVKKDLGINIDIEKIPFDDQKVFELLSQGDTTGIFQLESDGVRSVLKKLK
DPO3A_STAAR     GLLKIDFLGLRNLSIIHQITQVKKDLGINIDIEKIPFDDQKVFELLSQGDTTGIFQLESDGVRSVLKKLK
DPO3A_STAA8     GLLKIDFLGLRNLSIIHQLTQVKKDLGINIDIEKIPFDDQKVFELLSQGDTTGIFQLESDGVRSVLKKLK
DPO3A_STAAC     GLLKIDFLGLRNLSIIHQITQVKKDLGINIDIEKIPFDDQKVFELLSQGDTTGIFQLESDGVRSVLKKLK
DPO3A_SYNY3     GLLKMDFLGLKNLTTLQRAVELVAEKGIELDLDDLPLDVKKTHKLLEAGDLEGIFQLESQGMKQIVRDLK
DPO3A_STAES     GLLKIDFLGLRNLSIIHQILQVKKDLNINIDIEAIPYDDKKVFDLLSNGDTTGIFQLESDGVRSVLKRLQ
DPO3A_STAAN     GLLKIDFLGLRNLSIIHQILQVKKDLGINIDIEKIPFDDQKVFELLSQGDTTGIFQLESDGVRSVLKKLK
DPO3A_STAAM     GLLKIDFLGLRNLSIIHQILQVKKDLGINIDIEKIPFDDQKVFELLSQGDTTGIFQLESDGVRSVLKKLK
DPO3A_STAEQ     GLLKIDFLGLRNLSIIHQILQVKKDLNINIDIEAIPYDDKKVFDLLSNGDTTGIFQLESDGVRSVLKRLQ
DPO3A_MYCLE     GLLKMDFLGLRNLTIIGDAIENIKNRGIDLDLESVPLDDQATYELLGRGDTLGVFQLDGGPMRDLLRRMQ
DPO3A_STRP8     GLLKMDFLGLRNLTFVQKMEKVAKDYGCQIDIAAIDLEDPQTLALFAKGDTKGIFQFEQNGAINLLKRIK
DPO3A_STRP6     GLLKMDFLGLRNLTFVQKMEKVAKDYGCQIDIAAIDLEDPQTLALFAKGDTKGIFQFEQNGAINLLKRIK
DPO3A_STRP3     GLLKMDFLGLRNLTFVQKMEKVAKDYGCQIDIAAIDLEDPQTLALFAKGDTKGIFQFEQNGAINLLKRIK
DPO3A_STRP1     GLLKMDFLGLRNLTFVQKMEKVAKDYGCQIDITAIDLEDPQTLALFAKGDTKGIFQFEQNGAINLLKRIK
DPO3A_STRPY     GLLKMDFLGLRNLTFVQKMEKVAKDYGCQIDITAIDLEDPQTLALFAKGDTKGIFQFEQNGAINLLKRIK
DPO3A_LACLA     GLLKIDFLGLRNLTIISRLRDLVKRQKIDIDPLKINLEDEDTLALFRAGNTMGIFQFENPQMRRFLRNLA
DPO3A_MYCGE     NLNKFDLLGLINLTMISDVITQIKNQTVNQFLNTISWTDQNTFINLVNEDTLGIFQLESFGMKKLLVQIK
DPO3A_UREPA     GLIKMDLLGLKNLTIIDNVLKMIYEQNKKIDLFNINYNDKFVFEDLAKARTNGIFQLESPGMKKVLLKVK
DNAE2_AGRVS     KFMKVDVLALGMLTCMSKVFALIREKGDDLDLAKIRQEDKATYEMICKADTLGTFQIESRAQMAMLPRLK
DNAE2_RHOBA     GILKVDILALGMLSAIRRCFELVKDHNRELSLSTIPPDDTPTYDMICAADTMGVFQIESRAQMSMLPRLK
DPO3A_MYCPN     NLNKFDLLGLINLTMIHEVVQAVKPKEVSVQLQQIPLDDEATFTNLTNQATLGVFQLESFGMKKVLKQIK
DNE23_AGRT5     KFMKVDILALGMLTCMAKAFDLIREKDRDLDLSKIEQEDSVTYAMIRKADTLGTFQIESRAQMAMLPRLK
DNE22_AGRT5     KFMKVDVLALGMLTCMAKAFDLIREKGQQLDLSNIEQEDAATYAMIRKADTLGTFQIESRAQMAMLPRLK
DNE22_RHIME     KFLKVDVLALGMLTCMAKAFALISEHKHEIDLATIPQEDPATYAMIRKADTLGTFQIESRAQMSMLPRMK
DNAE2_SYMTH     XXXXXXXXXXRTFTAVDDAVRAIG----DIDYEQIPHGDAATYEMLGVGESIGVFQLESPAQRALQARLK
DNAE2_PROAC     GLVKFDLLGLGMLSALSISFDLISQHGRFWTLASIPRNEPGVYDMLCRGDSIGVFQVESRAQIGALPRLK
DNAE2_MYCTU     GLVKFDLLGLGMLSALHYAKDLVAEKGIEVDLARLDLSEPAVYEMLARADSVGVFQVESRAQMATLPRLK
DNAE2_MYCBO     GLVKFDLLGLGMLSALHYAKDLVAEKGIEVDLARLDLSEPAVYEMLARADSVGVFQVESRAQMATLPRLK
DNE21_RHIME     XXXXXXXXALGMLTCLAKGFKLLEAHYGEPITLAEIYQDHRVYDMICRADTVGVFQIESRAQMSMLPRLQ
DNE21_AGRT5     KFMKMDCLALGMLSCMKRGFDLLEARGEKYDLAAMPPDDPATFAMIQKADTLGTFQIESRAQMSMLPRLK
DNAE2_MYCPA     GLVKFDLLGLGMLSALHYAIDLVAEKGIEVDLARLDLSEPAVYEMLARADSVGVFQVESRAQMATLPRLK
DNAE2_SINMW     XXXXXXXXALGMLTCLAKGFKLLEAHYGEPITLAEIYQDHQVYDMICRADTVGVFQIESRAQMSMLPRLQ
DNAE2_IDILO     GLLKVDVLALGMLTALRKMLALINRYDQQLTMATIPQEDSRVYQQLQTADSMGIFQIESRAQMNMLPRLK
DNAE2_DECAR     GLMKVDILALGMLSAIRRMLQIVGETGRPMKMQDIPAEDPATYEMLCHADSMGVFQVESRAQMAMLPRLR
DNAE2_RHISN     XXXXXXXXALGMLTCLARAFRFLEVHYGKPKTLAELYEDQQVYDMICRADTVGVFQIESRAQMSMLPRLR
DNAE2_BDEBA     RLMKIDVLSLGMLTCLRKCFDLLRDKGRDYSLATLPADDKPTYDMICRAETVGVFQIESRAQMNTLPRMQ
DNAE2_PSEF5     GLLKVDILALGMLSAIRRCFDLIHYRGQRYSLASIPPEDPATYEMIGRADTIGVFQIESRAQMSMLPRLK
DPO3A_YERPE     GLIKXXXXXXXXXXXXXSAKRYIKESGEDINLDAIPLDDRKVLDGFAAGYTQGVFQLESGPMRKLLKDLE
DNAE2_TERTT     GLLKVDILALGMLTALRKTLAMVNRYEPAISLADIPPEDPHTYDMLCAADTVGVFQIESRAQMSMLPRLR
DNAE2_BRASO     SMMKVDVLALGMLTCIRKSFDLIADKGRRYVLSDISEDDNEVYQMLQRGESLGVFQVESRAQMNMLPRLK
DNAE2_SACD2     GLLKVDVLALGMLTALRKSLETVSQYDAAVSLATIPREDPATYAMLSKGDSIGVFQVESRAQMSMLPRLR
DNAE2_PSEPF     GLLKVDILALGMLSAIRRCFDLLRHRHQDLSLATIPPEDRPTYDMISRADTIGVFQIESRAQMSMLPRLR
DNAE2_SILPO     GILKVDVLGLGMLTCIRKAFDLMREEQRHLSIDTVPQEDAATYDMLCAADAVGVFQVESRAQMNFLPRMR
DNAE2_BRUSU     GLMKVDVLSLGMLTCIRKAFDLIHQHGEKLTLASLPREDKAVYDMLCKGDSLGVFQVESRAQMNMLPRLR
DNAE2_BRUME     GLMKVDVLSLGMLTCIRKAFDLIHQHGEKLTLASLPRKDKAVYDMLCKGDSLGVFQVESRAQMNMLPRLR
DNAE2_BRUAB     GLMKVDVLSLGMLTCIRKAFDLIHQHGEKLTLASLPRKDKAVYDMLCKGDSLGVFQVESRAQMNMLPRLR
DNAE2_PSE14     XXXXXXXXALGMLSALRRTFDLVHHRGKRWTLADLPGDDRETYEMISRADTIGVFQIESRAQMAMLPRLR
DNAE2_PSEU2     XXXXXXXXALGMLSALRRTFDLVHHRGQRWTLATLPGDDRKTYEMISRADTIGVFQIESRAQMAMLPRLR
DNAE2_CORGL     GLVKFDLLGLGMLEAIHHMLDLVAERGKKINLWELDLAEPEVYDMLCKADAVGVFQVESRAQLSTLPRLK
DNAE2_RHILO     KILKVDVLALGMLTCLQRAFILLTDHGQPYVLASLPPEDKRVYDMIGRADTLGVFQIESRAQMSMLPRLK
DNAE2_CAUCR     GLMKVDILALGMLHAIQRAMTMLREQDWLKDLADIPKEVPGVYDMLCAADSVGVFQVESRAQMSMLPRLR
DNAE2_CAUCN     GLMKVDILALGMLHAIQRAMTMLREQDWLKDLADIPKEVPGVYDMLCAADSVGVFQVESRAQMSMLPRLR
DNAE2_RHOPS     XXXXXXVLALGMLTCIRKGFDLIQHKGVRYALSDISEDDNAVYQMLQRGESIGVFQVESRAQMNMLPRLK
DNAE2_RHOP2     KMMKVDVLALGMLTCIRKGFDLIQHKGVRFQLSDISEDDNNVYQMLQRGESIGVFQVESRAQMNMLPRLK
DNAE2_CORJK     GLVKFDLLGLGMLEALHHAVDQVRHRGREVELWRLDPTESEVYAMLSRADAVGVFQVESRAQMSTLPRLK
DNAE2_VIBPA     XXXXXXXXALGMLNAIRKCFQLIEQRSLSIAEITRRQDDPHVYRMLQKADTVGVFQIESRAQMSMLPRLK
DNAE2_CORDI     GLVKFDLLGLGMLEALHHMIDLVVETGTTINLWEIDLAEPEIYTMLSNGDAVGVFQVESRAQLATLPRLR
DNAE2_ALHEH     GLLKVDVLALGMLSCIRRAFDLLAGRGRRLTLADVPAEDPAVYRMISDADTMGVFQIESRAQMAMLPRLR
DNAE2_PSEPK     GLLKVDVLALGMLSALRRCDQLQHHRGRHLTLATIPSEDPATYAMISRAETMGVFQIESRAQMAMLPRLR
DNAE2_PSESM     XXXXXXXXALGMLSALRRTFDLVHHRGKQWTLASLPGDDRPTYEMISRADTIGVFQIESRAQMAMLPRLR
DNAE2_COREF     GLVKFDLLGLGMLEALHHMMDLVHHRGITVNLWELDLADAGVYDMLCRADAVGVFQVESRAQMSTLPRLK
DNAE2_RHOP5     KMMKVDVLALGMLTCIRKGFDLIQHKGKRYELADISEDDNEVYKMLQRGESVGVFQVESRAQMNMLPRLR
DNAE2_METCA     GLLKVDVLSLGMLTAIRKALAYVGERGRPFTLADVPPEDPAVYEMLQRADSIGVFQVESRAQMSMLPRLR
DNAE2_ANADE     XXXXXXXXXXXXXTXXXXXXXXXXXXXXXXXLATIPAEDPEVYEMLGRADSIGVFQVESRAQMSLAPRLR
DNAE2_RHOPA     KMMKVDVLALGMLTCIRKGFHLIQHKGVRFQLSDISEDDNAVYKMLQRGESIGVFQVESRAQMNMLPRLK
DNAE2_BRAJA     NMMKVDVLALGMLTCIRKCFDLIQHKGERWVLASVPQDDPKVYDMLCDGESLGVFQVESRAQMNMLPRLK
DNAE2_NOCFA     GLVKFDMLGLGMLSALHYMIDLVREEGVEVRLHELDLKEPAVYEMLSRADSVGVFQVESRAQMATLPRLR
DNAE2_ANAD2     XXXXXXXXXXXXXTXXXXXXXXXXXXXXXXXLATIPAEDPEVYEMLGRADSIGVFQVESRAQMSLAPRLR
DNAE2_HAHCH     GLMKVDVLALGMLTALKKCTTYISETGKTFSLESIKEEDSQVYDMLQRADTVGLFQVESRAQMNMLPRLR
DNAE2_ANASK     XXXXXXXXXXXXXTXXXXXXXXXXXXXXXXXLATIPAEDPEVYEMLGRADSIGVFQVESRAQMSLAPRLR
DNAE2_PSEA7     GLLKVDVLALGMLSALRRSFDLLHEGGERLSLASIPSEDPATYAMISRADTIGVFQIESRAQMAMLPRLR
DNAE2_PSEAE     GLLKVDVLALGMLSALRRSFDLIHRGGKRLSIASIPSEDPATYEMISRADTIGVFQIESRAQMAMLPRLR
DNAE2_BURPS     GLMKVDVLALGMLSMITAWRGPPLPDGRPFRLEHIPQDDEATYDMICRADTVGVFQIESRAQMSMLPRLR
DNAE2_BURMA     GLMKVDVLALGMLSMITAWRGPPLPDGRPFRLEHIPQDDEATYDMICRADTVGVFQIESRAQMSMLPRLR
DNAE2_VIBVU     XXXXXXXXXXGMLTAIRKCFLSIEQQRLSIADITRRQDDQAVYKMIQKADTIGVFQIESRAQMSMLPRLK
DPO3A_THEMA     GVVKIDILGLKTLSFIKDFKKEIFD-----------YSDEKTYHLISKGKTLGVFQLEGLQARKLCRRIS
DNAE2_VIBVY     XXXXXXXXXXGMLTAIRKCFRSIEQQRLSIADITRRQDDQAVYKMIQKADTIGVFQIESRAQMSMLPRLK
DNAE2_VIBHB     XXXXXXXXALGMLNAIRKCFQLVEQRSLSIAEITRLQDDPHVYRMIQKADTVGVFQIESRAQMSMLPRLK
DNAE2_RALSO     RLLKVDVLALGMLTAIRRTLDMLDAAPDKLAMQHLPDEDTATYEMICRAETIGVFQIESRAQQSMLPRLR
DNAE2_GLUOX     RFMKVDVXXXXXXXXXXXXFELLHTYQTRMDLAAIPAEDPQTYRMVQKADTLGTFQIESRAQMSMLPRMK
DNAE2_AZOSE     XXXXXXVXXXXXXXXXXXXXXXVSTRGRPFTLADIPREAPEVYRMLSEADSIGVFQIESRAQMTMLPRLK
DNAE2_XANCP     KLLKVDCLALGMLTCIRKTLDLVRHRGRDYTIATLPGEDAATYKMIQRADTVGVFQIESRAQMAMLPRLK
DNAE2_XANC8     KLLKVDCLALGMLTCIRKTLDLVRHRGRDYTIATLPGEDAATYKMIQRADTVGVFQIESRAQMAMLPRLK
DNAE2_XANAC     KLLKVDCLALGMLTCIRKTLDLVRHRGRNYSIATLPGGDAPTYKMIQRADTVGVFQIESRAQMAMLPRLK
DNAE2_RALPJ     RLLKVDVLALGMLTAIRRTLDMVDAATAKLAMQNLPDDDTETYDMICRAETIGVFQIESRAQQSMLPRLR
DNAE2_XANCB     QLLKVDCLALGMLTCIRKTLDLVRHRGRDYTIATLPGEDAATYKMIQRADTVGVFQIESRAQMAMLPRLK
DNAE2_XANOR     KLLKVDCLALGMLTCIRKTLDLVRHRGRDYSIATLPGEDLPTYKMIQRADTVGVFQIESRAQMAMLPRLK
DNAE2_XANOP     KLLKVDCLALGMLTCIRKTLDLVRHRGRDYSIATLPGEDLPTYKMIQRADTVGVFQIESRAQMAMLPRLK
DNAE2_BORPA     XXXXXXXXXXGMLSVXXXXXXXXXXXXXXXXXHEIPPDDDATYDMICAADTIGVFQIESRAQMSMLPRLR
DNAE2_AZOSB     GLLKVDVLALGMLSVIRRSLELVRRRGAPFALPHIPPKDAATFDMLCAADSVGVFQVESRAQMAMLPRLR
DNAE2_PSEMY     XXXXXXXXALGMLSALRRCFALIERRGTRWTLASLPQEDAATYAMISRADTVGVFQIESRAQMAMLPRLR
DNAE2_XANC5     KLLKVDCLALGMLTCIRKTLDLVRHRHRDYTLATLPDEDAATYKMIQRADTVGVFQIESRAQMAMLPRLK
DNAE2_BORBR     XXXXXXXXXXGMLSVXXXXXXXXXXXXXXXXXHEIPPDDDATYDMICAADTIGVFQIESRAQMSMLPRLR
YORL_BACSU      GSVKFDLLTIEALDKIVTLDQLIENNEIEIHPDVIEYEDDKLWEMAGNGEIMDLFQFSTEVGHQSVVKVK
DPO3_STAES      NVLKLDILGHDDPTMI----RMLQDLS-GIDPKTIPVDDKETMQILCKTGTFGVPEFGTGFVRQMLEDTK
DPO3_STAEQ      NVLKLDILGHDDPTMI----RMLQDLS-GIDPKTIPVDDKETMQILCKTGTFGVPEFGTGFVRQMLEDTK
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_BACCR      NLLKLDILGHDDPTVI----RMLQDLS-GIDPKTIPTDDPEVMQINCKTGTLGIPEFGTKFVRQMLEETK
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
PPAC_METJA      GISNIEEFGMEILKAKSVVGKLKPEEIINMDFKNFDFN----------GKKVGIGQVEVIDVSEV--ESK


                         .         +         .         .         .         .         *:700
query           PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLQPILEETYGVVIYQEQVQRIAQVLAGYT
DPO3A_RICCN     PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLQPILEETYGVVIYQEQVQRIAQVLAGYT
DPO3A_RICFE     PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQILAGYT
DPO3A_RICTY     PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHKLLKPILEETYGVVIYQEQVQRIAQVLAGYT
DPO3A_RICPR     PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHKLLEPILEETYGVVIYQEQVQRIAQVLAGYT
DPO3A_RICBR     PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQVLAGYT
DPO3A_CAUCR     CGSIEEITALISLYRPGPMDNIDTFVDCKFGRKPVDTLHPSLEAVLKETYGVIVYQEQVMQIAQILAGYS
DPO3A_CAUCN     CGSIEEITALISLYRPGPMDNIDTFVDCKFGRKPVDTLHPSLEAVLKETYGVIVYQEQVMQIAQILAGYS
DPO3A_BORBU     PDSIEDLIALNALYRPGPMQFIPQFIAAKKGVKRIKYPHPDLKEVLRPTYGVIVYQEQVMEVAKIIGGFS
DPO3A_ECO57     PDCFEDMIALVALFRPGPLQSVDNFIDRKHEISYPDWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYT
DPO3A_ECOLI     PDCFEDMIALVALFRPGPLQSVDNFIDRKHEISYPDWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYT
DPO3A_ECOL6     PDCFEDMIALVALFRPGPLQSVDNFIDRKHEISYPDWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYT
DPO3A_PSEFL     LDCLEDLIALVALFRPGPLQSVDDFINRKHAYPHPDYQYEGLQPVLAPTYGIILYQEQVMQIAQVMAGYT
DPO3A_HAEIN     PDCFEDIIALVALFRPGPLQSVDNFIDRKHEVSYPDYQHASLKPILEPTYGIILYQEQVMQIAQVLAGYT
DPO3A_TREPA     PSKMEDLIALNALYRPGPMAFIDQYIESKRDPGKIKYPDPCLEDILSETYGVIVYQEQVMQVAQRIAGFS
DPO3A_VIBCH     PDCFEDIIALVALFRPGPLQSVDNFIDRKHAISYPDWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYT
DPO3A_SALTY     PDCFEDMIALVALFRPGPLQSVDNFIDRKHELSYPDWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYT
DPO3A_BUCAI     PDCFEDMIALVALFRPGPLQSVDNFINRKHNISYPDWQHILLKPILESTYGIILYQEQVMEIAQVLSGYT
DPO3A_PSEAE     PDCLEDLIALVALFRPGPLQSVDDFINRKHSYPHPDYQYAGLEPVLKPTYGIILYQEQVMQIAQVMAGYT
DPO3A_PASMU     PDCFEDIIALVALFRPGPLESVQNFIDRKHAYPDPEYQHDSLKPILEPTYGVIVYQEQVMQIAQELAGYT
DPO3A_NEIMB     TTKFEELIAFVSLYRPGPMDNIPDFVA-RMKGQEFQYIHPLLEGILAPTYGIMVYQEQVMQAAQIIGGYS
DPO3A_CAMJE     PERFEDIIAVLALYRPGPMESLDDFIDRKHGLKSIEYPFDSLEKVLEPTYGVIVYQEQVMQIVQIIGGFS
DPO3A_THEAQ     PRRLEDIIALVSLYRPGPMEHIPTYIR-RHHGQEPPHAEKYLRPILDETYGIPVYQEQIMQIASQVAGYS
DPO3A_NEIMA     TTKFEELIAFVSLYRPGPMDNIPDFVA-RMKGQEFQYIHPLLEGILAPTYGIMVYQEQVMQAAQIIGGYS
DPO3A_BUCAP     PDCFEDIIALIALFRPGPLQSVDNFINRKHEISYPDWQHILLKPVLESTYGIILYQEQVMQIAQILAGYT
DPO3A_XYLFT     PDRFEDLIALVSLYRPGPMDLIPEFTARKHGVQETIYPDPRTKNILKDTYGIMVYQEQVMQMAQIVGGYS
DPO3A_HELPY     PSSFEDIIAIIALGRPGPMESVDDFVNRKHGVEPIAYAFKELEPILKPTYGTIVYQEQVMQIVQTIGGFS
DPO3A_HELPJ     PSSFEDIIAIIALGRPGPMESVDDFVNRKHGVEPIAYAFKELEPILKPTYGTIVYQEQVMQIVQTIGGFS
DPO3A_XYLFA     PDRFEDLIALVSLYRPGPMDLIPEFTARKHGVQETIYPDPRTKNILKDTYGIMVYQEQVMQMAQIVGGYS
DPO3A_BUCBP     PDSFEDLVALVALFRPGPLQSVDNFINRKHKILYPECQHALLKPILKSTYGIILYQEQVMKIVQVFANYT
DPO3A_BACSU     PSGLEDIVAVNALYRPGPMENIPLFIDRKHGRAPVHYPHEDLRSILEDTYGVIVYQEQIMMIASRMAGFS
DPO3A_BACHD     PNTFADIVAVNALYRPGPMEFIPDYIQGKEGTKEITYLHPDLEPILSSTYGVIVYQEQIMQIAAKMAGFS
DPO3A_AQUAE     PDSFDDIVAVLALYRPGPLKSVDTYIKRKHGKEPVEYPFPELEPVLKETYGVIVYQEQVMKMSQILSGFT
DPO3A_CHLTR     PDAFEEIIAIGALYRPGPMDMIPSFINRKHGKENIEYDHPLMEPILKETFGIMVYQEQVMQIAGSLAKYS
DPO3A_CHLPN     PDLFEEIIAMGALYRPGPMDMIPSFINRKHGKEIIEYDHPLMESILKETYGIMVYQEQVMQIAGALASYS
DPO3A_CHLMU     PDAFEEIIAIGALYRPGPMDMIPSFINRKHGKENIEYDHPLMEPILKETFGIMVYQEQVMQIAGSLAKYS
DPO3A_STRCO     PDNFEDISAVSALYRPGPMDSHTNYALRKNGLQEITPIHEPLQEVLAVTYGLIVYQEQVQKAAQIIAGYS
DPO3A_DEIRA     PRRLADIIALSALYRPGPMENIPTYVRRHHGIEEVDYSKQWLEKILQETYGIPVYQEQIMQIASEVAGYS
DPO3A_MYCTU     PTGFEDVVAVIALYRPGPMNAHNDYADRKNNRQAIKPIHEPLREILAETYGLIVYQEQIMRIAQKVASYS
DPO3A_MYCBO     PTGFEDVVAVIALYRPGPMNAHNDYADRKNNRQAIKPIHEPLREILAETYGLIVYQEQIMRIAQKVASYS
DPO3A_STAAW     PEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQYLHPHLEPILKNTYGVIIYQEQIMQIASTFANFS
DPO3A_STAAS     PEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQYLHPHLEPILKNTYGVIIYQEQIMQIASTFANFS
DPO3A_STAAR     PEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQYLHPHLEPILKNTYGVIIYQEQIMQIASTFANFS
DPO3A_STAA8     PEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQYLHPHLEPILKNTYGVIIYQEQIMQIASTFANFS
DPO3A_STAAC     PEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQYLHPHLEPILKNTYGVIIYQEQIMQIASTFANFS
DPO3A_SYNY3     PSGIEDISSILALYRPGPLDAIPIFINRKHGREEISYQHKLLEPILNETYGVLVYQEQIMKMAQDLADYS
DPO3A_STAES     PEHFEDIVAVTSLYRPGPMEEIPTYITRRHNPNQVAYLHPDLEPILKNTYGVIIYQEQIMLIASQVAGFS
DPO3A_STAAN     PEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQYLHPHLEPILKNTYGVIIYQEQIMQIASTFANFS
DPO3A_STAAM     PEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQYLHPHLEPILKNTYGVIIYQEQIMQIASTFANFS
DPO3A_STAEQ     PEHFEDIVAVTSLYRPGPMEEISTYITRRHNPNQVAYLHPDLEPILKNTYGVIIYQEQIMLIASQVAGFS
DPO3A_MYCLE     PTGFEDIVAVLALYRPGPMNAHNDYADRKNNRQVIKPIHEPLREILAETYGLIVYQEQIMRIAQKVAGYS
DPO3A_STRP8     PQRFEEIVATTSLNRPGASDYTTNFIKRREGQEKIDLIDPVIAPILEPTYGIMLYQEQVMQIAQVYAGFT
DPO3A_STRP6     PQRFEEIVATTSLNRPGASDYTTNFIKRREGQEKIDLIDPVIAPILEPTYGIMLYQEQVMQIAQVYAGFT
DPO3A_STRP3     PQRFEEIVATTSLNRPGASDYTTNFIKRREGQEKIDLIDPVIAPILEPTYGIMLYQEQVMQIAQIYAGFT
DPO3A_STRP1     PQRFEEIVATTSLNRPGASDYTTNFIKRREGQEKIDLIDPVIAPILEPTYGIMLYQEQVMQIAQVYAGFT
DPO3A_STRPY     PQRFEEIVATTSLNRPGASDYTTNFIKRREGQEKIDLIDPVIAPILEPTYGIMLYQEQVMQIAQVYAGFT
DPO3A_LACLA     PSKFDDIVDATSIFRPGPSQFIPQFVARRHGKEIVPTVDDSISEILKPTYGIMIYQEQIMQVAQAFAGFS
DPO3A_MYCGE     PKTINQLAIVLALYRPGAQDNINLFINRLHNGYDQSDIDPRILPIVKNTYGVLIFQEQIINIVKVVANYS
DPO3A_UREPA     PQNIEDISIVSALFRPGPQQNIKTFVERRFKREEFSYWNEATRKILEPTYGIIVYQEQVIELVKTIANFD
DNAE2_AGRVS     PKTFYDLVVQVAIVRPGPIQGVHPYLRRREKKEDVDYPTPELEAVLGKTLGVPLFQESAMRVAMVCAGFT
DNAE2_RHOBA     PRCYYDLVIEVAIVRPGPIQGVHPFLAARENPAAAKYPNDAIRKVLEKTLGVPIFQEQAMKLAVVAAGFT
DPO3A_MYCPN     PHNLHDLAIVLALYRPGPQDNINTFIANRNLGFDTSDIDPRILPILKETYGVLIFQEQVINIAKTVANYS
DNE23_AGRT5     PRTFYDLVVQVAIVRPGPIQGVHPYLRRREGKEAVEYPTPELEAVLGKTLGVPLFQESAMRVAMVCAGFT
DNE22_AGRT5     PRTFYDLVVQVAIVRPGPIQGVHPYLRRREGKEPVEYPTPELEAVLGKTLGVPLFQESAMRVAMVCAGFT
DNE22_RHIME     PRTFYDLVIQVAIVRPGPIQGVHPYLRRREGKEKVEYPTPELEAVLHKTLGVPLFQESAMRVAMVCAGFT
DNAE2_SYMTH     PDRFEDIVASVAIIRPGPIKGVEPFLARRHGKEEVTYLHPKLKPILEKTYGVVLFQEQVIEIATAVAGFT
DNAE2_PROAC     PRCFYDLAVEIGLIRPGPVQGVHPYIRRRTGVEPVTYPHPLLEPVLERTLGIPLFQEQLMQMATTVGNCT
DNAE2_MYCTU     PRVFYDLVVEVALIRPGPIQSVHPYIRRRNGVDPVIYEHPSMAPALRKTLGVPLFQEQLMQLAVDCAGFS
DNAE2_MYCBO     PRVFYDLVVEVALIRPGPIQSVHPYIRRRNGVDPVIYEHPSMAPALRKTLGVPLFQEQLMQLAVDCAGFS
DNE21_RHIME     PREMYDLVIEVAIVRPGPIQGNMVHPYLKRREAQRRYPSPELKAVLERTLGVPLFQEQAMQIAITAAGFS
DNE21_AGRT5     PAKFYDLVIQVAIVRPGPIQGVHPYLRRRQGKEPVLYEKPQLENILKKTLGVPLFQEQAMRIAMDCADFT
DNAE2_MYCPA     PRVFYDLVVEVALIRPGPIQSVHPYIRRRNGVDPVLYDHPSMEPALRKTLGVPLFQEQLMQLAVDCAGFS
DNAE2_SINMW     PREMYDLVIEVAIVRPGPIQGNMVHPYLKRKGEKVKYPSPELKAVLERTLGVPLFQEQAMQIAITAAGFS
DNAE2_IDILO     PKTFYDLVIQIAIVRPGPIQGVHPFLRRRAGLEEVDYPSDEVKSVLERTLGVPIFQEQVIKLAMVAAGFS
DNAE2_DECAR     PQNFYDLVVEVALVRPGPIQGVHPYLKRRQGRERIEEISPAVDAVLERTYGVPIFQEQVMQLAVVAANFT
DNAE2_RHISN     PREMYDLVIEVAIVRPGPIQGVHPYLEAQRKGEPVDYPSPELKAVLERTLGVPLFQEQAMQIAITAAGFS
DNAE2_BDEBA     PRNFYDLVIEIALIRPGPLQGGMVHPFLKLRQNPPKYAHPALEPILKKTMGIPIFQEQVMKMVVAVADFT
DNAE2_PSEF5     PQNFYDLVIEVAIVRPGPIQGVHPYLRRRNRQEPETYPSPELEGVLKRTLGVPLFQEQVMQIAIVAADYT
DPO3A_YERPE     PMSFKTVVATTALFRPGPIQSLDDYVSVAKGFMAPQSLHPVLDELTAETNGVILYQEQTMNATRLLAGFT
DNAE2_TERTT     PRTFYDLVIEIAIVRPGPIQGVHPYLRRRDGLEPVSYQSPDIADVLKPTLGVPIFQEQAIRLAMVAAGFS
DNAE2_BRASO     PRTFYDLVIEVAIVRPGPIQGVHPYLRRRNKLEKVTYPSDELYKVLHKTLGVPLFQEQAMRIAIEAAKFS
DNAE2_SACD2     PKCFYDLVIEIAIVRPGPIQGVHPYLRRRDGIEEVHYQNDKIKSVLEPTLGIPIFQEQAIRLAMVAADFS
DNAE2_PSEPF     PQTFYDLVIEVAIVRPGPIQGVHPYLRRRNKXXXXXXXXXXXXVVLKRTLGVPLFQEQVMQIAIVAADYS
DNAE2_SILPO     PRTFYDLVIEVAIVRPGPIQGVQPYIRRRQGLEKAEPFGPELAAVTARTLGVPLFQEQALQIAVVGAGYT
DNAE2_BRUSU     PQEFYDLVIEVAIVRPGPIQGDMVHPYLRRRLPSPSPQHNELQQILGKTKGVPLFQEQAMRIAMEAAKFT
DNAE2_BRUME     PQEFYDLVIEVAIVRPGPIQGDMVHPYLRRRLPSPSPQHNELQQILGKTKGVPLFQEQAMRIAMEAAKFT
DNAE2_BRUAB     PQEFYDLVIEVAIVRPGPIQGDMVHPYLRRRLPSPSPQHNELQQILGKTKGVPLFQEQAMRIAMEAAKFT
DNAE2_PSE14     PEKFYDLVIEVAIVRPGPIQGVHPYLRRRNKEEAITYPPK-LKSVFERTLGVPLFQEQVMEVAIIAAGYT
DNAE2_PSEU2     PEKFYDLVIEVAIVRPGPIQGDMVHPYLRRRNGEEDVTYPKLESVFKRTLGVPLFQEQVMEVAILAADYT
DNAE2_CORGL     PRTFFDLVVEVALIRPGPIQSVHPYLRRRAGEEAITYDHPVLEKSLGKTLGIPLFQEQLMQVAVDAAGFS
DNAE2_RHILO     PKDFYDLVIEVAIVRPGPIQGVHPYLRRRQGKEKPEYQKPELEAILSKTLGVPLFQEQAMKIAIVAGGFR
DNAE2_CAUCR     PREFYDLVIQVAIVRPGPIQGVHPYLKRRNKEEPVDWPKDELQEILGKTFGVPLFQEQAMSLAIEAAKFT
DNAE2_CAUCN     PREFYDLVIQVAIVRPGPIQGVHPYLKRRNKEEPVDWPKDELQEILGKTFGVPLFQEQAMSLAIEAAKFT
DNAE2_RHOPS     PKCFYDLVIEVAIVRPGPIQGDMVHPYLRRRNKQEPVVYPALEVILGKTLGVPLFQEQAMRIAIEAAHFT
DNAE2_RHOP2     PRCFYDLVIEVAIVRPGPIQGDMVHPYLRRRNGQEPVVYNELQQILGKTLGVPLFQEQAMRIAIEAAHFT
DNAE2_CORJK     PRTFYDLVVEVALIRPGPIQSVHPYIRRRNGLEPVTFDHPCLEPALTKTLGIPLFQEQLMQMAVDAAGFS
DNAE2_VIBPA     PACYYDLVIQIAIVRPGPIQGVHPFLKRRNGEEPVSYPSEAVKSVLERTMGVPIFQEQVIKLAMVAAGFS
DNAE2_CORDI     PREFFDLVVEVALVRPGPIQSVHPYIRRRNGLEAVTYEHPILERSLRKTLGVPLFQEQLMHIAVDAAGFS
DNAE2_ALHEH     PQTFYDLVIEVAIVRPGPIQGVHPYLRRREGLEPVDYPSEAVRGVLARTLGVPIFQEQVMQLAVVAAGFT
DNAE2_PSEPK     PQKFYDLVIEVAIVRPGPIQGVHPYLRRRLKQEPVTYPSPQLKEVFERTLGVPLFQEQVMELAMVAADYT
DNAE2_PSESM     PEKFYDLVIEVAIVRPGPIQGVHPYLRRRNKEEAITYPPK-LKSVFERTLGVPLFQEQVMEVAIIAADYT
DNAE2_COREF     PRTFFDLVVEVALIRPGPIQSVHPYLRRRSGEEAVTYDHPVLEKSLGKTLGIPLFQEQIMQIAVDAAGFT
DNAE2_RHOP5     PRCFYDLVIEVAIVRPGPIQGDMVHPYLRRRNGQEPVVYNELKTILGKTLGVPLFQEQAMRIAIEAAHFT
DNAE2_METCA     PQSYYDLVIQIAIVRPGPIQGVHPYLTRRAGLEPVSYPSPAVEKVLKRTLGVPIFQEQVMQLAMVAAGFT
DNAE2_ANADE     PRNFYDLVISVAIIRPGPIQGIHPYLRRRDGKEQVRYPYAPLEPVLARTLGVPLFQEQAMRLAVIAAGFT
DNAE2_RHOPA     PRCFYDLVIEVAIVRPGPIQGDMVHPYLRRRNGQEPVVYNELRQILGKTLGVPLFQEQAMRIAIEAAHFT
DNAE2_BRAJA     PRTFYDLVIEVAIVRPGPIQGVHPYLRRRNGQEKVNYPSDELYKVLHKTKGVPLFQEQAMRIAIEAAKFT
DNAE2_NOCFA     PREFYDLVVEVALIRPGPIQSVHPYIRRRNGTEPVTYDHPALENSLGRTLGVPLFQEQLMQMAVDVAGFT
DNAE2_ANAD2     PRNFYDLVISVAIIRPGPIQGIHPYLRRRDGKEQVRYPYAPLEPVLARTLGVPLFQEQAMRLAVIAAGFT
DNAE2_HAHCH     PEKYYDLVVQVAIVRPGPIDMVHPYLRRRHNLEDPDDVPPELKPILKRTFGVPIFQEQVIAIAIVGAGFT
DNAE2_ANASK     PRNFYDLVISVAIIRPGPIQGIHPYLRRRDGKEQVRYPYAPLEPVLARTLGVPLFQEQAMRLAVIAAGFT
DNAE2_PSEA7     PEKFYDLVIQVAIVRPGPIQGVHPYLRRRNGEEPVAYPSVELEKVFERTLGVPLFQEQVMELAIVAADYS
DNAE2_PSEAE     PQKFYDLVIQVAIVRPGPIQGVHPYLRRRNGEEPVAYPSAELEEVFERTLGVPLFQEQVMELAIVAADYT
DNAE2_BURPS     PRGYYDLVVQVSIVRPGPIQGGAVHIAAGEAHGEITYPSEALERVLERTLGIPIFQEQVMQIAIVAAGFT
DNAE2_BURMA     PRGYYDLVVQVSIVRPGPIQGGAVHIAAGEAHGEITYPSEALERVLERTLGIPIFQEQVMQIAIVAAGFT
DNAE2_VIBVU     PACYYDLVIQIAIVRPGPIQGVHPFLKRRDGEEPISYPSVHVQEVLERTLGVPIFQEQVIKLAMVAAGFS
DPO3A_THEMA     PRNMDELSILLALNRPGPLRSGLDVMFSNSK-NVPAFFRKMFP----ETRGVLIYQEQIMRLA-MFAGLS
DNAE2_VIBVY     PACYYDLVIQIAIVRPGPIQGVHPFLKRRDGEEPISYPSVHVQEVLERTLGVPIFQEQVIKLAMVAAGFS
DNAE2_VIBHB     PARYYDLVVQIAIARPGPIQGVHPFLKRRNGEEPISYPSEEVKSVLERTMGVPIFQEQVIKLAMVAAGFS
DNAE2_RALSO     PRTYYDLVIQVAIVRPGPIQGVHPYLQRREAVRNPDYPGPEVKAVLERTLGVPIFQEQVMEIAMKAGGFT
DNAE2_GLUOX     PATFYDLVIQVAIVRPGPIQGVHPYLRRREKLEPVTYPSETLRGILGKTLGVPLFQEQAMQVAIHCAGFT
DNAE2_AZOSE     PARFYDLVVQVAIVRPGPIQGVHPYLQARARIERDEPVSDDVRRVLERTLGVPIFQEQVMQLAVVAAGFT
DNAE2_XANCP     PREFYDLVIEVAIVRPGPIQGVHPYLRRRQGYEPVSFPSPGVEEILGRTLGIPLFQEQVMELV-IHAGYT
DNAE2_XANC8     PREFYDLVIEVAIVRPGPIQGVHPYLRRRQGYEPVSFPSPGVEEILGRTLGIPLFQEQVMELV-IHAGYT
DNAE2_XANAC     PAAFYDLVIEVAIVRPGPIQGVHPYLRRRQGREEVNYPSPAVEDILKPTLGVPLFQEQVMELLMHAADYS
DNAE2_RALPJ     PREYYDLVIQVAIVRPGPIQGVHPYLQRREAKRNGNYPGPEVKAVLERTLGVPIFQEQVMEIAMKAGDFT
DNAE2_XANCB     PREFYDLVIEVAIVRPGPIQGVHPYLRRRQGYEPVSFPSPGVEEILGRTLGIPLFQEQVMELV-IHAGYT
DNAE2_XANOR     PAEFYDLVIEVAIVRPGPIQGVHPYLRRRQGREDVSYPSPAVEDILKPTLGVPLFQEQVMELLMHAADYT
DNAE2_XANOP     PAEFYDLVIEVAIVRPGPIQGVHPYLRRRQGREDVSYPSPAVEDILKPTLGVPLFQEQVMELLMHAADYT
DNAE2_BORPA     PRQYYDLVVQVAIVRPGPIQGVPPYLRRRQGREDITYPGPAVRKALARTLGVPIFQEQVMQIAVDAAGFT
DNAE2_AZOSB     PRQFYDLVVQVAIVRPGPIQGDMVHPYLTNRADPAASARTLVRAVLERTLGVPIFQEQVMKLAEVAAGFT
DNAE2_PSEMY     PKTFYDLVIQVAIVRPGPIQGVHPYLRRRNDEEPVEYPSDELRPVFARTLGVPLFQEQVMELAMVAADYS
DNAE2_XANC5     PAEFYDLVIEVAIVRPGPIQGVHPYLQRRKDKSLINYPSEGVEQILGPTLGIPLFQEQVMELV-IHAGYD
DNAE2_BORBR     PRQYYDLVVQVAIVRPGPIQGVHPYLRRRQGREDITYPGPAVRKALARTLGVPIFQEQVMQIAVDAAGFT
YORL_BACSU      PKNLLEAAVTNSLMRDGEEQPVDTYVKYKNNLNKSEKEIRVMERHLKDIYGVADTQEVVMQMVKDIANFD
DPO3_STAES      PTTFSELVQISGL-----SHGTDVWLGNAQELIRQGICD--LSSVIGCRDDIMVY----LMYAGLEPSMA
DPO3_STAEQ      PTTFSELVQISGL-----SHGTDVWLGNAQELIRQGICD--LSSVIGCRDDIMVY----LMYAGLEPSMA
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_BACCR      PTTFSELVQISGL---------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
PPAC_METJA      KEDIYKLL--------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LGAADLLRRAMGXXXXXXXXXXXXXXXXGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQT
DPO3A_RICCN     LGAADLLRRAMGXXXXXXXXXXXXXXXXGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQT
DPO3A_RICFE     LGAADLLRRAMGXXXXXXXXXXXXXXXXGAIANNISESQAKSIFATVAKFAGYGFNKAHAAAYGVISYQT
DPO3A_RICTY     LGAADLLRRAMGXXXXXXXXXXXXXXXXGAIANNISQSQAKSIFATVAKFAGYGFNKAHAAAYGVISYQT
DPO3A_RICPR     LGAADLLRRAMGXXXXXXXXXXXXXXXXGAIANNISPSQAKSIFSTVAKFAGYGFNKAHAAAYGVISYQT
DPO3A_RICBR     LGAADLLRRAMGKKIKAEMEQQEEIFVKGAIANNISEAQAKSIFATVAKFAGYGFNKAHAAAYGVISYQT
DPO3A_CAUCR     LGEADLLRRAMGKKKKEEMDLQKIRFVSGAKEKNVPEEQSGSIFELVAKFAGYGFNKSHAAAYAFISYQT
DPO3A_CAUCN     LGEADLLRRAMGKKKKEEMDLQKIRFVSGAKEKNVPEEQSGSIFELVAKFAGYGFNKSHAAAYAFISYQT
DPO3A_BORBU     LGKADILRRAMGKKKEDEMNEMKVDFLRGAIEKGYDKEIASEIFELLKPFSGYGFNKSHAAAYSLIAYQT
DPO3A_ECO57     LGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQT
DPO3A_ECOLI     LGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQT
DPO3A_ECOL6     LGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQT
DPO3A_PSEFL     LGGADMLRRAMGKKKPEEMAKQRGGFIEGCASNNIDADLAGNIFDLVEKFAGYGFNKSHSAAYGLVSYQT
DPO3A_HAEIN     LGGADLLRRAMGKKKPEEMAKQRLVFKEGAEKNGIDGELSMKIFDLVEKFAGYGFNKSHSAAYALVSYQT
DPO3A_TREPA     LGEADILRRAMGKKKLAVMQXXXXXXXXXXXXQGFDKKHAENIFEILIPFAGYGFNKSHATAYSVVAYQT
DPO3A_VIBCH     LGGADMLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQT
DPO3A_SALTY     LGGADMLRRAMGKKKPEEMAKQRSVFEEGAKKNGIDGELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQT
DPO3A_BUCAI     LGSADILRRAMSKKNLKDMSEQRAIFEEGASNNGIDKKLSIKIFDLLEKFAGYGFNKSHSVAYALVSYQT
DPO3A_PSEAE     LGGADMLRRAMGKKKPEEMAKQRGGFIEGCKNNGIDADLAGNIFDLVEKFAGYGFNKSHSAAYGLVSYQT
DPO3A_PASMU     LGGADLLRRAMGKKKPEEMAAQREIFEKGAIQKGVDGELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQT
DPO3A_NEIMB     LGGADLLRRAMGKKKPEEMVKHREIFAEGAAKQGISREKSDEIFNYMEKFAGYGFNKSHAAAYALISYQT
DPO3A_CAMJE     LGGADVVRRAMGKKDPEKMKKLKTDFADGAEKQGYDRAKAEDLWELIVKFAGYGFNKSHSAAYALITFQT
DPO3A_THEAQ     LGEADLLRRAMGKKRVEEMQKHRERFVRGAKERGVPEEEANRLFDMLEAFANYGFNKSHAAAYSLLSYQT
DPO3A_NEIMA     LGGADLLRRAMGKKKPEEMVKHREIFAEGAAKQGISREKSDEIFNYMEKFAGYGFNKSHAAAYALISYQT
DPO3A_BUCAP     LGKADILRRAMSKKNIKDMAEQRSIFIEGAQKNGINRKLAIKIFDLLEKFAGYGFNKSHSVAYALVSYQT
DPO3A_XYLFT     LGSADLLRRAMGKKVPAEMAKHREIFREGAAKGGMDAVKADEIFDLMEKFAGYGFNKSHAAAYALVSYQT
DPO3A_HELPY     LGEADLIRRAMGKKDAQIMADNKAKFVEGAKNLGHDGQKAANLWDLIVKFAGYGFNKSHSAAYAMITFQT
DPO3A_HELPJ     LGEADLIRRAMGKKDAQIMADNKAKFVEGAKNLGHDGQKAANLWDLIVKFAGYGFNKSHSAAYAMITFQT
DPO3A_XYLFA     LGSADLLRRAMGKKVPAEMAKHREIFREGAAKGGMDAVKADEIFDLMEKFAGYGFNKSHAAAYALVSYQT
DPO3A_BUCBP     LGHADLLRRTMEKKDQVEMNKHREMFKNGAKENNINTKLSTKIFNLLEQFAGYAFNKSHSVSYALVSYQT
DPO3A_BACSU     LGEADLLRRAVSKKKKEILDRERSHFVEGCLKKEYSVDTANEVYDLIVKFANYGFNRSHAVAYSMIGCQL
DPO3A_BACHD     LGEADLLRRAISKKKGEALRQQEEAFVTGAVRQGYEQETAKKIYELIVRFANYGFNKSHAVAYSMLAYQL
DPO3A_AQUAE     PGEADTLRKAIGKKKADLMAQMKDKFIQGAVERGYPEEKIRKLWEDIEKFASYSFNKSHSVAYGYISYWT
DPO3A_CHLTR     LGEGDVLRRAMGKKDHEQMVKEREKFCSRAAANGIDPSIATTIFDKMEKFASYGFNKSHAAAYGLITYTT
DPO3A_CHLPN     LGEGDVLRRAMGKKDFQQMEQEREKFCKRACNNGIDPELATVIFDKMEKFAAYGFNKSHAAAYGLITYTT
DPO3A_CHLMU     LGEGDVLRRAMGKKDHEQMVKEREKFCSRASANGIDPSIATTIFDKMEKFASYGFNKSHAAAYGLITYTT
DPO3A_STRCO     LGEADILRRVMGKKKPDELAKNFVLFQAGARKNGYSDEAIQALWDVLVPFAGYAFNKAHSAAYGLVSYWT
DPO3A_DEIRA     LGGADLLRRAMGKKDAEEMKRQRQLFVVGAKEKGVPEDEGNKLFDMLDAFANYGFNKSHSAAYGVITYQT
DPO3A_MYCTU     LARADILRKAMGKKKREVLEKEFEGFSDGMQANGFSPAAIKALWDTILPFADYAFNKSHAAGYGMVSYWT
DPO3A_MYCBO     LARADILRKAMGKKKREVLEKEFEGFSDGMQANGFSPAAIKALWDTILPFADYAFNKSHAAGYGMVSYWT
DPO3A_STAAW     YGEADILRRAMSKKNRAVLESERQHFIEGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIM
DPO3A_STAAS     YGEADILRRAMSKKNRAVLESERQHFIEGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIM
DPO3A_STAAR     YGEADILRRAMSKKNRAVLESERQHFIEGTKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIM
DPO3A_STAA8     YGEADILRRAMSKKNRAVLESERQHFIEGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIM
DPO3A_STAAC     YGEADILRRAMSKKNRAVLESERQHFIEGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIM
DPO3A_SYNY3     LGEADLLRRAMGKKKAEEMQKHRAKFVDGSTKHGVPSRIAENLFDQMVKFAEY-FNKSHSXXXXXXXXXX
DPO3A_STAES     YGEADILRRAMSKKNRAILESERQHFIDGAKNNGYGEQISKQIFDLILKFADYGFPRAHAVSYSKIAYIM
DPO3A_STAAN     YGEADILRRAMSKKNRAVLESERQHFIEGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIM
DPO3A_STAAM     YGEADILRRAMSKKNRAVLESERQHFIEGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIM
DPO3A_STAEQ     YGEADILRRAMSKKNRAILESERQHFIDGAKNNGYDEQISKQIFDLILKFADYGFPRAHAVSYSKIAYIM
DPO3A_MYCLE     LARADILRKAMGKKKREVLEKEFEGFSEGMQANGFSVHAIKALWDIILPFADYAFNKSHAAGYGLISYWT
DPO3A_STRP8     LGKADLLRRAMSKKNLQEMQKMEEDFIASAKHLGRAEETARGLFKRMEKFAGYGFNRSHAFAYSALAFQL
DPO3A_STRP6     LGKADLLRRAMSKKNLQEMQKMEEDFIASAKHLGRAEETARGLFKRMEKFAGYGFNRSHAFAYSALAFQL
DPO3A_STRP3     LGKADLLRRAMSKKNLQEMQKMEEDFIASAKHLGRAEETARGLFKRMEKFAGYGFNRSHAFAYSALAFQL
DPO3A_STRP1     LGKADLLRRAMSKKNLQEMQKMEEDFIASAKHLGRAEETARGLFKRMEKFAGYGFNRSHAFAYSALAFQL
DPO3A_STRPY     LGKADLLRRAMSKKNLQEMQKMEEDFIASAKHLGRAEETARGLFKRMEKFAGYGFNRSHAFAYSALAFQL
DPO3A_LACLA     LGKADLLRRAISKKKGSELEKLREDFLDSASHNGHSKEKAEEIYDLIERFANYGFNRSHGFAYGALAFQI
DPO3A_MYCGE     LEEADSFRRAISKKDVKLIQKNKRNFFERAVQNNFDLKTTTKIFSYIERFANYGFNLSHALGYALLSYWT
DPO3A_UREPA     IATSDNFRRAISKKDEKILIQLKDDFINGALNNNYKQPLVNQIFEYIFSFAHYGFNHSHSLAYSYISYWL
DNAE2_AGRVS     GGEADQLRKSMAFKFTGGVSRFKEKLVSGMVKNGYTPEFAEKTFSRLEGFGSYGFPESHAASFALIAYAS
DNAE2_RHOBA     PGEADQLRRAMAWRRPGVIDRFRTKLLEGMKANGLNGEFAENVFRQIRGFGEYGFPESHAASFALLVYAS
DPO3A_MYCPN     LETADSFRRAISKKNLQVIQDNMRSFYEGALANNFSLKAATTIFNYIQRFAGYGFNLSHALGYALLSYWT
DNE23_AGRT5     GGEADQLRKSMAFKFTGGVSQFKDKLVSGMVRNGYAPEFAEKTFSQLEGFGSYGFPESHAASFALIAYAS
DNE22_AGRT5     GGEADQLRKSMAFKFTGGVSRFKDKLVSGMVKNGYSPEFAEKTFSQLEGFGSYGFPESHAASFALIAYAS
DNE22_RHIME     GGEADQLRKSMAFKFTGGVSRFKDKLVNGMIRNGYTKEFAEKTFSQLEGFGSYGFPESHAASFALIAYAS
DNAE2_SYMTH     PGEADQLRRVMHARNREDMEAIGRLFRQKXXXXXXXXXXXXTIFSYIQGYASYGFCEXXXXXXXXXXXXX
DNAE2_PROAC     AADADLLRRAMGKRGVERIDSLRTKLFEGMAANGIDDDTAQGIYARIESFANFGFAESHALSFAGLVYTS
DNAE2_MYCTU     AAEADQLRRAMGSKRSTERMRRLRGRFYDGMLHGAPDEVIDRIYEKLEAFANFGFPESHALSFASLVFYS
DNAE2_MYCBO     AAEADQLRRAMGSKRSTERMRRLRGRFYDGMLHGAPDEVIDRIYEKLEAFANFGFPESHALSFASLVFYS
DNE21_RHIME     PSEADRLRRAMAFKRTGTIHTFERKMVEGMVANDYEREFAERCFNQIKGFGEYGFPESHAASFASLVYAS
DNE21_AGRT5     ADEADQLRRAMAFKNVGTISKFKEKLVTGMVANGYDKEFAERIFKQLEGFGSYGFPESHAASFALIAYAS
DNAE2_MYCPA     AAEADQLRRAMGXXXXXXXXXXXXXXFYDGMLHGAPDEVIDRTYEKLEAFANFGFPESHALSFASLVFYS
DNAE2_SINMW     PSEADRLRRAMAFKRTGTIHTFERKMVEGMVANGYEREFAERCFNQIKGFGEYGFPESHAASFASLVYAS
DNAE2_IDILO     GGEADQLRRAMSWGQNGHLTRFEDKLINGMLERGYKQEFAERLFRQICGFGQYGFPESHSASFANLAYVS
DNAE2_DECAR     PGEADQLRRAMAWKRKGGLEPFEQKLLAGMAANDLPESFARRIIAQIQGFGEYGFPESHAASFALLVYAS
DNAE2_RHISN     PSEADRLRRAMAFKRTGTIHTFERKMIDGMVRNGYEREFAERCFNQIKGFGEYGFPESHAASFASLVYAS
DNAE2_BDEBA     PGEADELRRVMSSAWKRKATMGGIEQRLGFARHGISSEYADQIFKTIEGFANYGFPESHSASFALLTYAS
DNAE2_PSEF5     PGEADQLRRSMAWKRHGGLEPHRERLRRGMNRNGYSDEFATQIFEQIKGFGSYGFPESHAASFALLTYAS
DPO3A_YERPE     MAEADGVRKAIG----------------------LSETKAKEIWDAFEKNGAYQFNKSHPVAYSLISYQS
DNAE2_TERTT     GGEADRLRRAMASWGKNGNLLQFEETFIQGMLNNGYELDAHRLFEQIKGFGGYGFPESHSASFAILCYAS
DNAE2_BRASO     PEEANGLRRAMAFRNVGTIGSYEEKMVSNMIARGYDPAFAKSCFDQIKGFGSYGFPESHAASFAQLVYVS
DNAE2_SACD2     GGEADQLRRAMASWGKNGSLLKFEDKFIGMLNNGYPLDFAHRLFEQIKGFGGYGFPESHSASFALLCYAS
DNAE2_PSEPF     PGEADQLRRSMAWKRHGGLEPHKERLAAGMKKNGYSPEFAAQIFEQIKGFGSYGFPESHAASFALLTYAS
DNAE2_SILPO     AEEADHLRRSLSFRRMGTIGAHRDTFIAGMRRNGYSQEVAERCFGQIEGFADYGFPESHAAAFAMLAYVS
DNAE2_BRUSU     PEEANQLRRAMAFRKMGTIHTMEKKMIDGMVNRGYDRTFAENCFNQIKGFGEYGFPESHAASFAHLVYIS
DNAE2_BRUME     PEEANQLRRAMAFRKMGTIHTMEKKMIDGMVNRGYDRTFAENCFNQIKGFGEYGFPESHAASFAHLVYIS
DNAE2_BRUAB     PEEANQLRRAMAFRKMGTIHTMEKKMIDGMVNRGYDRTFAENCFNQIKGFGEYGFPESHAASFAHLVYIS
DNAE2_PSE14     PGEADELRRAMAWKRHGGLEPHRERLRTGMLKNGYEADFADRIFEQIKGFGSYGFPESHAASFALLTYAS
DNAE2_PSEU2     PGEADELRRAMAWKRHGGLEPHRERLRTGMLKNGYEADFADRIFEQIKGFGSYGFPESHAASFALLTYAS
DNAE2_CORGL     GGEADSLRRAMGSKRSPERMAALRSRFFQGLTNGIVGETAEKLWNKIVAFAAYGFPESHSQSFASLVYFS
DNAE2_RHILO     PGEADELRRAMAFKRTGTIGNYRQRMIDGMVGKGYTKDFAERCFKQIEGFGEYGFPESHAASFALLVYAS
DNAE2_CAUCR     PDEADGLRKAMAFRNLGSPDAYRNKFIEGMVGRGYERAFAERCFKQIEGFSHYGFPESHAASFAKLVYVS
DNAE2_CAUCN     PDEADGLRKAMAFRNLGSPDAYRNKFIEGMVGRGYERAFAERCFKQIEGFSHYGFPESHAASFAKLVYVS
DNAE2_RHOPS     PDEANQLRRAMATFRNVGTIGKFESKMVGLVARGYDPVFAKNCFEQIKGFGSYGFPESHAASFAKLVYVS
DNAE2_RHOP2     PDEANQLRRAMATFRNVGTIGKFESKMIGLMARGYDATFAKNCFEQIKGFGSYGFPESHAASFAKLVYVS
DNAE2_CORJK     GAEADTLRRAMGSKRSPQKMERLKKRFYQGLENGIRGVVADRLWDKIVAFASYGFPESHSQSFASLVYYS
DNAE2_VIBPA     GGEADQLRRAMSWKKNGDLAKFKPKLLNGMQERGYDLAFAERIFEQICGFGEYGFPESHSASFAVLAYCS
DNAE2_CORDI     GGEADELRRAMGRRSVDTMNRMKRRFFAGLRRNNITGDIAGILWNKIVAFVAYGFPESHSQSFASLVYFS
DNAE2_ALHEH     PGEADALRRAMAWKRKGGLGPFRDKLLKGMRRNGYCEDYAERLFRQIQGFGEYGFPESHAASFALLVYVS
DNAE2_PSEPK     PGEADQLRRSMAWKRHGGLEPHRERLVQGMLRNGYTLAFAERIFEQIKGFGSYGFPESHAASFALLCYAS
DNAE2_PSESM     PGEADQLRRAMAWKRHGGLDPHRERLRTGMLANGYDADFADRIFEQIKGFGSYGFPESHAASFALLTYAS
DNAE2_COREF     GGEADALRRAMGSKRSPTRMAALRSRFYQGLAHGIIGDTADKLWNKMVAFAAYGFPESHSQSFATLVYFS
DNAE2_RHOP5     PDEANQLRRAMATFRNVGTIGKFEAKMTGLVARGYDPVFAQNCFEQIKGFGSYGFPESHAASFAKLVYVS
DNAE2_METCA     PGEADRLRRAMAAWHRKGGLEPFEKKLMGMRERGYEERFARQIYRQIRGFGEYGFPESHSASFALLAYVS
DNAE2_ANADE     PGEADELRRVMTHRRSHEKLAAMKARLVAGMARGISGADAEEIFKQLLGFAGYGFPESHAASFALLVYAS
DNAE2_RHOPA     PDEANQLRRAMATFRNVGTIGKFEAKMIGLVKRGYDATFAKNCFEQIKGFGSYGFPESHAASFAKLVYVS
DNAE2_BRAJA     SEEANGLRRSMATFRNVGTIGKYEDKLIGMVARGYDPNFARSCFDQIKGFGSYGFPESHAASFAQLVYIS
DNAE2_NOCFA     AAEADQLRRAMGSKRSPERMRRLKERLYRGMAHGITGEVADRIYEKLYAFANFGFPESHSQSFAALVFYS
DNAE2_ANAD2     PGEADELRRVMTHRRSHEKLAAMKARLVAGMARGISGADAEEIFKQLLGFAGYGFPESHAASFALLVYAS
DNAE2_HAHCH     SEEAEELRRSMSWKRRGHMGKLMDKLIINLLKKGVPLEYIQRLCRQIEGFGEYGFPESHAASFALLAYHS
DNAE2_ANASK     PGEADELRRVMTHRRSHEKLAAMKARLVAGMARGISGADAEEIFKQLLGFAGYGFPESHAASFALLVYAS
DNAE2_PSEA7     PGEADELRRSMAWKRHGGLEHHRERLTRGMLANGYEADFAARIFEQIKGFGSYGFPESHAASFALLTYAS
DNAE2_PSEAE     PGEADELRRSMAWKRHGGLEHHRERLTRGMLAKGYEADFAARIFEQIKGFGSYGFPESHAASFALLTYAS
DNAE2_BURPS     PGEADALRRAMAWKRKGDLGKYHERIVAGMLERGYSREFAEQIFEQIKGFGEYGFPESHAASFAKLAYAS
DNAE2_BURMA     PGEADALRRAMAWKRKGDLGKYHERIVAGMLERGYSREFAEQIFEQIKGFGEYGFPESHAASFAKLAYAS
DNAE2_VIBVU     GGEADQLRRAMAWKKNGHVFKFKTKLINGMLERGYELDFAERIFEQICGFGEYGFPESHSASFAVLAYCS
DPO3A_THEMA     GTEADILRRAIAXXXXXXXXXXXXXXXXXXXXXXXXN--AEQILEILLNFSSYAFNKSHSVAYAHITYQT
DNAE2_VIBVY     GGEADQLRRAMAWKKNGHVFKFKTKLINGMLERGYELDFAERIFEQICGFGEYGFPESHSASFAVLAYCS
DNAE2_VIBHB     GGEADQLRRAMAAWKKNGDLAKFKPKLIDGMRERGYDLEAERIFDQICGFGEYGFPESHSASFAVLAYCS
DNAE2_RALSO     ADEADRLRRDMAAWKRKGNLTQHQARLMKEMVRHYDPAFVEALCRQMEGFAEYGFPESHAAGFARLAYVS
DNAE2_GLUOX     PGEADQLRRAMAFKMTGGVSPFRDKLVNGMLANGYEQEFAEQTFAQLEGFGSYGFPEXXXXXXXXXXXXX
DNAE2_AZOSE     PGEADQLRRAMGFRRHGELERYRAKLLAGMAARGYRAEFAERLCDQIEGFGSYGFPESHAASFALLVYCS
DNAE2_XANCP     DSEADQLRRSMAAWRRGGDMEPHRVRIRELMARGYAPEFIDQIFEQIKGFGSYGFPQSHAASFAKLVYAS
DNAE2_XANC8     DSEADQLRRSMAAWRRGGDMEPHRVRIRELMARGYAPEFIDQIFEQIKGFGSYGFPQSHAASFAKLVYAS
DNAE2_XANAC     EDEADNLRRSMAAWRRGGDMEQHRTRVRERMGKGYASSFIDQIFEQIKGFGSYGFPQSHAASFAKLVYAS
DNAE2_RALPJ     XXXXXXXXXXXXXWKRKGNLTQHQERLVHAVKRRYDPAFVEALCKQMEGFAEYGFPESHAAGFAKLAYVS
DNAE2_XANCB     DSEADQLRRSMAAWRRGGDMEPHRVRIRELMARGYAPEFIDQIFEQIKGFGSYGFPQSHAASFAKLVYAS
DNAE2_XANOR     ESEADNLRRSMAAWRRGGDMEQHRMRVRERMGKGYASTFIDQIFEQIKGFGSYGFPQSHAASFAKLVYAS
DNAE2_XANOP     ESEADNLRRSMAAWRRGGDMEQHRTRVRERMGKGYASTFIDQIFEQIKGFGSYGFPQSHAASFAKLVYAS
DNAE2_BORPA     PGEADALRRSMAAWRRKGGVDKFRAQLVGGLARNYTADFAQALFRQIEGFGEYGFPESHXXXXXXXXXXX
DNAE2_AZOSB     PGEADQLRRAMSWRQKGHIERFKQKLRDGMKARGHDSDFADALCRQIEGFGEYGFPEXXXXXXXXXXXXX
DNAE2_PSEMY     PGEADELRRSMAAWKRHGGLEPHRQRLTSMLEKGYTAEFTARIFRQIEGFGSYGFPESHAASFALLTYAS
DNAE2_XANC5     PDEADKLRRSMAAWRRGGDMESHRLRIRALMGKGYASSFIDQIFEQIKGFGSYGFPQSHAASFAKLVYAS
DNAE2_BORBR     PGEADALRRSMAAWRRKGGVDKFRAQLVGGLARNYTADFAQALFRQIEGFGEYGFPESHXXXXXXXXXXX
YORL_BACSU      IKESNYLRKSIAXXXXXXXXXXXXXFFKKGKEIGTSDNLLNYVWNVQFKRQGYSFSLLHTLAYSIIALQE
DPO3_STAES      FKTMEFVRKGRG--------------LTDEMVEAMKENNVPDWYLDSCRKIKYMFPKAHAAAYVLMAVRI
DPO3_STAEQ      FKTMEFVRKGRG--------------LTDEMVEAMKENNVPDWYLDSCRKIKYMFPKAHAAAYVLMAVRI
DPO3_LACS1      ----------------------------------------------------YMFPKAHAAAYVLMALRI
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------YLFPKAHAAAYVLMAWRI
DPO3_MYCPN      ----------------------------------------------------YLFPKAHAAAYVLMAWRI
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
PPAC_METJA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           AYLKANYPAAFLVACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKFSDTVIPHSVKPVIP
DPO3A_RICCN     AYLKANYPAAFLVACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKFSDTVIPHSVKPVIP
DPO3A_RICFE     AYLKANYPAEFLVACLNLELNNHDKINLFLQEAKDSGIKIIAPNINISEGYFSVK---SVIPHPQGPLCP
DPO3A_RICTY     AYLKANYPAEFLVACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKSSDTVITHNTKPLIP
DPO3A_RICPR     AYLKANYPAEFLVACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKSSNTVITHSTKSVIS
DPO3A_RICBR     AYLKANYPAEFVVACLNLELNNHDKINLFLQEAKDXXXXXXXXXXXXSGGYF-----------SVKSVIP
DPO3A_CAUCR     AWLKANTPVEFFAASMSLDLSNTDKLAVFHQDARRFGITVRAPDVNRSGADFEVENGEVLYALG------
DPO3A_CAUCN     AWLKANTPVEFFAASMSLDLSNTDKLAVFHQDARRFGITVRAPDVNRSGADFEVENGEVLYALG------
DPO3A_BORBU     AYLKANYPEYFMAANLTNEINNNDKLSYYIEESKAIGINVLKPDINRSFREFRV--TDSGISYGL-----
DPO3A_ECO57     LWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVN-DDGEIVYGIGAI--
DPO3A_ECOLI     LWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVN-DDGEIVYGIGAI--
DPO3A_ECOL6     LWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVN-DDGEIVYGIGAI--
DPO3A_PSEFL     AWLKAHYPAPFMAAVLSADMHNTDKVVTLIEEVRTMKLRLDAPDVNTSEFKFTVNDEGRIV---------
DPO3A_HAEIN     LWLKTHFPAEFMAAVMTSEMDNTDKIVGLYDECLRMGLKVTPPDINIGKHHFSVNEQGEIV-YGIGAI--
DPO3A_TREPA     AFLKANFPAEFMAANLSNEINSAEKLPLYMAEAEKMGLSIQKPDVNASEPYFSV--CEGCIVYGL-----
DPO3A_VIBCH     LWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYRFNVDDNGAIV---------
DPO3A_SALTY     LWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVNDEGEIV-YGIGAI--
DPO3A_BUCAI     LWLKSHYPAEFIAAAMTSDIDNTEKIVILINESLNMGVKIIPPNINLSKYEFYVNDQGDIV-YGLGAI--
DPO3A_PSEAE     AWLKTHFPAPFMAAVLTADMQNTDKVVTLIEECRHMKLRIVAPDVNNSEFRFTVD-DDGRIVYGL-----
DPO3A_PASMU     LWLKTHYPAEFMAAVMTSEMDNTDKIVGLYDECLRMGLKVAPPDINTGKHHFSVNEYGEIV-YGIGAI--
DPO3A_NEIMB     AWLKAHYPAEFMAATMSSELDNTDQLKHFYDDCRANGIEFLPPDINESD-YRFTPYPDMKIRYAL-----
DPO3A_CAMJE     AYLKTYYPSEFMAALLTSEENNVDKIAVYIDEMKKMNIKLLPPSINKAIREFS-----------------
DPO3A_THEAQ     AYVKAHYPVEFMAALLSVERHDSDKVAEYIRDARALGIPVLPPDVNRSGFDFKVVGEEILF---------
DPO3A_NEIMA     AWLKAHYPAEFMAATMSSELDNTDQLKHFYDDCRANGIEFLPPDINESD-YRFTPYPDMKIRYAL-----
DPO3A_BUCAP     LWLKAHYPSEFMASAMTSDIDNTDKIVMLVNESIQMGIKIIPPNINLSKYEFYVDHTKNIVYGL------
DPO3A_XYLFT     AWLKRHYPAEFMAATLSSDMDNTDKVVGFLDEARNLNLKVLRPNINHSAYMFEATHADT-IQYGLGAI--
DPO3A_HELPY     AYLKTYYKHEFMAAMLTSESNKIESVARYIDEVRALEIEVMPPHINSSMQDFSVAEFKNQKGELEKKIVF
DPO3A_HELPJ     AYLKTYYKHEFMAAMLTSESNKIESVARYIDEVRALEIEVMPPHINSSMQDFSVAEFKNQKGELEKKIVF
DPO3A_XYLFA     AWLKRHYPAEFMAATLSSDMDNTDKVVGFLDEARNLNLKVLRPNINHSVYMFEATHADT-IQYGLGAI--
DPO3A_BUCBP     LWLKLYYPEEFMASAMNADIDNIKKIVVLINECKVMKLKIIPPNVNQSDYYFKVDDDKNIIYGL------
DPO3A_BACSU     AYLKAHYPLYFMCGLLTSVIGNEDKISQYLYEAKGSGIRILPPSVNKSSFPFTVE--NGSVRYSLRAIKS
DPO3A_BACHD     AYLKAHYPSSFYAALASTIWNQPEKLERLLQEMKQQGIRVLPPSLSKSDIHFSEEEEGVRF-----PLLP
DPO3A_AQUAE     AYVKAHYPAEFFAVKLTTEKNDNKFLNL-IKDAKLFGFEILPPDINKSDVGFTIEGEN------------
DPO3A_CHLTR     AYLKANYPKEWLAALLTCDYDDIEKVGKLIQEAHSMNILVLPPDINESGQDFEA--TQKGIRFSLGAV--
DPO3A_CHLPN     AYLKANYPKEWLAALLTCDSDDIEKIGKLIREAQSMGIPILPPHINVSSNHFVA--TDEGIRFAMGAI--
DPO3A_CHLMU     AYLKANYPKEWLAALLTCDYDDIEKVGKLIQEAHSMNIPVLPPDINESGQDFEA--TQEGIRFSLGAV--
DPO3A_STRCO     GYLKANYPAEYMAALLTSVKDDKDKSAVYLNECRRMGIKVLPPNVNESMSNFAAQGDDVIL---------
DPO3A_DEIRA     AWLKANYPVQFMAALLTVERRDSDKVAEYVSDARKMDLHVLPPDINRSSSDFAVAGEEILFGL-------
DPO3A_MYCTU     AYLKANYPAEYMAGLLTSVGDDKDKAAVYLADCRKLGITVLPPDVN------------------------
DPO3A_MYCBO     AYLKANYPAEYMAGLLTSVGDDKDKAAVYLADCRKLGITVLPPDVN------------------------
DPO3A_STAAW     SFLKVHYPNYFYANILSNVIGSEKKTAQMIEEAKKQGITILPPNIN--ESHWFYKPSQEGIYLSIGTI--
DPO3A_STAAS     SFLKVHYPNYFYANILSNVIGSEKKTAQMIEEAKKQGITILPPNIN--ESHWFYKPSQEGIYLSIGTI--
DPO3A_STAAR     SFLKVHYPNYFYANILSNVIGSEKKTAQMIEEAKKQGITILPPNIN--ESHWFYKPSQEGIYLSIGTI--
DPO3A_STAA8     SFLKVHYPNYFYANILSNVIGSEKKTAQMIEEAKKQGITILPPNIN--ESHWFYKPSQEGIYLSIGTI--
DPO3A_STAAC     SFLKVHYPNYFYANILSNVIGSEKKTAQMIEEAKKQGITILPPNIN--ESHWFYKPSQEGIYLSIGTI--
DPO3A_SYNY3     XXLKANYPVEYMAALLTASSDSQEKVEKYRENCQKMGITVEPPDINRSQRHFTPLGEAILFGLSAV----
DPO3A_STAES     SYLKVHYPHYFYANILSNVIGSEKKTAAMIDEAKHQRISILPPNINQSHWYYKAS---------------
DPO3A_STAAN     SFLKVHYPNYFYANILSNVIGSEKKTAQMIEEAKKQGITILPPNIN--ESHWFYKPSQEGIYLSIGTI--
DPO3A_STAAM     SFLKVHYPNYFYANILSNVIGSEKKTAQMIEEAKKQGITILPPNIN--ESHWFYKPSQEGIYLSIGTI--
DPO3A_STAEQ     SYLKVHYPHYFYANILSNVIGSEKKTAAMIDEAKHQRISILPPNINQSHWYYKAS---------------
DPO3A_MYCLE     AYLKANFAGEYMAGLLTSVGDDKDKAAVYLADCRKFGITVLPPDVNESVLDFASVGADI-------RYXX
DPO3A_STRP8     AYFKAHYPAVFYDIMMNYSSSD------YITDALESDFQVAQVTIN-------------SIPYTDKIEAS
DPO3A_STRP6     AYFKAHYPAVFYDIMMNYSSSD------YITDALESDFQVAQVTIN-------------SIPYTDKIEAS
DPO3A_STRP3     AYFKAHYPAVFYDIMMNYSSSD------YITDALESDFQVAQVTIN-------------SIPYTDKIEAS
DPO3A_STRP1     AYFKAHYPAVFYDIMMNYSSSD------YITDALESDFQVAQVTIN-------------SIPYTDKIEAS
DPO3A_STRPY     AYFKAHYPAVFYDIMMNYSSSD------YITDALESDFQVAQVTIN-------------SIPYTDKIEAS
DPO3A_LACLA     AYFKAHFPDEF----YEIQLRDR-KREVMILDALENGFEIEKPSINL------MKIGDFVKNKKIRLGLA
DPO3A_MYCGE     AWLKTNYPVYFYLWLLNHFQSSKDKQKLIIRTLEKSGIEIYPPLLN------------------------
DPO3A_UREPA     AYLKHYYTLEFLSVLLSHTSASKDKLLSYLNEAKEFNISIKGPDIQYFSNDFVIDTQKQIIRFGFKTIKG
DNAE2_AGRVS     NYVKCHFPDVFCAALLNSQPMGFYAPAQIVGDARAHGVEVRPVCVNRSRWDCTLERIGTTQQHAVR----
DNAE2_RHOBA     CYLKRHYPTAFCAALLDSQPMGFYAPAQLIRDAQQHGVQVLPVDINDS------NIRSKLIPDLNRP-HP
DPO3A_MYCPN     AWLKTHYFEQFNLWWLNHXXXXXXXXXXLLNEFISSGYEICPPLINKAKSDFSVQ---------------
DNE23_AGRT5     SYIKCHYPEAFCAALINSQPMGFYAPAQIVGDARAHGVEVRPVCINRS----------------------
DNE22_AGRT5     NYIKCHYPDVFCAALLN-----------------------------------------------------
DNE22_RHIME     NYIKCYFPDVFCAALLNSQPMGFYAPAQIVRDAREHGVEVRPICINRSRWDCMLEPIDGSGGHAVR-LGM
DNAE2_SYMTH     XXLVRHYPAEYFAALMSAQPMGYYPINTLAVEARRRGVGLLPVDINRSEEAFTVE---------------
DNAE2_PROAC     AWIKLHYPAVFLAALLRSQPMGFYSSATLVADARRHGVVTRRPDV-------------------------
DNAE2_MYCTU     AWFKLHHPAAFCAALLRAQPMGFYSPQSLVADARRHGVAVHGPCVNASLAHATCENAGTEV---------
DNAE2_MYCBO     AWFKLHHPAAFCAALLRAQPMGFYSPQSLVADARRHGVAVHGPCVNASLAHATCENAGTEV---------
DNE21_RHIME     AWLKTYYPDIFCAALLNAQPMGFYAPAQLVRDAREHGVRMLPVDINHSDWDALLEGEGAFDKNAVHP---
DNE21_AGRT5     SWLKCHHPDIFCTAILNSQPMGFYAPAQIVRDARDHGVEVRPVCVNNS----------------------
DNAE2_MYCPA     SWFKLHHPAAFCAALLRAQPMGFYSPQSLVADARRHGVTVHGPDVNASLAHATLENAGTEV---------
DNAE2_SINMW     AWLKTYYPDIFCAALLNAQPMGFYAPAQLVRDAREHGVKVLPVDINHSDWDALLEGEGQFRKESVDP---
DNAE2_IDILO     SWFKTYHPAAFYVGLLNSLPMGFYSASQLVQDAQRHGVAFLAADINASD---------------------
DNAE2_DECAR     AWLKRHHPAAFLCGLLNSQPMGFYSPSMLIQDARRHGVRVLPPDVMTSD---------------------
DNAE2_RHISN     SWFKAYYPDIFCAALLNSQPMGFYAPAQLVRDAREHGVRILPVDVNHSDWDALLEGEAMFRKEAIDPRHG
DNAE2_BDEBA     CYLKCHYPDVFACGLLNSQPMGFYAPRTIIAEAQRNGV-VVAP-LDVQKSDYDYTIEKTAAGDLLRVGL-
DNAE2_PSEF5     CWLKCHEPAAFACALINSWPMGFYSPDQILQDARRHGLQVLAVDVGASD---------------------
DPO3A_YERPE     MWLKTHYPAEFFAAALT--ILGEDKHQGLVKDALTYGIHVLPPDVNVSSNRIEIR---------------
DNAE2_TERTT     SWLKCHHPAAFYCALLNSQPMGFYSPSQLIQDARRHGIPVLPVDVNHSE---------------------
DNAE2_BRASO     SWLKYFHPDAFCCALLNSQPMGFYAPAQIVGDARKNGVEI--RDIDVSHSF-------------------
DNAE2_SACD2     SWLKCHHPAAFYCALLNSQPMGFYSASQLIQDARRHKVVVLPVEVNASESHVVLTNHNTSAPPNIIQLGL
DNAE2_PSEPF     CWLKCHEPAAFACALINSWPMGFYSPDQILQDARRHHLQIRPVDVRASD---------------------
DNAE2_SILPO     AWLKCHHPAIFACALLNAQPMGFYAPAQIVRDARDHQVELRPICVNASD---------------------
DNAE2_BRUSU     AWLKCHHPEVFAAALLNSQPMVFYAPAQIVRDAREHGVTVLPVDVNFSQ---------------------
DNAE2_BRUME     AWLKCHHPEVFAAALLNSQPMGFYAPAQIVRDAREHGVTVLPVDVNFSQ---------------------
DNAE2_BRUAB     AWLKCHHPEVFAAALLNSQPMGFYAPAQIVRDAREHGVTVLPVDVNFSQ---------------------
DNAE2_PSE14     CWLKCHEPAAFTCALINSWPMGFYSPDQLLQDARRHHIEIRPVDVRYSD---------------------
DNAE2_PSEU2     CWLKCHEPAAFTCALINSWPMGFYSPDQLLQDARRHHIEIRPVDVRYSD---------------------
DNAE2_CORGL     AWFKYHYPAEFCVGLLRAQPMGFYSPQSLISDARRHGVSILPITVNDS----------------------
DNAE2_RHILO     CWFKTFYPDVFCAAILNSQPMGFYQPAQLVRDARDHGVDIREVDVNCSAWDCTLE----KVPFDPARILP
DNAE2_CAUCR     AWIKWAWPDVFCAALINAQPMGFYQPAQLVRDAREHGVEVLPPDILTSD---------------------
DNAE2_CAUCN     AWIKWAWPDVFCAALINAQPMGFYQPAQLVRDAREHGVEVLPPDILTSD---------------------
DNAE2_RHOPS     AWMKCEHPDAFCCALLNSQPMGFYAPAQIVGDARANEVEVRPVDVSFSDGQCTLE-ERCGKHHAVRLGFR
DNAE2_RHOP2     AWMKCEHPDAFCCALLNSQPMGFYAPAQIVGDARANKVEVRPVDVSFSDGQCTLE-ERCGAYHAVRLGFR
DNAE2_CORJK     AWFKYHYPAEFCVALLRAQPMGFYSPQSLLADARRHGVEVLPVDVNDSDVQVDAVASLATPPRTNRPTVH
DNAE2_VIBPA     AWLKYYYPAEFYTALLNSQPMGFYSPSQLVQDARRHGVEVLPICVNHS----------------------
DNAE2_CORDI     AWFKYHHPAEFYVGLLRAQPMGFYSPQSLLADARRKELTILSHNINKSQ---------------------
DNAE2_ALHEH     AWLKCHEPALFTCALLNSQPMGFYAPAQLLRDAERHGVEIRPVDVRHSD---------------------
DNAE2_PSEPK     SWLKCHEPAIFTCALVNSWPMGFYSPDQLLQEARRQGIEV------------------------------
DNAE2_PSESM     CWLKCHEPAAFTCALINSWPMGFYSPDQLLQDARRHHIEIRPVDVRYS----------------------
DNAE2_COREF     AWFKHHYPAEFCAGLLRAQPMGFYSPQSLIADARRHGVEILPISINES----------------------
DNAE2_RHOP5     AWLKHAHPDAFCCALLNSQPMGFYAPAQIVGDARQNGVEIRGVDVAYS-------FSQNTLEHAVRLGFR
DNAE2_METCA     AWLKCHHPAAFACALLNSQPMGFYGPSQLIQDARRHGVEVRPIDVNHSD---------------------
DNAE2_ANADE     AWLKRYHPAAFACALLNSQPMGFYAPHTLVEDAKRHGVEVRGVDVGCS----------------------
DNAE2_RHOPA     AWMKCEHPDAFCCALLNSQPMGFYAPAQIVGDARSNGVEVRPVDVSFSEG--------------------
DNAE2_BRAJA     SWLKYHHPDAFCCGLLNSQPMGFYAPAQIVGDARKNGVEV------------------------------
DNAE2_NOCFA     AWFKLHHPAAFCAGLLRAQPMGFYSPQSLVADARRHGVPVHGPDVNAS----------------------
DNAE2_ANAD2     AWLKRYHPAAFACALLNSQPMGFYAPHTLVEDAKRHGVEVRGVDVGCS----------------------
DNAE2_HAHCH     GWLKYYYPSAFCCALLNSQPMGFYAPWQVIQDAQRHGVIVLPVDINNS----------------------
DNAE2_ANASK     AWLKRYHPAAFACALLNSQPMGFYAPHTLVEDAKRHGVEVRGVDVGCS----------------------
DNAE2_PSEA7     SWLKRHEPAAFACALINSWPMGFYSPDQLLQDARRHAIQ-------------------------------
DNAE2_PSEAE     SWLKRHEPAAFACALINSWPMGFYSPDQLLQDARRHALQ-------------------------------
DNAE2_BURPS     SWLKRHEPAIFLAALLNSQPMGFYPPAQLVQDAKRHGVTVL-----------------------------
DNAE2_BURMA     SWLKRHEPAIFLAALLNSQPMGFYPPAQLVQDAKRHGVTVL-----------------------------
DNAE2_VIBVU     AWLKHYYPAEFYTALLNSQPMGFYSPSQLVQDAKRHGIAVLPICVNFS----------------------
DPO3A_THEMA     AYLKAHHLEEFFKLYFAYNSSDAGKIFLAVQELRNEGYRVHPPDINISGKDLVFHGKDVYLP--XXXXXX
DNAE2_VIBVY     AWLKHYYPAEFYTALLNSQPMGFYSPSQLVQDAKRHGIAVLPICVNFS----------------------
DNAE2_VIBHB     AWLKFYYPAEFYTALLNSQPMGFYSPSQLIQDARRHGVEVLPVCINHS----------------------
DNAE2_RALSO     SFLKCHEPAAFFAALLNSQPMGFYSPSQLVQEARRSRVRVLPADVTAS----------------------
DNAE2_GLUOX     XWMKCHYPDVFCAALLNSQPMGFYAPSQIVQDAQRHGVEVRPICINAS----------------------
DNAE2_AZOSE     AWLKCCEPAAFLCGLLNSQPMGFYAPSQLIQDARRHGVVVLGAEVTASDWDCTLE----ALPDASPGAAP
DNAE2_XANCP     CWLKRHEPAAFACGLLNAQPMGFYSASQIVQDAR------------------------------------
DNAE2_XANC8     CWLKRHEPAAFACGLLNAQPMGFYSASQIVQDAR------------------------------------
DNAE2_XANAC     CWLKRHEPAAFACGLLNAQPMGFYSASQIVQDAR------------------------------------
DNAE2_RALPJ     SFLKCHEPAAFFAALLNSQPMGFYSPSQLVQEARRSHVRVLPADVTAS----------------------
DNAE2_XANCB     CWLKRHEPAAFACGLLNAQPMGFYSASQIVQDAR------------------------------------
DNAE2_XANOR     CWLKRHEPAAFACGLLNAQPMGFYSASQIVQDAR------------------------------------
DNAE2_XANOP     CWLKRHEPAAFACGLLNAQPMGFYSASQIVQDAR------------------------------------
DNAE2_BORPA     XXXKCHEPEAFLAALLNSQPMGFYAPAQLVQDARRHGVRVLPADV-------------------------
DNAE2_AZOSB     XXXKRHEPEAFLCGLLNSQPMGFYAPAQLLQDARRHGVEVRPVDVTAS----------------------
DNAE2_PSEMY     CWLKCHEPAAYACALVNSWPMGFYSPDQVLQDARRHGIEVRPADVRHSAWDCSLEPSD------------
DNAE2_XANC5     CWLKRHEPAAFACGLLNAQPMGFYSASQIVQDAR------------------------------------
DNAE2_BORBR     XXXKCHEPEAFLAALLNSQPMGFYAPAQLVQDARRHGVRVLPADV-------------------------
YORL_BACSU      LNLNYRYPLYWNTACLTVNATNYGKVASAIGNIRQRGIKIDLPDINKADFGFRTDINNNSILFGLK----
DPO3_STAES      AYFKVHHPLYYYAAYFTIRASDFDLITM------------------------------------------
DPO3_STAEQ      AYFKVHHPLYYYAAYFTIRASDFDLITM------------------------------------------
DPO3_LACS1      AYFKVYYPLVYYAAYFSVRADDFDLVSMSRKEAVKNAMELI-----------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_MYCGE      AWFKLYHPLSYYACLLSFKLKEHD-INGF--EKGYEFIKNRLDELNKLYRIKKIKPKEAELLTSYEVYLE
DPO3_MYCPN      AWFKLYHPLSYYACLLSFKLKEHDVSGF---KSGVSFVKQKLEELNTLYRIKRIKPKEAELLTSYEVYLE
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
PPAC_METJA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           RLDRGIQKISKDTVVKPRCDXXXXXXXXXXXXXXVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINS
DPO3A_RICCN     RLDRGIQKISKDTVVKPRCDXXXXXXXXXXXXXXVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINS
DPO3A_RICFE     RVGGYPEKVSRNDIEDTGYDEKSTIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPLKSINS
DPO3A_RICTY     RLNNEID--IKDTAVKSYYKDESTIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINS
DPO3A_RICPR     RLNCDIKKIAKDTAVKPYCKDESTIIFALGAIKGVTANFGKLVTDERKARGAFKSITDFIERLPPKSINS
DPO3A_RICBR     RLDCGIHGDQKDTAVKPQYDIDSSIIFALGAIKGVTPNFGKLVTDERNARGAFKSIVDFIERLPPKAINS
DPO3A_CAUCR     ----AIRNVGLEAM--------------------------KHLVAVRAEGGPFRDVFDFVERIDPRQVNK
DPO3A_CAUCN     ----AIRNVGLEAM--------------------------KHLVAVRAEGGPFRDVFDFVERIDPRQVNK
DPO3A_BORBU     ---NGIKNLGGIVV--------------------------DLIIDEREKNGKYSSFEDFIRRVDDKVINK
DPO3A_ECO57     ---KGVGEGPIEAII-----------------------------EARNKGGYFRELFDLCARTDTKKLNR
DPO3A_ECOLI     ---KGVGEGPIEAII-----------------------------EARNKGGYFRELFDLCARTDTKKLNR
DPO3A_ECOL6     ---KGVGEGPIEAII-----------------------------EARNKGGYFRELFDLCARTDTKKLNR
DPO3A_PSEFL     ---YGLGAIK-----------------------GVGEGPVEAITEARQA-GPFKDLFDFCARVDLKRINK
DPO3A_HAEIN     ---KGVGEGPIEALVAARNEG-----------------------------GIFKDLFDLCARVDLKKINR
DPO3A_TREPA     ---LGIKGLGEQVAFD--------------------------VFDERIRNGPYTSFVEVLDRVPATSLNK
DPO3A_VIBCH     ---YGIGAIK-----------------------GVGEGPIEAILEARNKGGYFKDLFDFCARIDLKKVNK
DPO3A_SALTY     ---KGVGEGPIEAII-----------------------------DARNQGGYFRELFDLCARTDTKKLNR
DPO3A_BUCAI     ---KGIGKNSVQVLIK-----------------------------EREENKFFHDLFDLCMRIDSQKITR
DPO3A_PSEAE     ---GAIKGVGEGPV--------------------------EAITECRAEGGPFNTLFDFCDRVDLKRINK
DPO3A_PASMU     ---KGVGEGPIEALI-----------------------------SAREQGGIFKDLFDLCARVDLKKINR
DPO3A_NEIMB     ----GAIKGTGEAAVES-------------------------ITAARQSGGKFTGLLDFCERVGKEHMNR
DPO3A_CAMJE     ----ALEQDGKDAII----------YGLGAIKSVGIPAVENLL--EARQDGEFKDINDFLGKIDPTKINR
DPO3A_THEAQ     ----GLSAVKN-----------------------VGEMAARAILEERERGGPFKSLGDFLKRLPEQVVNK
DPO3A_NEIMA     ----GAIKGTGEAAVES-------------------------ITSARQSGGKFTGLLDFCERVGKEHMNR
DPO3A_BUCAP     ---GAVKGIGRNPILN--------------------------LVQEREKNGLFSDLFDLCMRTDPNKITR
DPO3A_XYLFT     ---KGVGQSVCEAIVK-----------------------------ERLHYGPYTSLLDFCTRVTSAKLNR
DPO3A_HELPY     GLG-AIKGVGGEPI--------------------------KNIIEER-AKGDYKSLEDFISRVDFSKLTK
DPO3A_HELPJ     GLG-AVKGVGGEPI--------------------------KNIIEER-AKGDYKSLEDFISRVDFSKLTK
DPO3A_XYLFA     ---KGVGQSVCEAIVK-----------------------------ERLHYGPYTSLLNFCTRVASAKLNR
DPO3A_BUCBP     ---GAIKGIGKSVILD--------------------------IVNARKNRKRFSELFDLCVSVNSKRITH
DPO3A_BACSU     VGVSAVKDIYKARKEKP-----------------------------------FEDLFDFCFRVPSKSVNR
DPO3A_BACHD     LRYVSVRAIR------------------------------ELIKARREA--PVRSLFDLCSRVDGRIVTS
DPO3A_AQUAE     RIRFGLARIK-----------------------GVGEETAKIIVEARKKYKQFKGLADFXXXXXXXXXXX
DPO3A_CHLTR     ---KGVGMSIVDSIV-----------------------------EEREKNGPYKSLQDFVQRADFKKVTK
DPO3A_CHLPN     ---KGIGRGLIESIV-----------------------------EERDHHGPYESIRDFIQRSDLKKVSK
DPO3A_CHLMU     ---KGVGVSIVDSIV-----------------------------EEREKNGPYRSLQDFVQRSDFKKVTK
DPO3A_STRCO     ---FGLSAVRN-----------------------VGTNVVESIIKCRKAKGKYASFPDYLDKVEAVVCNK
DPO3A_DEIRA     ---YAIKGLGESAVLR--------------------------ILEEREKAGAFKSLADFCSRLGNKVCNR
DPO3A_MYCTU     --ESGLNFASVGQDIRYXXXXXXXXXXXXXXSLLQTRNDKGKFTD----------FSDYLNKIDISACNK
DPO3A_MYCBO     --ESGLNFASVGQDIRYXXXXXXXXXXXXXXSLLQTRNDKGKFTD----------FSDYLNKIDISACNK
DPO3A_STAAW     -KGVGYQSV-------------------------------KVIVDERYQNGKFKDFFDFARRIPKRVKTR
DPO3A_STAAS     -KGVGYQSV-------------------------------KVIVDERYQNGKFKDFFDFARRIPKRVKTR
DPO3A_STAAR     -KGVGYQSV-------------------------------KVIVEERYQNGKFKDFFDFARRIPKRVKTR
DPO3A_STAA8     -KGVGYQSV-------------------------------KVIVDERYQNGKFKDFFDFARRIPKRVKTR
DPO3A_STAAC     -KGVGYQSV-------------------------------KVIVDERYQNGKFKDFFDFARRIPKRVKTR
DPO3A_SYNY3     ---RNLGEGAIEQIITARDN-----------------------SEEKR----FKSLADFCTQVDLRVVNR
DPO3A_STAES     --NKGIY-LSLGTI------------------KGIGYQSVKLIIDERQQNGPYRDFFDFSRRIPKRVKNR
DPO3A_STAAN     -KGVGYQSV-------------------------------KVIVDERYQNGKFKDFFDFARRIPKRVKTR
DPO3A_STAAM     -KGVGYQSV-------------------------------KVIVDERYQNGKFKDFFDFARRIPKRVKTR
DPO3A_STAEQ     --NKGIY-LSLGTI------------------KGIGYQSVKLIIDERQQNGPYRDFFDFSRRIPKRVKNR
DPO3A_MYCLE     XXXXXXXXXXXXSLIKTR-----------------------------NAKGKFADFSDYLNKIDITSCNK
DPO3A_STRP8     KIYMGLKNIK-----------------------GLPRDFAYWIIEQR----PFNSVEDFLTRTPEKYQKK
DPO3A_STRP6     KIYMGLKNIK-----------------------GLPRDFAYWIIEQR----PFNSVEDFLTRTPEKYQKK
DPO3A_STRP3     KIYMGLKNIK-----------------------GLPRDFAYWIIEQR----PFNSVEDFLTRTPEKYQKK
DPO3A_STRP1     KIYMGLKNIK-----------------------GLPRDFAYWIIEQR----PFNSVEDFLTRTPEKYQKK
DPO3A_STRPY     KIYMGLKNIK-----------------------GLPRDFAYWIIEQR----PFNSVEDFLTRTPEKYQKK
DPO3A_LACLA     H----VQGISRD--------------------------LAKWIVENQ----PYKDLADFVEKLPNNFHKK
DPO3A_MYCGE     ----------------------------------------------------------------------
DPO3A_UREPA     FGDELLKKI-------------------------------------------------------------
DNAE2_AGRVS     ----------------------------------------------------------------------
DNAE2_RHOBA     KLRLGLQMV-----------------------RGLPSAVAQKIIVARDANGPFANLHDLTTRAKLSRSNI
DPO3A_MYCPN     ----------------------------------------------------------------------
DNE23_AGRT5     ----------------------------------------------------------------------
DNE22_AGRT5     ----------------------------------------------------------------------
DNE22_RHIME     RLVRGL----------------------------------------------------------------
DNAE2_SYMTH     ----------------------------------------------------------------------
DNAE2_PROAC     ----------------------------------------------------------------------
DNAE2_MYCTU     ----------------------------------------------------------------------
DNAE2_MYCBO     ----------------------------------------------------------------------
DNE21_RHIME     ------RHASMREVIKTR---KAVRLGFRLVKGLKQTDMKALVA--RRGEG-YRSVHDLWLR---SGLSR
DNE21_AGRT5     ----------------------------------------------------------------------
DNAE2_MYCPA     RLGLGVRHIGDDLAEK--------------------------LVQERKANGPFTSLLDLTARL---QLSV
DNAE2_SINMW     ------RHADMREVIKTR---KAVRLGFRLVKGLKQADMGALVA----CRGGYRSVHDLWFR---SGLSR
DNAE2_IDILO     ----------------------------------------------------------------------
DNAE2_DECAR     ----------------------------------------------------------------------
DNAE2_RHISN     EM-RDVIRSGKAVRLGFR-----------LVKGLRQPDMEALVA--RRGEG-YRSVHDLWLR---SGLTR
DNAE2_BDEBA     ---RSIYGIPEVLI--------------------------RRIEDSRKEEGLYIDLADFIRRTQPRSV--
DNAE2_PSEF5     ----------------------------------------------------------------------
DPO3A_YERPE     ----------------------------------------------------------------------
DNAE2_TERTT     ----------------------------------------------------------------------
DNAE2_BRASO     ----------------------------------------------------------------------
DNAE2_SACD2     HMIKGLSILTAERIVLAKGD--------------------------------------------------
DNAE2_PSEPF     ----------------------------------------------------------------------
DNAE2_SILPO     ----------------------------------------------------------------------
DNAE2_BRUSU     ----------------------------------------------------------------------
DNAE2_BRUME     ----------------------------------------------------------------------
DNAE2_BRUAB     ----------------------------------------------------------------------
DNAE2_PSE14     ----------------------------------------------------------------------
DNAE2_PSEU2     ----------------------------------------------------------------------
DNAE2_CORGL     ----------------------------------------------------------------------
DNAE2_RHILO     RHADMRGVIETNHAVR-------------LGFRQIKGLSKERMEDFAKRRGSYETVRDVWLR---SGLDV
DNAE2_CAUCR     ----------------------------------------------------------------------
DNAE2_CAUCN     ----------------------------------------------------------------------
DNAE2_RHOPS     QIDGFVERVRREAGLLPSEDWA-----------------ARIVA--ARARGPFNSLERFARL---TALPK
DNAE2_RHOP2     QIDPDEERVRLEAGLPPSDDWA-----------------ARIVA--ARARGPFGSLEQFITALPKRA---
DNAE2_CORJK     GLGRG-----------------------------------------------------------------
DNAE2_VIBPA     ----------------------------------------------------------------------
DNAE2_CORDI     ----------------------------------------------------------------------
DNAE2_ALHEH     ----------------------------------------------------------------------
DNAE2_PSEPK     ----------------------------------------------------------------------
DNAE2_PSESM     ----------------------------------------------------------------------
DNAE2_COREF     ----------------------------------------------------------------------
DNAE2_RHOP5     QID-GFRWADFDNLWQARGDAP-------------PEDWGARIVEARE-KSPFTSLEQFAR---ATALPK
DNAE2_METCA     ----------------------------------------------------------------------
DNAE2_ANADE     ----------------------------------------------------------------------
DNAE2_RHOPA     ----------------------------------------------------------------------
DNAE2_BRAJA     ----------------------------------------------------------------------
DNAE2_NOCFA     ----------------------------------------------------------------------
DNAE2_ANAD2     ----------------------------------------------------------------------
DNAE2_HAHCH     ----------------------------------------------------------------------
DNAE2_ANASK     ----------------------------------------------------------------------
DNAE2_PSEA7     ----------------------------------------------------------------------
DNAE2_PSEAE     ----------------------------------------------------------------------
DNAE2_BURPS     ----------------------------------------------------------------------
DNAE2_BURMA     ----------------------------------------------------------------------
DNAE2_VIBVU     ----------------------------------------------------------------------
DPO3A_THEMA     XXXXXXEQIEK---IRP-----------------------------------VSSVRELQERV--TGVPR
DNAE2_VIBVY     ----------------------------------------------------------------------
DNAE2_VIBHB     ----------------------------------------------------------------------
DNAE2_RALSO     ----------------------------------------------------------------------
DNAE2_GLUOX     ----------------------------------------------------------------------
DNAE2_AZOSE     AVRLGLQLV-------------------------------------------------------------
DNAE2_XANCP     ----------------------------------------------------------------------
DNAE2_XANC8     ----------------------------------------------------------------------
DNAE2_XANAC     ----------------------------------------------------------------------
DNAE2_RALPJ     ----------------------------------------------------------------------
DNAE2_XANCB     ----------------------------------------------------------------------
DNAE2_XANOR     ----------------------------------------------------------------------
DNAE2_XANOP     ----------------------------------------------------------------------
DNAE2_BORPA     ----------------------------------------------------------------------
DNAE2_AZOSB     ----------------------------------------------------------------------
DNAE2_PSEMY     ----------------------------------------------------------------------
DNAE2_XANC5     ----------------------------------------------------------------------
DNAE2_BORBR     ----------------------------------------------------------------------
YORL_BACSU      ----GMNGIGDDVI-------------------------HHIVLNR-----PYSDFNDFIERMFKSGIIK
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_MYCGE      MMARNI-KLQQISIQNSNARMFVEHNGVLIAPFITIPGMGEAVASEARNEKPFASLNDFKKR---TKITK
DPO3_MYCPN      MMARGI-KLEQISLTHSHATRFVEHNGMLIAPFITIPGMGEAVANEARNEKPFSSLDDFKKR---TKITK
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
PPAC_METJA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           KLLENLIKSGCFDELHDNRLQLLSSIPKLLSYSTAYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLA
DPO3A_RICCN     KLLENLIKSGCFDELHDNRLQLLSSIPKLLSYSTAYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLA
DPO3A_RICFE     KLLENLIKSGCFDELHDNRLQLFSSISKLLAYSASYHAEQESNQFSLIKVSSLSPNILIASDYADNNTLA
DPO3A_RICTY     KLLENLIKAGCFDELHDNRLQLFLSVPKLIAYSTSYHQEQESNQFSLIKVSSLSPTILVSSNYADKNTLA
DPO3A_RICPR     KLLENLIKAGCFDELHDNRLQLFLSIPKLIAYSTSYHQEQESNQFSLIKVSSLSPTILVSSDYADKNTLA
DPO3A_RICBR     KLLENLIKAGCFDELHDNRLQLFLSISKLLAYSVSYHEEQASNQFSLIKVSSLSKEILVSSDYADKNTLA
DPO3A_CAUCR     RAIENLARAGAFDSIHKNRAQIVASADVLIAHAQSCHADRQGGQGGLFSDPGAGRPRLSKTENWNQVDLL
DPO3A_CAUCN     RAIENLARAGAFDSIHKNRAQIVASADVLIAHAQSCHADRQGGQGGLFSDPGAGRPRLSKTENWNQVDLL
DPO3A_BORBU     KFLESAIKSGLFDSLDQNRKTLFENLDHLIEVVSEDKNNKKLGQNSLFGALESQDPIQQSFNY---QTFK
DPO3A_ECO57     RVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEEPE-QIEQSYASEQVVL
DPO3A_ECOLI     RVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEEPE-QIEQSYASEQVVL
DPO3A_ECOL6     RVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEEPE-QIEQSYASEQVVL
DPO3A_PSEFL     RTLDGLIRSGALDRLHDNRAVLLAAMEEAIKSAEQTARTRDSGHADLFGGLFVEEDADVYAIHRKAKELT
DPO3A_HAEIN     RTFESLIMSGAFDKLGPHRAALSKNLEDALRASDQHAKDEAMGQTDMFGVEDVENAYANTPPYTEKQILD
DPO3A_TREPA     KNAEIMIKAGCFDRFGVTRASLTAHLDDAMKYVARKKAVTSSRQASLFDETDLGETFPVMEEWSQRERLR
DPO3A_VIBCH     RVIEKLILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQADMFGVLTDAPEEVEQKEWPEKVRLE
DPO3A_SALTY     RVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQTDMFGVLAEEPE-QIEQSYASEQVVL
DPO3A_BUCAI     RVLEKLIMSGSCDCFDKNRNYLLQSIDDAINASKESFRIKSFKQDSLFGIXXXXXXXXXXXXCPEKNKLQ
DPO3A_PSEAE     RTLEALIRAGALDRLHDNRAVLLXXXXXXXXXXXXXXRSHDSGHMDLFGGVFAEPEADVYANHRKVKELT
DPO3A_PASMU     RTFESLILSGAFDKLGPHRAALSKNLEDALKASDQHAKDAAMGQADMFGVLTESEKAYASTPRWSEKVIL
DPO3A_NEIMB     RTLEALIRGGAFDSIEPNRAMLLANIDLXXXXXXXXXXXXXXGGLFDMMEDAIEPVRLIDAPMWSESEKL
DPO3A_CAMJE     RTLESLIKAGAFDEFGFTRKALFDNMENLSEASRKMAEVRKNAASSLFGEEELTSGVQV--NFTPKNEKL
DPO3A_THEAQ     RALESLVKAGALDAFGD-RARLLASLEPLLRWAAETRERGRSGLVGLFAEVEEPP--LVEASPLDEITML
DPO3A_NEIMA     RTLEALIRGGAFDSIEPNRAMLLANIDLXXXXXXXXXXXXXQGGLFDMMEDAIEPVRLIDAPMWSESEKL
DPO3A_BUCAP     KVLEKLIMSGSCDCFNKNRNYLLSLIEDAIKASKEHFKIKKFQQESLFXXXXXXXXXXXXXSFSDEEKKL
DPO3A_XYLFT     RALEAMIHAGALDELGKNRASVMLQLPEVIKATEQMSRERESGQNSLFNADPGTPVIQLDLPECEEWPLT
DPO3A_HELPY     KSLEPLVKSGSLDNLGYTRKTMLANLDLICDAGRAKDKANEMMQFGAMEGGTKEQVVLDMIDLGDAKTLL