[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL03799.1

[Show Plain Result]


## Summary of Sequence Search
    1::652
  809::882     6e-13  34% 2021 aa  OMPA_RICCN RecName: Full=Outer membrane protein A;AltName: Full=rOmp
 1154::1461    2e-12  29% 2249 aa  OMPA_RICRI RecName: Full=Outer membrane protein A;AltName: Full=rOmp
 3092::3427    4e-07  22% 3971 aa  YHU2_SCHPO RecName: Full=Uncharacterized threonine-rich GPI-anchored
  160::515     2e-06  30% 1656 aa  OMPB_RICJA RecName: Full=Outer membrane protein B;AltName:
  184::294     2e-05  44% 1655 aa  OMPB_RICCN RecName: Full=Outer membrane protein B;AltName:
  502::697     4e-05  29% 1526 aa  YPJA_ECOLI RecName: Full=Uncharacterized outer membrane protein
  713::892     2e-04  22% 1758 aa  YUAO_ECOLI RecName: Full=Uncharacterized protein yuaO;Flags:
   65::274     5e-04  29%  928 aa  PMP9_CHLPN RecName: Full=Probable outer membrane protein
  241::343     5e-04  33%  363 aa  FLGI_COLP3 RecName: Full=Flagellar P-ring protein;AltName:
 1122::1191    2e-06  47% 2249 aa  OMPA_RICRI RecName: Full=Outer membrane protein A;AltName: Full=rOmp(query 31->108)
  382::472     2e-04  34% 1656 aa  OMPB_RICJA RecName: Full=Outer membrane protein B;AltName:(query 6->101)
    1::652

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxYRRGRIIVQFTQNSLVRFQQDVISDIDFNGTAAQVTIADGKNVGGATGGNIDNKLGGGVNILNFV
OMPA_RICCN      -------------------LLRVQGGVVKSINLTDNASAVTFTNPVVVTGA----IDNTGNANNGIVTFT
OMPA_RICRI      ----------------------------------------------------------------------
YHU2_SCHPO      ----------------------------------------------------------------------
OMPB_RICJA      ----------------------------------------------------------------------
OMPB_RICCN      ----------------------------------------------------------------------
YPJA_ECOLI      ----------------------------------------------------------------------
YUAO_ECOLI      ----------------------------------------------------------------------
PMP9_CHLPN      ----------------------------------------------------------------------
FLGI_COLP3      ----------------------------------------------------------------------
OMPA_RICRI      ------------------------------INLTDNASAVTFTNPVVVTGA----IDNTGNANNGIVTFT
OMPB_RICJA      -----FKTAASIVAITQNSN-------FGTTDFGNLAAQVTVPDTMTLTGNFTGDANNP-GNTAGVITFA


                         .         .         *         .         .         .         .:140
query           GNSTVIGNVGATNPVNILNVQGNNAGTINLAAGGNLAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
OMPA_RICCN      GDSTVTGNIGNTNALATISVGAGKA---------------------------------------------
OMPA_RICRI      ----------------------------------------------------------------------
YHU2_SCHPO      ----------------------------------------------------------------------
OMPB_RICJA      ----------------------------------------------------------------------
OMPB_RICCN      ----------------------------------------------------------------------
YPJA_ECOLI      ----------------------------------------------------------------------
YUAO_ECOLI      ----------------------------------------------------------------------
PMP9_CHLPN      ----------------------------------------------------------------------
FLGI_COLP3      ----------------------------------------------------------------------
OMPA_RICRI      GNSTVTGDIGNTNALATVNV---GAG-ITLQAGGSLAA--------------------------------
OMPB_RICJA      ANGTLAANVAVTN--NITAIEASGVGVVQLS---------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
OMPA_RICCN      ----------------------------------------------------------------------
OMPA_RICRI      ----------------------------------------------------------------------
YHU2_SCHPO      ----------------------------------------------------------------------
OMPB_RICJA      ----------------------------------------------------------------------
OMPB_RICCN      ----------------------------------------------------------------------
YPJA_ECOLI      ----------------------------------------------------------------------
YUAO_ECOLI      ----------------------------------------------------------------------
PMP9_CHLPN      ----------------------------------------------------------------------
FLGI_COLP3      ----------------------------------------------------------------------
OMPA_RICRI      ----------------------------------------------------------------------
OMPB_RICJA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxITVNAAGNKTVI
OMPA_RICCN      ----------------------------------------------------------------GNTNAL
OMPA_RICRI      ------------------------------------------------------------VTFTGNSTVT
YHU2_SCHPO      -----------------------------------------------------------------SSTAI
OMPB_RICJA      ----------------------------------------------------------------------
OMPB_RICCN      ----------------------------------------------------------------------
YPJA_ECOLI      -----------------------------------------------------------TIDTGGK--LI
YUAO_ECOLI      -------------------------------------------------------------NAASAKVIV
PMP9_CHLPN      ----------------------------------------------------------VSITNAGSPTAL
FLGI_COLP3      ----------------------------------------------------------------------
OMPA_RICRI      ----------------------------------------------------------------------
OMPB_RICJA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LQKSVSATSLTLGNNAVANLQDSLTKSGNVDFTNGGVLEFSGANPAGYLLNSQIKNGNTGTLNVYTTGTI
OMPA_RICCN      ATVNVGAVTLQAGGSLDAN---------NIDFGARSTLEFNGGNAIPYYFKXXXXXXXXXXLNVNTK--L
OMPA_RICRI      IGNTNALATVNVGAGITLQAGGSLA-ANNIDFGARSTLEFNGPLDGGYYFKXXXXXXXXXXLNVNTK--L
YHU2_SCHPO      TSSSIVNSSTPITSSSVLNSSTAITSSSSTPITSSSILNSSTPITSSTVVNSSTPITSSTTLNTSTPITS
OMPB_RICJA      ------------GGAAIAN--NDLSGLGTIDFAAASTLVFDLANPAPLILNALIVNGANGTLNV--TNGF
OMPB_RICCN      -------------------------------------LVFNLANPAPLILNAVIVNGANGTLNV--TNGF
YPJA_ECOLI      VQKEAKTDSTRLNNGGVLEVQDG-GEAKHVEQQSGGALIASGTNSYGYIRNSEAKNENAGSLTVVTGSRA
YUAO_ECOLI      DNADLSANSMSIGEGDTA----AVTMTGNATISSGNTFTVARGNNASATLDSKXXXXXXXXXXXEKAQTV
PMP9_CHLPN      TASCFKETTLSFQGHGYQFLLQNIDAGANCTFTNTAANKXXXXXXXXXXXXIQTTNATTGTGAIKSTGAC
FLGI_COLP3      -------------------------------------LEFEPASPAAKI----IVNSRTGTIVIGSEVTL
OMPA_RICRI      ----------------------------------------------------------------------
OMPB_RICJA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LTATDSSIGMVNTINIGQGNAVAAFTIDVSNKALTLGSDINLNNTKSVFGLTTSKNQQVTFMNSVDGFAG
OMPA_RICCN      LTAYHLTIGTVAEINIGAGNL---FAIDASAGDVTIAQDIHFRALDSALVLSNLTGVGVNNIPGVDEFDG
OMPA_RICRI      LTASHLTIGTVAEINIGAGNL---FTIDASVGDVTIAQNINFRARDSVLVLSNLTGVGVNILLAADLVAP
YHU2_SCHPO      SSVLNSSTAITSSSIVNSSTPITSSSVLNSSTPITSSTTLNLNSSTAITSSSVLNSSTPITSSSVLNSST
OMPB_RICJA      IQVSDKSFATVKAINIGDGQGFMFXXXXXXXXXXXXGTTINFNGTDGTGRLVLSKNGAATDFN-VTGSLG
OMPB_RICCN      IKVSSKSFATVNVINIGDGQGI-MFNTDADNNTLNLGATITFNGTDGTGRLVLSKNAAATDFN-VTGSLG
YPJA_ECOLI      VDTIINANGKMDVYGKDVGTVLSAGTQTIYASATSDKANIK-GGKQTVYGLATEANEQIVDGGSTEKTHI
YUAO_ECOLI      LTLKDSALAATGDVIMGQGQETQTDLTLSPQSSIKVSGNMSIAQGNAASAKVIVDNADLS-ANSMSIGEG
PMP9_CHLPN      SIQSNYSCYFGQNFSNDNGGALQGSSISLSNKATQKGGGITINNTSASFSENTSSNKAISFINSVTATSA
FLGI_COLP3      LAAAITHGGITVTINVSQPNAFAEGETVVTNQ-----SDINVSNSDARMFVFKPGVTLETLVRAINEVGA
OMPA_RICRI      ----------------------------------------------------------------------
OMPB_RICJA      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GGGSVNLSSTSSTIPNDNVLTLQGNLGNETLGTKANPLAXXXXXXXXXXXXXXXXXXXXXLDMSNTAVLN
OMPA_RICCN      GVNGLNIGS--------NVAGAARNIG-DVGGNKFNTLLIYNAVTITD-------------DVNLEGIQN
OMPA_RICRI      GADEXXXXXXXXXXXXXXXXXXXXTARNDGGGNKFNTLLIYNAVTITD-------------DVNLEGIQN
YHU2_SCHPO      PITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPI-------------------------TSSTVVN
OMPB_RICJA      GNGIIEL----NTVAINGQLIANAGPANAVIGTRAAGFVVSVDNGKAATIDGQVYAKDMVIQSANAHIVD
OMPB_RICCN      G---------------------------------------------------------------------
YPJA_ECOLI      NGGTQTVQNYGKAINTDIVSGLQQIMANGT----------------------------------------
YUAO_ECOLI      DTAAVTMTGNGATISSGNTFTVRGNNASATL---------------------------------------
PMP9_CHLPN      TGGAIYCSSTSAPKP---VLTLSDN---------------------------------------------
FLGI_COLP3      GPGDV-----------------------------------------------------------------
OMPA_RICRI      ----------------------------------------------------------------------
OMPB_RICJA      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           IAAGGVFADASLTSAKIAKINIGEVNAGPAVYALDALNGDFPLDAPGVTFVNSASVLKLMTTVASGKNST
OMPA_RICCN      VLINN---NADFTSS--TAFNAGTIQINDATYTIDANNGNLNIPAGNIKFAHADAQLILQNS--SGNDRT
OMPA_RICRI      VL---INKNADFTSS--TAFNAGAIQINDATYTIDANNGNLNIPAGNIQFAHADAQLVLQNS--SGNDRT
YHU2_SCHPO      SSTPITSSTTLNTSTPITSSSV--LNSSTAITSSTALNTSTPITSSSVTAITSSSILNSSTPVTSSSNSS
OMPB_RICJA      VGIDGTTAFKTAASSNFGTTDFGNLAAQVTVPDTMTLTGNFTGDAPG----NTAGVITFATLASASADAN
OMPB_RICCN      ----------------------------------------------------------------------
YPJA_ECOLI      ----------------------------------------------------------------------
YUAO_ECOLI      ----------------------------------------------------------------------
PMP9_CHLPN      ----------------------------------------------------------------------
FLGI_COLP3      ----------------------------------------------------------------------
OMPA_RICRI      ----------------------------------------------------------------------
OMPB_RICJA      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           IELTGNIEPVVPNTGVVEINARNANTKLTIDGMANKYAIGTKANPVSKVQLTGHGTLVITALNxxxxxxx
OMPA_RICCN      ITLGANIDPDNDDEGIVILNSVTAGKKLTIAG--------------------------------------
OMPA_RICRI      ITLGANIDPDNDDEGIVILNSVTAGKKLTIAG--------------------------------------
YHU2_SCHPO      TPITSS-TVVNSSTPITSSTALNTSTPITSSSVLN------SSTPITSSTVVNSSTPITTALN-------
OMPB_RICJA      VAVTNNITAIASGVGVVQLSTHTAELRLGNAGSVFKLADGTVINKVNQTVLVG-GVLAAGAI--------
OMPB_RICCN      ----------------------------------------------------------------------
YPJA_ECOLI      ----------------------------------------------------------------------
YUAO_ECOLI      ----------------------------------------------------------------------
PMP9_CHLPN      ----------------------------------------------------------------------
FLGI_COLP3      ----------------------------------------------------------------------
OMPA_RICRI      ----------------------------------------------------------------------
OMPB_RICJA      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxx
OMPA_RICCN      ----------------------
OMPA_RICRI      ----------------------
YHU2_SCHPO      ----------------------
OMPB_RICJA      ----------------------
OMPB_RICCN      ----------------------
YPJA_ECOLI      ----------------------
YUAO_ECOLI      ----------------------
PMP9_CHLPN      ----------------------
FLGI_COLP3      ----------------------
OMPA_RICRI      ----------------------
OMPB_RICJA      ----------------------