[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL03816.1

[Show Plain Result]


## Summary of Sequence Search
    1::122
  149::260     7e-31  53%  280 aa  RADC_AGRT5 RecName: Full=DNA repair protein radC homolog;
  132::243     4e-30  54%  263 aa  RADC_RHISN RecName: Full=DNA repair protein radC homolog;
  143::254     5e-30  52%  274 aa  RADC_RHIEC RecName: Full=DNA repair protein radC homolog;
  143::254     5e-30  52%  274 aa  RADC_RHIE6 RecName: Full=DNA repair protein radC homolog;
  131::240     8e-30  54%  262 aa  RADC_RHIME RecName: Full=DNA repair protein radC homolog;
  144::255     8e-30  51%  275 aa  RADC_RHILW RecName: Full=DNA repair protein radC homolog;
  129::238     1e-29  55%  260 aa  RADC_SINMW RecName: Full=DNA repair protein radC homolog;
  144::255     3e-29  49%  275 aa  RADC_RHIL3 RecName: Full=DNA repair protein radC homolog;
  133::243     9e-29  48%  263 aa  RADC_PARDP RecName: Full=DNA repair protein radC homolog;
   84::194     4e-28  45%  214 aa  RADC_RHOCA RecName: Full=DNA repair protein radC homolog;
  119::229     1e-27  49%  249 aa  RADC_OCHA4 RecName: Full=DNA repair protein radC homolog;
  119::229     2e-27  49%  249 aa  RADC_BRUSU RecName: Full=DNA repair protein radC homolog;
  119::229     2e-27  49%  249 aa  RADC_BRUME RecName: Full=DNA repair protein radC homolog;
  119::229     2e-27  49%  249 aa  RADC_BRUMB RecName: Full=DNA repair protein radC homolog;
  119::229     2e-27  49%  249 aa  RADC_BRUC2 RecName: Full=DNA repair protein radC homolog;
  119::229     2e-27  49%  249 aa  RADC_BRUAB RecName: Full=DNA repair protein radC homolog;
  119::229     2e-27  49%  249 aa  RADC_BRUA2 RecName: Full=DNA repair protein radC homolog;
  119::229     2e-27  49%  249 aa  RADC_BRUA1 RecName: Full=DNA repair protein radC homolog;
   94::202     3e-27  44%  224 aa  RADC_SILPO RecName: Full=DNA repair protein radC homolog;
  120::230     5e-27  49%  250 aa  RADC_RHOP2 RecName: Full=DNA repair protein radC homolog;
  111::206     9e-21  47%  224 aa  RADC_CELJU RecName: Full=DNA repair protein radC homolog;
  111::206     9e-21  46%  224 aa  RADC_AZOVD RecName: Full=DNA repair protein radC homolog;
   47::140     3e-20  44%  160 aa  YFJY_ECOLI RecName: Full=Putative radC-like protein yfjY;
  112::206     3e-20  45%  224 aa  RADC_VIBVY RecName: Full=DNA repair protein radC homolog;
  112::206     3e-20  45%  224 aa  RADC_VIBVU RecName: Full=DNA repair protein radC homolog;
  112::208     6e-20  45%  226 aa  RADC_PSEPG RecName: Full=DNA repair protein radC homolog;
  112::206     1e-19  44%  224 aa  RADC_VIBCM RecName: Full=DNA repair protein radC homolog;
  112::206     1e-19  44%  224 aa  RADC_VIBCH RecName: Full=DNA repair protein radC homolog;
  112::206     1e-19  44%  224 aa  RADC_VIBC3 RecName: Full=DNA repair protein radC homolog;
  111::206     1e-19  45%  224 aa  RADC_PSEA7 RecName: Full=DNA repair protein radC homolog;
  111::206     2e-19  45%  224 aa  RADC_PSEU5 RecName: Full=DNA repair protein radC homolog;
  112::208     2e-19  43%  226 aa  RADC_PSEPW RecName: Full=DNA repair protein radC homolog;
  112::206     2e-19  46%  224 aa  RADC_JANMA RecName: Full=DNA repair protein radC homolog;
   93::208     2e-19  40%  224 aa  RADC_PSEFS RecName: Full=DNA repair protein radC homolog;
  112::208     3e-19  44%  226 aa  RADC_PSEPK RecName: Full=DNA repair protein radC homolog;
  112::208     3e-19  44%  226 aa  RADC_PSEP1 RecName: Full=DNA repair protein radC homolog;
  111::206     3e-19  44%  224 aa  RADC_PSEMY RecName: Full=DNA repair protein radC homolog;
   93::206     4e-19  40%  224 aa  RADC_RALSO RecName: Full=DNA repair protein radC homolog;
  111::206     4e-19  44%  224 aa  RADC_PSEAB RecName: Full=DNA repair protein radC homolog;
  111::206     4e-19  44%  224 aa  RADC_PSEA8 RecName: Full=DNA repair protein radC homolog;
  112::206     5e-19  42%  226 aa  RADC_PSEE4 RecName: Full=DNA repair protein radC homolog;
  113::206     6e-19  45%  224 aa  RADC_ALCBS RecName: Full=DNA repair protein radC homolog;
  111::206     8e-19  43%  224 aa  RADC_PSEAE RecName: Full=DNA repair protein radC homolog;
  112::206     8e-19  42%  225 aa  RADC_ALTMD RecName: Full=DNA repair protein radC homolog;
  108::202     8e-19  45%  220 aa  RADC_ACTSZ RecName: Full=DNA repair protein radC homolog;
  106::212     1e-18  42%  233 aa  RADC_THETN RecName: Full=DNA repair protein radC homolog;
  111::206     1e-18  41%  224 aa  RADC_RALPJ RecName: Full=DNA repair protein radC homolog;
  112::206     1e-18  45%  224 aa  RADC_PHOPR RecName: Full=DNA repair protein radC homolog;
   28::141     1e-18  35%  158 aa  Y1786_VIBCH RecName: Full=Putative radC-like protein VC_1786;
  111::206     1e-18  42%  224 aa  RADC_PSEPF RecName: Full=DNA repair protein radC homolog;
  112::206     1e-18  43%  224 aa  RADC_PASMU RecName: Full=DNA repair protein radC homolog;
  112::206     2e-18  41%  224 aa  RADC_VIBFM RecName: Full=DNA repair protein radC homolog;
  102::212     2e-18  38%  230 aa  RADC_PHOLL RecName: Full=DNA repair protein radC homolog;
  112::206     2e-18  42%  224 aa  RADC_ALISL RecName: Full=DNA repair protein radC homolog;
  112::206     2e-18  41%  224 aa  RADC_VIBF1 RecName: Full=DNA repair protein radC homolog;
   94::207     2e-18  36%  225 aa  RADC_VARPS RecName: Full=DNA repair protein radC homolog;
  111::208     3e-18  40%  224 aa  RADC_TERTT RecName: Full=DNA repair protein radC homolog;
  113::207     3e-18  41%  234 aa  RADC_STRMK RecName: Full=DNA repair protein radC homolog;
  103::216     3e-18  37%  234 aa  RADC_RHOFD RecName: Full=DNA repair protein radC homolog;
  111::206     3e-18  41%  225 aa  RADC_NEIMF RecName: Full=DNA repair protein radC homolog;
  111::206     3e-18  41%  225 aa  RADC_NEIMB RecName: Full=DNA repair protein radC homolog;
  111::206     3e-18  41%  225 aa  RADC_NEIMA RecName: Full=DNA repair protein radC homolog;
  111::206     3e-18  41%  225 aa  RADC_NEIM0 RecName: Full=DNA repair protein radC homolog;
  111::206     3e-18  41%  225 aa  RADC_NEIG2 RecName: Full=DNA repair protein radC homolog;
  111::206     3e-18  41%  225 aa  RADC_NEIG1 RecName: Full=DNA repair protein radC homolog;
  112::206     3e-18  43%  224 aa  RADC_HERAR RecName: Full=DNA repair protein radC homolog;
  110::204     3e-18  47%  222 aa  RADC_HAES2 RecName: Full=DNA repair protein radC homolog;
  110::204     3e-18  47%  222 aa  RADC_HAES1 RecName: Full=DNA repair protein radC homolog;
  113::207     4e-18  41%  234 aa  RADC_STRM5 RecName: Full=DNA repair protein radC homolog;
  112::206     4e-18  40%  228 aa  RADC_RALEJ RecName: Full=DNA repair protein radC homolog;
  119::214     5e-18  39%  234 aa  RADC_SYMTH RecName: Full=DNA repair protein radC homolog;
   93::193     5e-18  42%  224 aa  RADC_MARMS RecName: Full=DNA repair protein radC homolog;
  111::206     7e-18  44%  224 aa  RADC_PSEF5 RecName: Full=DNA repair protein radC homolog;
  117::212     7e-18  39%  230 aa  RADC_ENTS8 RecName: Full=DNA repair protein radC homolog;
  123::206     1e-17  43%  225 aa  RADC_XANOR RecName: Full=DNA repair protein radC homolog;
  123::206     1e-17  43%  225 aa  RADC_XANOP RecName: Full=DNA repair protein radC homolog;
   45::124     2e-17  45%  158 aa  YKFG_ECOLI RecName: Full=Putative radC-like protein ykfG;
  111::208     2e-17  40%  226 aa  RADC_STACT RecName: Full=DNA repair protein radC homolog;
  112::206     2e-17  39%  224 aa  RADC_NITMU RecName: Full=DNA repair protein radC homolog;
   93::206     2e-17  35%  224 aa  RADC_NITEC RecName: Full=DNA repair protein radC homolog;
  111::208     2e-17  42%  224 aa  RADC_PSEHT RecName: Full=DNA repair protein radC homolog;
  116::207     3e-17  43%  223 aa  RADC_FINM2 RecName: Full=DNA repair protein radC homolog;
  123::206     4e-17  42%  225 aa  RADC_XANOM RecName: Full=DNA repair protein radC homolog;
  123::206     4e-17  42%  225 aa  RADC_XANAC RecName: Full=DNA repair protein radC homolog;
  110::216     4e-17  38%  232 aa  RADC_FUSNN RecName: Full=DNA repair protein radC homolog;
  109::203     5e-17  44%  221 aa  RADC_HAEIE RecName: Full=DNA repair protein radC homolog;
   90::203     5e-17  39%  221 aa  RADC_HAEI8 RecName: Full=DNA repair protein radC homolog;
  121::212     6e-17  40%  229 aa  RADC_METBF RecName: Full=DNA repair protein radC homolog;
  112::206     6e-17  35%  228 aa  RADC_CUPTR RecName: Full=DNA repair protein radC homolog;
  111::206     6e-17  39%  225 aa  RADC_AZOSB RecName: Full=DNA repair protein radC homolog;
  107::203     8e-17  36%  221 aa  RADC_SALAR RecName: Full=DNA repair protein radC;
  121::199     8e-17  43%  229 aa  RADC_METMA RecName: Full=DNA repair protein radC homolog;
  121::199     8e-17  43%  229 aa  RADC_METAC RecName: Full=DNA repair protein radC homolog;
  129::214     8e-17  44%  230 aa  RADC_DESAP RecName: Full=DNA repair protein radC homolog;
  146::237     8e-17  41%  259 aa  RADC_BURPP RecName: Full=DNA repair protein radC homolog;
   45::142     1e-16  37%  157 aa  Y510_VIBCH RecName: Full=Putative radC-like protein VC_0510;
  123::206     1e-16  42%  225 aa  RADC_XANC5 RecName: Full=DNA repair protein radC homolog;
  109::206     1e-16  39%  222 aa  RADC_SHIFL RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_SHIF8 RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_SHIBS RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_SHIB3 RecName: Full=DNA repair protein radC;
   93::206     1e-16  35%  224 aa  RADC_NITEU RecName: Full=DNA repair protein radC homolog;
  124::210     1e-16  41%  229 aa  RADC_METBU RecName: Full=DNA repair protein radC homolog;
  112::206     1e-16  41%  224 aa  RADC_MARAV RecName: Full=DNA repair protein radC homolog;
  109::206     1e-16  39%  222 aa  RADC_ESCF3 RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECOUT RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECOSM RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECOLU RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECOLI RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECOL6 RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECOL5 RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECOK1 RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECOHS RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECODH RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECOBW RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECO8A RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECO81 RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECO7I RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECO5E RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECO57 RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECO55 RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECO45 RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECO27 RecName: Full=DNA repair protein radC;
  109::206     1e-16  39%  222 aa  RADC_ECO24 RecName: Full=DNA repair protein radC;
  111::195     1e-16  41%  224 aa  RADC_PSE14 RecName: Full=DNA repair protein radC homolog;
   91::198     1e-16  37%  220 aa  RADC_ACTPJ RecName: Full=DNA repair protein radC homolog;
   91::198     1e-16  37%  220 aa  RADC_ACTP7 RecName: Full=DNA repair protein radC homolog;
   91::198     1e-16  37%  220 aa  RADC_ACTP2 RecName: Full=DNA repair protein radC homolog;
  109::206     2e-16  38%  222 aa  RADC_SHIDS RecName: Full=DNA repair protein radC;
  111::206     2e-16  33%  228 aa  RADC_RALEH RecName: Full=DNA repair protein radC homolog;
  111::195     2e-16  42%  224 aa  RADC_PSESM RecName: Full=DNA repair protein radC homolog;
  112::206     2e-16  37%  225 aa  RADC_XANCP RecName: Full=DNA repair protein radC homolog;
  112::206     2e-16  37%  225 aa  RADC_XANC8 RecName: Full=DNA repair protein radC homolog;
   93::203     2e-16  33%  221 aa  RADC_KLEP3 RecName: Full=DNA repair protein radC homolog;
  109::203     2e-16  44%  221 aa  RADC_HAEIN RecName: Full=DNA repair protein radC homolog;
  123::208     2e-16  44%  224 aa  RADC_COXBN RecName: Full=DNA repair protein radC homolog;
  123::208     2e-16  44%  224 aa  RADC_COXB1 RecName: Full=DNA repair protein radC homolog;
   90::202     2e-16  35%  220 aa  RADC_CITK8 RecName: Full=DNA repair protein radC homolog;
  126::198     3e-16  47%  227 aa  RADC_DESRM RecName: Full=DNA repair protein radC homolog;
  113::215     3e-16  38%  225 aa  RADC_BACC4 RecName: Full=DNA repair protein radC homolog;
  113::215     3e-16  37%  225 aa  RADC_BACC2 RecName: Full=DNA repair protein radC homolog;
  112::206     4e-16  40%  224 aa  RADC_METFK RecName: Full=DNA repair protein radC homolog;
  108::203     4e-16  35%  221 aa  RADC_KLEP7 RecName: Full=DNA repair protein radC homolog;
  108::203     4e-16  35%  221 aa  RADC_ENT38 RecName: Full=DNA repair protein radC homolog;
  140::231     4e-16  40%  253 aa  RADC_BURXL RecName: Full=DNA repair protein radC homolog;
  113::215     4e-16  37%  225 aa  RADC_BACHK RecName: Full=DNA repair protein radC homolog;
  113::215     4e-16  37%  225 aa  RADC_BACCZ RecName: Full=DNA repair protein radC homolog;
  113::215     4e-16  37%  225 aa  RADC_BACCQ RecName: Full=DNA repair protein radC homolog;
  113::215     4e-16  37%  225 aa  RADC_BACC7 RecName: Full=DNA repair protein radC homolog;
  113::215     4e-16  37%  225 aa  RADC_BACC3 RecName: Full=DNA repair protein radC homolog;
  113::215     4e-16  37%  225 aa  RADC_BACC1 RecName: Full=DNA repair protein radC homolog;
  113::215     4e-16  37%  225 aa  RADC_BACAN RecName: Full=DNA repair protein radC homolog;
  113::215     4e-16  37%  225 aa  RADC_BACAC RecName: Full=DNA repair protein radC homolog;
  113::215     4e-16  37%  225 aa  RADC_BACAA RecName: Full=DNA repair protein radC homolog;
  134::217     5e-16  40%  235 aa  RADC_SYNWW RecName: Full=DNA repair protein radC homolog;
  112::206     5e-16  38%  224 aa  RADC_SACD2 RecName: Full=DNA repair protein radC homolog;
  113::215     5e-16  37%  225 aa  RADC_BACWK RecName: Full=DNA repair protein radC homolog;
  110::204     7e-16  37%  222 aa  RADC_YERE8 RecName: Full=DNA repair protein radC homolog;
  111::206     7e-16  40%  224 aa  RADC_IDILO RecName: Full=DNA repair protein radC homolog;
  121::216     7e-16  40%  232 aa  RADC_ALKOO RecName: Full=DNA repair protein radC homolog;
  116::213     9e-16  37%  229 aa  RADC_PELPD RecName: Full=DNA repair protein radC homolog;
  109::204     9e-16  39%  222 aa  RADC_LEPCP RecName: Full=DNA repair protein radC homolog;
  106::198     9e-16  41%  223 aa  RADC_HAEDU RecName: Full=DNA repair protein radC homolog;
  117::208     1e-15  37%  228 aa  RADC_STAHJ RecName: Full=DNA repair protein radC homolog;
  111::206     1e-15  38%  225 aa  RADC_SHEPW RecName: Full=DNA repair protein radC homolog;
  111::206     1e-15  36%  225 aa  RADC_SHEB8 RecName: Full=DNA repair protein radC homolog;
  112::195     1e-15  42%  224 aa  RADC_PSEU2 RecName: Full=DNA repair protein radC homolog;
  112::206     1e-15  40%  224 aa  RADC_CHRSD RecName: Full=DNA repair protein radC homolog;
  111::206     1e-15  38%  225 aa  RADC_SHEPA RecName: Full=DNA repair protein radC homolog;
  111::206     1e-15  38%  225 aa  RADC_SHEHH RecName: Full=DNA repair protein radC homolog;
  111::206     1e-15  36%  225 aa  RADC_SHEAM RecName: Full=DNA repair protein radC homolog;
  111::206     1e-15  40%  224 aa  RADC_AERHH RecName: Full=DNA repair protein radC homolog;
  110::204     2e-15  37%  222 aa  RADC_YERPY RecName: Full=DNA repair protein radC homolog;
  110::204     2e-15  37%  222 aa  RADC_YERPS RecName: Full=DNA repair protein radC homolog;
  110::204     2e-15  37%  222 aa  RADC_YERPP RecName: Full=DNA repair protein radC homolog;
  110::204     2e-15  37%  222 aa  RADC_YERPN RecName: Full=DNA repair protein radC homolog;
  110::204     2e-15  37%  222 aa  RADC_YERPG RecName: Full=DNA repair protein radC homolog;
  110::204     2e-15  37%  222 aa  RADC_YERPE RecName: Full=DNA repair protein radC homolog;
  110::204     2e-15  37%  222 aa  RADC_YERPB RecName: Full=DNA repair protein radC homolog;
  110::204     2e-15  37%  222 aa  RADC_YERPA RecName: Full=DNA repair protein radC homolog;
  110::204     2e-15  37%  222 aa  RADC_YERP3 RecName: Full=DNA repair protein radC homolog;
  114::209     2e-15  33%  226 aa  RADC_STRA5 RecName: Full=DNA repair protein radC homolog;
  114::209     2e-15  33%  226 aa  RADC_STRA1 RecName: Full=DNA repair protein radC homolog;
  111::206     2e-15  38%  225 aa  RADC_SHESR RecName: Full=DNA repair protein radC homolog;
  111::206     2e-15  38%  225 aa  RADC_SHESM RecName: Full=DNA repair protein radC homolog;
  111::206     2e-15  38%  225 aa  RADC_SHESA RecName: Full=DNA repair protein radC homolog;
  111::206     2e-15  38%  225 aa  RADC_SHEON RecName: Full=DNA repair protein radC homolog;
  114::208     2e-15  41%  224 aa  RADC_BACLD RecName: Full=DNA repair protein radC homolog;
   35::128     3e-15  39%  148 aa  YEES_ECOLI RecName: Full=Putative radC-like protein yeeS;
  114::209     3e-15  33%  226 aa  RADC_STRA3 RecName: Full=DNA repair protein radC homolog;
  111::206     3e-15  38%  225 aa  RADC_SHEFN RecName: Full=DNA repair protein radC homolog;
  111::206     3e-15  36%  225 aa  RADC_SHEB9 RecName: Full=DNA repair protein radC homolog;
  111::206     3e-15  36%  225 aa  RADC_SHEB5 RecName: Full=DNA repair protein radC homolog;
  111::206     3e-15  36%  225 aa  RADC_SHEB2 RecName: Full=DNA repair protein radC homolog;
  108::203     3e-15  35%  221 aa  RADC_SALTY RecName: Full=DNA repair protein radC;
  108::203     3e-15  35%  221 aa  RADC_SALTI RecName: Full=DNA repair protein radC;
  108::203     3e-15  35%  221 aa  RADC_SALSV RecName: Full=DNA repair protein radC;
  108::203     3e-15  35%  221 aa  RADC_SALPC RecName: Full=DNA repair protein radC;
  108::203     3e-15  35%  221 aa  RADC_SALHS RecName: Full=DNA repair protein radC;
  108::203     3e-15  35%  221 aa  RADC_SALG2 RecName: Full=DNA repair protein radC;
  108::203     3e-15  35%  221 aa  RADC_SALEP RecName: Full=DNA repair protein radC;
  108::203     3e-15  35%  221 aa  RADC_SALDC RecName: Full=DNA repair protein radC;
  108::203     3e-15  35%  221 aa  RADC_SALCH RecName: Full=DNA repair protein radC;
  108::203     3e-15  35%  221 aa  RADC_SALA4 RecName: Full=DNA repair protein radC;
  123::206     3e-15  43%  224 aa  RADC_PSEA6 RecName: Full=DNA repair protein radC homolog;
   97::206     3e-15  35%  222 aa  RADC_PELPB RecName: Full=DNA repair protein radC homolog;
  121::216     3e-15  40%  232 aa  RADC_ALKMQ RecName: Full=DNA repair protein radC homolog;
  112::206     3e-15  39%  224 aa  RADC_TOLAT RecName: Full=DNA repair protein radC homolog;
  111::206     3e-15  38%  225 aa  RADC_SHESW RecName: Full=DNA repair protein radC homolog;
  111::206     3e-15  38%  225 aa  RADC_SHEPC RecName: Full=DNA repair protein radC homolog;
  111::206     3e-15  38%  225 aa  RADC_SHELP RecName: Full=DNA repair protein radC homolog;
  111::206     3e-15  36%  225 aa  RADC_SHEDO RecName: Full=DNA repair protein radC homolog;
  108::203     3e-15  35%  221 aa  RADC_SALPK RecName: Full=DNA repair protein radC;
  108::203     3e-15  35%  221 aa  RADC_SALPA RecName: Full=DNA repair protein radC;
  122::213     3e-15  37%  229 aa  RADC_CLOBA RecName: Full=DNA repair protein radC homolog;
  145::240     3e-15  38%  258 aa  RADC_BURVG RecName: Full=DNA repair protein radC homolog;
  118::214     4e-15  38%  226 aa  RADC_STRPZ RecName: Full=DNA repair protein radC homolog;
  118::214     4e-15  38%  226 aa  RADC_STRPG RecName: Full=DNA repair protein radC homolog;
  118::214     4e-15  38%  226 aa  RADC_STRPF RecName: Full=DNA repair protein radC homolog;
  118::214     4e-15  38%  226 aa  RADC_STRPD RecName: Full=DNA repair protein radC homolog;
  118::214     4e-15  38%  226 aa  RADC_STRPC RecName: Full=DNA repair protein radC homolog;
  118::214     4e-15  38%  226 aa  RADC_STRPB RecName: Full=DNA repair protein radC homolog;
  118::214     4e-15  38%  226 aa  RADC_STRP8 RecName: Full=DNA repair protein radC homolog;
  118::214     4e-15  38%  226 aa  RADC_STRP6 RecName: Full=DNA repair protein radC homolog;
  118::214     4e-15  38%  226 aa  RADC_STRP1 RecName: Full=DNA repair protein radC homolog;
  113::215     4e-15  34%  225 aa  RADC_STRE4 RecName: Full=DNA repair protein radC homolog;
   95::208     4e-15  33%  226 aa  RADC_DELAS RecName: Full=DNA repair protein radC homolog;
  110::207     4e-15  41%  235 aa  RADC_CLOD6 RecName: Full=DNA repair protein radC homolog;
  122::213     4e-15  37%  229 aa  RADC_CLOBB RecName: Full=DNA repair protein radC homolog;
  113::216     4e-15  34%  226 aa  RADC_CARHZ RecName: Full=DNA repair protein radC homolog;
  108::203     6e-15  35%  221 aa  RADC_SALNS RecName: Full=DNA repair protein radC;
  100::210     6e-15  36%  229 aa  RADC_CLOB8 RecName: Full=DNA repair protein radC homolog;
   95::204     6e-15  34%  222 aa  RADC_CHLP8 RecName: Full=DNA repair protein radC homolog;
  126::223     6e-15  36%  257 aa  RADC_BURS3 RecName: Full=DNA repair protein radC homolog;
  115::208     7e-15  34%  227 aa  RADC_STRSV RecName: Full=DNA repair protein radC homolog;
  117::210     7e-15  37%  227 aa  RADC_RUBXD RecName: Full=DNA repair protein radC homolog;
  114::208     1e-14  36%  226 aa  RADC_GEOSW RecName: Full=DNA repair protein radC homolog;
  109::204     1e-14  36%  222 aa  RADC_CHLCH RecName: Full=DNA repair protein radC homolog;
  112::206     1e-14  36%  224 aa  RADC_ACIF5 RecName: Full=DNA repair protein radC homolog;
  112::206     1e-14  36%  224 aa  RADC_ACIF2 RecName: Full=DNA repair protein radC homolog;
  118::214     1e-14  36%  226 aa  RADC_STRPM RecName: Full=DNA repair protein radC homolog;
  118::214     1e-14  36%  226 aa  RADC_STRP3 RecName: Full=DNA repair protein radC homolog;
   99::207     1e-14  34%  231 aa  RADC_PARUW RecName: Full=DNA repair protein radC homolog;
  111::206     2e-14  35%  226 aa  RADC_STAS1 RecName: Full=DNA repair protein radC homolog;
  114::208     2e-14  36%  226 aa  RADC_GEOTN RecName: Full=DNA repair protein radC homolog;
  114::208     2e-14  36%  226 aa  RADC_GEOKA RecName: Full=DNA repair protein radC homolog;
  113::208     2e-14  34%  225 aa  RADC_STRS7 RecName: Full=DNA repair protein radC homolog;
  113::208     2e-14  34%  225 aa  RADC_STREM RecName: Full=DNA repair protein radC homolog;
  111::206     2e-14  36%  225 aa  RADC_SHESH RecName: Full=DNA repair protein radC homolog;
  125::212     2e-14  38%  228 aa  RADC_GEOUR RecName: Full=DNA repair protein radC homolog;
  144::223     2e-14  39%  257 aa  RADC_BURCH RecName: Full=DNA repair protein radC homolog;
  144::223     2e-14  39%  257 aa  RADC_BURCC RecName: Full=DNA repair protein radC homolog;
  144::223     2e-14  39%  257 aa  RADC_BURCA RecName: Full=DNA repair protein radC homolog;
  128::211     2e-14  38%  232 aa  RADC_BACHD RecName: Full=DNA repair protein radC homolog;
  119::213     2e-14  37%  231 aa  RADC_BACA2 RecName: Full=DNA repair protein radC homolog;
  111::202     2e-14  41%  220 aa  RADC_AERS4 RecName: Full=DNA repair protein radC homolog;
  111::195     3e-14  39%  228 aa  RADC_STAAB RecName: Full=DNA repair protein radC homolog;
  111::206     3e-14  36%  225 aa  RADC_SHEWM RecName: Full=DNA repair protein radC homolog;
  112::206     4e-14  37%  224 aa  RADC_VIBSL RecName: Full=DNA repair protein radC homolog;
  111::195     4e-14  39%  228 aa  RADC_STAAW RecName: Full=DNA repair protein radC homolog;
  111::195     4e-14  39%  228 aa  RADC_STAAS RecName: Full=DNA repair protein radC homolog;
  111::195     4e-14  39%  228 aa  RADC_STAAE RecName: Full=DNA repair protein radC homolog;
  111::195     4e-14  39%  228 aa  RADC_STAAC RecName: Full=DNA repair protein radC homolog;
  101::185     4e-14  39%  218 aa  RADC_STAA8 RecName: Full=DNA repair protein radC homolog;AltName:
  101::185     4e-14  39%  218 aa  RADC_STAA3 RecName: Full=DNA repair protein radC homolog;
  111::206     4e-14  35%  224 aa  RADC_POLNA RecName: Full=DNA repair protein radC homolog;
  109::204     5e-14  34%  223 aa  RADC_PROVI RecName: Full=DNA repair protein radC homolog;
  118::210     5e-14  35%  230 aa  RADC_BACSK RecName: Full=DNA repair protein radC homolog;
  111::206     5e-14  35%  224 aa  RADC_BACP2 RecName: Full=DNA repair protein radC homolog;
  118::207     6e-14  32%  246 aa  RADC_STRS2 RecName: Full=DNA repair protein radC homolog;
  109::184     6e-14  42%  222 aa  RADC_METPP RecName: Full=DNA repair protein radC homolog;
  126::213     6e-14  36%  229 aa  RADC_GEOSL RecName: Full=DNA repair protein radC homolog;
  123::219     6e-14  35%  235 aa  RADC_COPPD RecName: Full=DNA repair protein radC homolog;
  109::204     6e-14  34%  222 aa  RADC_CHLTE RecName: Full=DNA repair protein radC homolog;
  112::206     8e-14  35%  224 aa  RADC_VIBPA RecName: Full=DNA repair protein radC homolog;
  138::221     8e-14  37%  250 aa  RADC_THEEB RecName: Full=DNA repair protein radC homolog;
  128::211     8e-14  37%  229 aa  RADC_MOOTA RecName: Full=DNA repair protein radC homolog;
  128::213     8e-14  36%  229 aa  RADC_CLOAB RecName: Full=DNA repair protein radC homolog;
  130::213     8e-14  39%  231 aa  RADC_BACSU RecName: Full=DNA repair protein radC homolog;
  112::206     1e-13  35%  224 aa  RADC_VIBHB RecName: Full=DNA repair protein radC homolog;
  127::197     1e-13  39%  228 aa  RADC_CLONN RecName: Full=DNA repair protein radC homolog;
  134::217     1e-13  38%  243 aa  RADC_SYNY3 RecName: Full=DNA repair protein radC homolog;
  113::207     1e-13  38%  225 aa  RADC_PSYIN RecName: Full=DNA repair protein radC homolog;
  109::206     1e-13  35%  223 aa  RADC_CHLPB RecName: Full=DNA repair protein radC homolog;
  124::221     1e-13  35%  237 aa  RADC_ACIAC RecName: Full=DNA repair protein radC homolog;
   98::204     2e-13  34%  223 aa  RADC_PROA2 RecName: Full=DNA repair protein radC homolog;
  123::202     2e-13  40%  224 aa  RADC_XYLFT RecName: Full=DNA repair protein radC homolog;
  123::202     2e-13  40%  224 aa  RADC_XYLFA RecName: Full=DNA repair protein radC homolog;
  111::206     2e-13  38%  224 aa  RADC_THIDA RecName: Full=DNA repair protein radC homolog;
  134::217     2e-13  35%  243 aa  RADC_SYNP2 RecName: Full=DNA repair protein radC homolog;
  123::208     2e-13  36%  224 aa  RADC_LISMO RecName: Full=DNA repair protein radC homolog;
  123::208     2e-13  36%  224 aa  RADC_LISMH RecName: Full=DNA repair protein radC homolog;
  123::208     2e-13  36%  224 aa  RADC_LISMF RecName: Full=DNA repair protein radC homolog;
  123::208     2e-13  36%  224 aa  RADC_LISMC RecName: Full=DNA repair protein radC homolog;
  134::217     2e-13  37%  243 aa  RADC_CYAP7 RecName: Full=DNA repair protein radC homolog;
  113::208     3e-13  36%  225 aa  RADC_THICR RecName: Full=DNA repair protein radC homolog;
  124::212     3e-13  36%  228 aa  RADC_CLOTE RecName: Full=DNA repair protein radC homolog;
  121::200     3e-13  38%  228 aa  RADC_CLOK5 RecName: Full=DNA repair protein radC homolog;
  121::200     3e-13  38%  228 aa  RADC_CLOK1 RecName: Full=DNA repair protein radC homolog;
  117::208     4e-13  35%  226 aa  RADC_STAES RecName: Full=DNA repair protein radC homolog;
  117::214     4e-13  33%  230 aa  RADC_GEOLS RecName: Full=DNA repair protein radC homolog;
  120::200     4e-13  40%  228 aa  RADC_CLOBM RecName: Full=DNA repair protein radC homolog;
  120::199     4e-13  39%  228 aa  RADC_CLOBK RecName: Full=DNA repair protein radC homolog;
  120::199     4e-13  39%  228 aa  RADC_CLOBJ RecName: Full=DNA repair protein radC homolog;
  120::199     4e-13  39%  228 aa  RADC_CLOBH RecName: Full=DNA repair protein radC homolog;
  120::199     4e-13  39%  228 aa  RADC_CLOB6 RecName: Full=DNA repair protein radC homolog;
  120::199     4e-13  39%  228 aa  RADC_CLOB1 RecName: Full=DNA repair protein radC homolog;
  109::204     4e-13  33%  223 aa  RADC_CHLPD RecName: Full=DNA repair protein radC homolog;
  120::199     7e-13  39%  228 aa  RADC_CLOBL RecName: Full=DNA repair protein radC homolog;
  123::208     9e-13  34%  224 aa  RADC_LISIN RecName: Full=DNA repair protein radC homolog;
  122::213     9e-13  32%  232 aa  RADC_ENTFA RecName: Full=DNA repair protein radC homolog;
  123::209     9e-13  34%  227 aa  RADC_CLOPS RecName: Full=DNA repair protein radC homolog;
  109::203     1e-12  34%  221 aa  RADC_ERWCT RecName: Full=DNA repair protein radC homolog;
  109::203     2e-12  34%  221 aa  RADC_PECCP RecName: Full=DNA repair protein radC homolog;
  111::206     2e-12  34%  224 aa  RADC_POLSJ RecName: Full=DNA repair protein radC homolog;
  123::209     2e-12  33%  227 aa  RADC_CLOPE RecName: Full=DNA repair protein radC homolog;
  123::209     2e-12  33%  227 aa  RADC_CLOP1 RecName: Full=DNA repair protein radC homolog;
  118::209     3e-12  34%  226 aa  RADC_STRU0 RecName: Full=DNA repair protein radC homolog;
  134::217     3e-12  36%  243 aa  RADC_MICAN RecName: Full=DNA repair protein radC homolog;
  122::219     3e-12  37%  229 aa  RADC_FLAJ1 RecName: Full=DNA repair protein radC homolog;
  132::217     3e-12  35%  242 aa  RADC_CYAA5 RecName: Full=DNA repair protein radC homolog;
  131::212     5e-12  33%  233 aa  RADC_SALRD RecName: Full=DNA repair protein radC homolog;
  109::204     5e-12  32%  223 aa  RADC_PELLD RecName: Full=DNA repair protein radC homolog;
  126::211     5e-12  31%  227 aa  RADC_PELCD RecName: Full=DNA repair protein radC homolog;
  134::217     5e-12  33%  243 aa  RADC_NOSP7 RecName: Full=DNA repair protein radC homolog;
  113::207     5e-12  32%  225 aa  RADC_BORPE RecName: Full=DNA repair protein radC homolog;
  134::209     6e-12  37%  243 aa  RADC_TRIEI RecName: Full=DNA repair protein radC homolog;
  123::195     6e-12  36%  224 aa  RADC_LISW6 RecName: Full=DNA repair protein radC homolog;
  121::213     6e-12  38%  224 aa  RADC_LACSS RecName: Full=DNA repair protein radC homolog;
  114::203     8e-12  33%  226 aa  RADC_LACLA RecName: Full=DNA repair protein radC homolog;
  114::213     1e-11  32%  226 aa  RADC_STRZT RecName: Full=DNA repair protein radC homolog;
  114::213     1e-11  32%  226 aa  RADC_STRZP RecName: Full=DNA repair protein radC homolog;
  114::213     1e-11  32%  226 aa  RADC_STRZJ RecName: Full=DNA repair protein radC homolog;
  114::213     1e-11  32%  226 aa  RADC_STRPN RecName: Full=DNA repair protein radC homolog;
  114::213     1e-11  32%  226 aa  RADC_STRPJ RecName: Full=DNA repair protein radC homolog;
  114::213     1e-11  32%  226 aa  RADC_STRPI RecName: Full=DNA repair protein radC homolog;
  114::213     1e-11  32%  226 aa  RADC_STRP7 RecName: Full=DNA repair protein radC homolog;
  114::213     1e-11  32%  226 aa  RADC_STRP4 RecName: Full=DNA repair protein radC homolog;
  111::206     1e-11  32%  225 aa  RADC_AZOSE RecName: Full=DNA repair protein radC homolog;
  114::213     1e-11  31%  226 aa  RADC_STRR6 RecName: Full=DNA repair protein radC homolog;
  114::213     1e-11  31%  226 aa  RADC_STRP2 RecName: Full=DNA repair protein radC homolog;
  113::209     1e-11  30%  235 aa  RADC_ACIBT RecName: Full=DNA repair protein radC homolog;
  113::209     1e-11  30%  235 aa  RADC_ACIB5 RecName: Full=DNA repair protein radC homolog;
  113::209     1e-11  30%  235 aa  RADC_ACIB3 RecName: Full=DNA repair protein radC homolog;
  114::207     2e-11  32%  228 aa  RADC_STRTD RecName: Full=DNA repair protein radC homolog;
  114::207     2e-11  32%  228 aa  RADC_STRT2 RecName: Full=DNA repair protein radC homolog;
  114::207     2e-11  32%  228 aa  RADC_STRT1 RecName: Full=DNA repair protein radC homolog;
  143::209     2e-11  37%  225 aa  RADC_BORA1 RecName: Full=DNA repair protein radC homolog;
  121::204     3e-11  30%  222 aa  RADC_THEP1 RecName: Full=DNA repair protein radC homolog;
  121::204     3e-11  30%  222 aa  RADC_THEMA RecName: Full=DNA repair protein radC homolog;
  134::209     3e-11  36%  243 aa  RADC_ANAVT RecName: Full=DNA repair protein radC homolog;
  134::209     3e-11  36%  243 aa  RADC_ANASP RecName: Full=DNA repair protein radC homolog;
  112::206     3e-11  35%  224 aa  RADC_ALHEH RecName: Full=DNA repair protein radC homolog;
  134::217     4e-11  30%  243 aa  RADC_CYAP4 RecName: Full=DNA repair protein radC homolog;
  112::208     5e-11  35%  224 aa  RADC_NITOC RecName: Full=DNA repair protein radC homolog;
  111::206     5e-11  32%  224 aa  RADC_HAHCH RecName: Full=DNA repair protein radC homolog;
  125::219     7e-11  33%  237 aa  RADC_VEREI RecName: Full=DNA repair protein radC homolog;
  114::203     7e-11  33%  227 aa  RADC_LACLM RecName: Full=DNA repair protein radC homolog;
  112::193     1e-10  35%  227 aa  RADC_LEGPL RecName: Full=DNA repair protein radC homolog;
  112::193     1e-10  35%  227 aa  RADC_LEGPH RecName: Full=DNA repair protein radC homolog;
  112::193     1e-10  35%  227 aa  RADC_LEGPA RecName: Full=DNA repair protein radC homolog;
  116::209     1e-10  31%  229 aa  RADC_CHLSY RecName: Full=DNA repair protein radC homolog;
  116::209     1e-10  31%  229 aa  RADC_CHLAA RecName: Full=DNA repair protein radC homolog;
  134::209     1e-10  32%  243 aa  RADC_ACAM1 RecName: Full=DNA repair protein radC homolog;
  114::207     2e-10  29%  226 aa  RADC_STRGC RecName: Full=DNA repair protein radC homolog;
  112::193     2e-10  35%  227 aa  RADC_LEGPC RecName: Full=DNA repair protein radC homolog;
  107::200     2e-10  34%  238 aa  RADC_DIAST RecName: Full=DNA repair protein radC homolog;
  111::206     2e-10  30%  224 aa  RADC_CHRVO RecName: Full=DNA repair protein radC homolog;
  118::200     2e-10  31%  233 aa  RADC_ROSCS RecName: Full=DNA repair protein radC homolog;
  112::206     3e-10  32%  223 aa  RADC_THISH RecName: Full=DNA repair protein radC homolog;
  125::201     4e-10  36%  227 aa  RADC_PORGI RecName: Full=DNA repair protein radC homolog;
  126::200     4e-10  39%  238 aa  RADC_ACISJ RecName: Full=DNA repair protein radC homolog;
  111::202     6e-10  29%  226 aa  RADC_PSYWF RecName: Full=DNA repair protein radC homolog;
  113::207     6e-10  29%  225 aa  RADC_BORPD RecName: Full=DNA repair protein radC homolog;
  128::213     6e-10  28%  231 aa  RADC_AQUAE RecName: Full=DNA repair protein radC homolog;
  111::206     7e-10  30%  226 aa  RADC_LARHH RecName: Full=DNA repair protein radC homolog;
  126::209     7e-10  32%  227 aa  RADC_DESHY RecName: Full=DNA repair protein radC homolog;
  126::209     7e-10  32%  227 aa  RADC_DESHD RecName: Full=DNA repair protein radC homolog;
  115::209     9e-10  32%  227 aa  RADC_SERP5 RecName: Full=DNA repair protein radC homolog;
  118::200     9e-10  31%  233 aa  RADC_ROSS1 RecName: Full=DNA repair protein radC homolog;
  120::224     9e-10  27%  271 aa  RADC_ACIAD RecName: Full=DNA repair protein radC homolog;
  111::206     1e-09  29%  227 aa  RADC_PSYCK RecName: Full=DNA repair protein radC homolog;
  116::209     2e-09  29%  229 aa  RADC_CHLAD RecName: Full=DNA repair protein radC homolog;
  111::206     5e-09  28%  227 aa  RADC_PSYA2 RecName: Full=DNA repair protein radC homolog;
  124::207     8e-09  29%  225 aa  RADC_METHJ RecName: Full=DNA repair protein radC homolog;
  112::207     8e-09  30%  226 aa  RADC_DECAR RecName: Full=DNA repair protein radC homolog;
  149::244     4e-08  27%  262 aa  RADC_BURTA RecName: Full=DNA repair protein radC homolog;
  165::260     3e-07  27%  278 aa  RADC_BURP6 RecName: Full=DNA repair protein radC homolog;
  165::260     3e-07  27%  278 aa  RADC_BURP1 RecName: Full=DNA repair protein radC homolog;
  165::260     3e-07  27%  278 aa  RADC_BURP0 RecName: Full=DNA repair protein radC homolog;
  165::260     3e-07  27%  278 aa  RADC_BURMS RecName: Full=DNA repair protein radC homolog;
  165::260     3e-07  27%  278 aa  RADC_BURMA RecName: Full=DNA repair protein radC homolog;
  165::260     3e-07  27%  278 aa  RADC_BURM9 RecName: Full=DNA repair protein radC homolog;
  165::260     3e-07  27%  278 aa  RADC_BURM7 RecName: Full=DNA repair protein radC homolog;
  112::206     4e-07  31%  224 aa  RADC_HALHL RecName: Full=DNA repair protein radC homolog;
  113::207     7e-07  24%  225 aa  RADC_BORBR RecName: Full=DNA repair protein radC homolog;
  113::207     1e-06  23%  225 aa  RADC_BORPA RecName: Full=DNA repair protein radC homolog;
  145::240     1e-06  28%  258 aa  RADC_BURCM RecName: Full=DNA repair protein radC homolog;
  145::240     1e-06  28%  258 aa  RADC_BURA4 RecName: Full=DNA repair protein radC homolog;
    1::122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQKIINKNINASWSSWIDYLKVNMGNMRLEQFRILFLNKKNILIADEVLSQGTIDQAAVYPREIIKRAL
RADC_AGRT5      LKSEIRNKQVLGSWSSVIDYCHAAMAHETREQFRILFLDKRNVLIADEVQGQGTVDHTPVYPREIVRRAL
RADC_RHISN      LKSELRNKQVLSSWSAVIDYCHAAMAHETKEQFRILFLDKRNALIADEVQQQGTIDHTPVYPREVVKRAL
RADC_RHIEC      LKSEIRSKQVLSSWSSVIQYCHAAMAHETREQFRILFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRAL
RADC_RHIE6      LKSEIRSKQVLSSWSSVIQYCHAAMAHETREQFRILFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRAL
RADC_RHIME      LRSELRNKQVLSSWSAVIDYCHAAMAHETKEQFRILFLDKRNTLIADEVQQQGTIDHTPVYPREVVKRAL
RADC_RHILW      LKSELRSKQVLSSWSSVIQYCHAAMAHETREQFRILFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRAL
RADC_SINMW      LKSELRNKQVLSSWSAVIDYCHAAMAHETKEQFRILFLDKRNTLIADEVQQQGTIDHTPVYPREVVKRAL
RADC_RHIL3      LKSELRTKQVLSSWSSVIQYCHAAMAHETREQFRILFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRAL
RADC_PARDP      -RSRVMHRPVLTSWDALLDYCHTAMAHGEIEQFRVLYLDRKNVLIADEEQARGTVDHVPVYPREIMRRAL
RADC_RHOCA      -RSRVLQRPVLSSWQALLDYCHTAMAHRPTEQFRVLFLDRKNLLIADEEQARGTVDHVPVYPREVVKRAL
RADC_OCHA4      -RSTVMEREVLGSWNKVIEYCTAAMAYETREQFRILFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRAL
RADC_BRUSU      -RSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRAL
RADC_BRUME      -RSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRAL
RADC_BRUMB      -RSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRAL
RADC_BRUC2      -RSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRAL
RADC_BRUAB      -RSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRAL
RADC_BRUA2      -RSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRAL
RADC_BRUA1      -RSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRAL
RADC_SILPO      -RARVMQRQVISSWDALLDYCHTTMAHRETEQFRVFYLDRKNVLIADEEQARGTVDHVPVYPREVAKRAL
RADC_RHOP2      -KGQVKSRTVLSSWSAVIDYCRTTMAFADREQFRILFLDKRNQLIADELQQVGTVDHTPVYPREIVKRAL
RADC_CELJU      ------------------DYLRAQLRHHAREVFAVLFLDNQNRLIAYEELFQGTIDGANVYPREVVKQAL
RADC_AZOVD      ------------------DYLKARLRHEPHEVFGCLFLDAKHRVLAFEVLFQGTVDGASVYPRQVLKRAL
YFJY_ECOLI      ------------------DWLKLKMAGLEREEFMMLYLNQQNQLIAHETLFAGSISSTEVHPREVVKRAL
RADC_VIBVY      -------------------YLSSMLRDRHREAFYVLFLDNQNRVIKDEVMFEGTIDAASVYPREVVKRAL
RADC_VIBVU      -------------------YLSSMLRDRHREAFYVLFLDNQNRVIKDEVMFEGTIDAASVYPREVVKRAL
RADC_PSEPG      -------------------YLKAMLRHEVSEVFGCLFLDSKHRPLAFEILFRGTIDRASVYPREVVRRAL
RADC_VIBCM      -------------------YLSSVLRDRQREAFYILFLDNQHRVIRDEILFEGTIDAASVYPREVVKRAL
RADC_VIBCH      -------------------YLSSVLRDRQREAFYILFLDNQHRVIRDEILFEGTIDAASVYPREVVKRAL
RADC_VIBC3      -------------------YLSSVLRDRQREAFYILFLDNQHRVIRDEILFEGTIDAASVYPREVVKRAL
RADC_PSEA7      ------------------DYLKARLRHEQHEVFACLFLDTRHRVLAFEVLFQGSIDGASVYPRQVVKRAL
RADC_PSEU5      ------------------DYLKARLRHEPHELFGCLFLDAKHRVLAFEVLFHGTIDGASVYPRQVVKRAL
RADC_PSEPW      -------------------YLKAMLRHEPSEVFGCLFLDSKHRPLAFEILFRGTIDRASIYPREVVRRSL
RADC_JANMA      -------------------YLQLLLGGKPYEAFAVLFLDVKNRLIACEELFRGTLTHTSVYPREIVKEAL
RADC_PSEFS      MAERLRHDSVLESPKAVRDYLKAMLRHEPHEIFGCLFLDSRHRVLGFEALSQGTIDAAMVYPRQVVKRAL
RADC_PSEPK      -------------------YLKAMLRHEASEVFGCLFLDTKHRPLAFEILFRGTIDRASVYPREVVRRAL
RADC_PSEP1      -------------------YLKAMLRHEASEVFGCLFLDTKHRPLAFEILFRGTIDRASVYPREVVRRAL
RADC_PSEMY      ------------------DYLKAQLRHEPHEVFGCLFLDAKHRVLAFEVLFRGSIDSASVYPRQVVKRAL
RADC_RALSO      LKEEIAYGQTLESPQSVKDFLRLTLGHRPQEVFACLFLDVRHRLIAWEELFQGTLTEARVYPREIAKRAL
RADC_PSEAB      ------------------DYLKARLRHEQHEVFACLFLDTRHRVLAFEVLFQGSIDGASVYPRQVVKRTL
RADC_PSEA8      ------------------DYLKARLRHEQHEVFACLFLDTRHRVLAFEVLFQGSIDGASVYPRQVVKRTL
RADC_PSEE4      -------------------YLKAMLRHEASEVFGCLFLDTKHRPLAFEILFRGTIDRASIYPREVVRRAL
RADC_ALCBS      --------------------LTAQLRGLPFEVFACLFLDNKHRLIAFEKLFQGTIDAAAVYPREVVRRAM
RADC_PSEAE      ------------------DYLKARLRHEQHEVFACLFLDTRHRVLSFEVLFQGSIDGASVYPRQVVKRTL
RADC_ALTMD      -------------------YLQAKLRDCQREKFALLMLDSQHQLIAFRTMFNGTINSAAVYPRELIKQVM
RADC_ACTSZ      -------------------YLQTELEHYEREVFSVLFLDNQHRLIKKEDMFRGTINAASVYPREIIKTAL
RADC_THETN      ----------NFSVTSPEDVINLLMEEMRYEHFKVVMLNVKNKIIAIETISIGSLNTSIVHPREVFKAAI
RADC_RALPJ      ------------------DFLRLTLGHRPHEVFACFFLDVRHRLIAWEELFRGTLTEARVYPREIAKRAL
RADC_PHOPR      -------------------YLSQLLRDRQREVFYVLFLDNQHRVIAGEVLFEGTINSAAVYPREIVKRSL
Y1786_VIBCH     LEQRYVRGETFARTENTTEYLRCKLAGYEHEIFAVLFLDNQHRLIEFKELFRGTVDAASVYPREVLKEAL
RADC_PSEPF      ------------------DYLKVMLRHEPHEVFGCLFLDSKHQVLTFEALFRGSIDNTAVHPREVVKRSL
RADC_PASMU      -------------------YLQATLENKEREIFQVLFLDNQHRLIKQEEMFLGTINCTTIHPREIIKSAL
RADC_VIBFM      -------------------YLTRMLRDRHREAFYVLFLDNQHRVLKGEILFEGTIDAAAVYPREVVKRSI
RADC_PHOLL      ---QFMHEDIMSSPSVTQEYLQNLLSGRDREIFVVLFLNNQNRVICHEEMFKGTINKVEVHPREIVRSAI
RADC_ALISL      -------------------YLTRILRDRHREAFYVLFLDNQHRVLKGEVLFEGTIDAAAVYPREVVKRSI
RADC_VIBF1      -------------------YLTRMLRDRHREAFYVLFLDNQHRVLKGEILFEGTIDVAAVYPREVVKRSI
RADC_VARPS      MAERLKERTVFDSPGTVKQYLQLHIGSRPYEVFAVLFLDAQHRLIVLEELFRGTLTQTSVYPREVVTRAL
RADC_TERTT      ------------------DFLNSQLRHRRSEVFAALFLDSQHRLLSFDILFNGTIDGAAVYPREVVKKCL
RADC_STRMK      -------------------YLQHRLRGQAREVFMALFLDNRHRLIACEELFHGTINAAPVYPREVVRRAL
RADC_RHOFD      LAQQLKERTIFATPDAVKHYLQLHLAAKPHEVFAVLFLDVQNRLLALEELFRGTLTQTSVYPREVVLRAL
RADC_NEIMF      ------------------DYLRFHLGQEKVEVSVALLLNRQNQLIAVRELSRGTVAENTIYIREIVKLAL
RADC_NEIMB      ------------------DYLRFHLGQEKVEVSVALLLNRQNQLIAVRELSRGTVAENTIYIREIVKLAL
RADC_NEIMA      ------------------DYLRFHLGQEKVEVSVALLLNRQNQLIAVRELSRGTVAENTIYIREIVKLAL
RADC_NEIM0      ------------------DYLRFHLGQEKVEVSVALLLNRQNQLIAVRELSRGTVAENTIYIREIVKLAL
RADC_NEIG2      ------------------DYLRFHLGQEKVEVSVALLLNRQNQLIAVRELSRGTVAENTIYIREIVKLAL
RADC_NEIG1      ------------------DYLRFHLGQEKVEVSVALLLNRQNQLIAVRELSRGTVAENTIYIREIVKLAL
RADC_HERAR      -------------------YLQLLLSGRAYESFVILFLDVKNRLIVCDEMFRGTLTHTSVYPREIVKAAL
RADC_HAES2      -------------------YLQTELENKDREIFMVLFLDNQHRLIKKEEMFLGTINQANVYPREIIKTAL
RADC_HAES1      -------------------YLQTELENKDREIFMVLFLDNQHRLIKKEEMFLGTINQANVYPREIIKTAL
RADC_STRM5      -------------------YLQHRLRGQAREIFMALFLDNRHRLIACEELFHGTINAAPVYPREVVRRAL
RADC_RALEJ      -------------------YLRLTLAPLAQEVFVCLFLDTRNRMIASEELFRGTLNQTAVYPREVARRAL
RADC_SYMTH      ------------------EFLAPRMAHLSIEQFHVILLNAKNQVIDVECVSEGTLTASLVHPREVFKTAI
RADC_MARMS      LQEQLMRETVFASAEHVRTYLSSQLRHSPREVFAVLFLDTQHRLIRYQELFMGTIDAAAVYPREVVKAAL
RADC_PSEF5      ------------------DYLKSMLRHEPHEVFGCLFLDTRHRVLTFEVLFQGSIDSTTVYPRQVIKRAL
RADC_ENTS8      ------------------DFLESQLAEQEREVFLVIFLDSQNRIIRQNTLFTGTLSHVEVHPREIVREAV
RADC_XANOR      ------------------------------EVFAVLFLDNRHRAIAFEELFTGTIDGADIHPREVVRRAL
RADC_XANOP      ------------------------------EVFAVLFLDNRHRAIAFEELFTGTIDGADIHPREVVRRAL
YKFG_ECOLI      ------------------EWLRLHMAALEREEFRVLYLDNQNQLIAHETLFTGTINRTEVHPREVVKRAL
RADC_STACT      ------------------DYFLSRMMHLTHEQFEVLFLNSKNVVIRHEVIFVGTLNSSIVHPREVFKAAI
RADC_NITMU      -------------------FLRLSLEGKEHEVFVSIFLDARNRVIATEELFQGTLTQTSVYPREVVKRAL
RADC_NITEC      LAEELKSGDIMDSPQSVRSYLRLSLGGKPHEVFVGIFLDARHRTIMIEELFRGTLTQASVYPREVVKRAL
RADC_PSEHT      ------------------DYLTLQMRGLQQEVFMVLYLDSQNRLIKDEILFYGTINSASVYPREXXXXXX
RADC_FINM2      ------------------------IGSCDVENFYALLLDTKNRIISKELISKGTINQSIVHPREVFKSAI
RADC_XANOM      ------------------------------EVFAVLFLDNRHRAIAFEELFTGTIDGADIHPREVVRRAL
RADC_XANAC      ------------------------------EVFAVLFLDNRHRAIAFEELFTGTIDGADIHPREVVRRAL
RADC_FUSNN      ---KISNKDI------LLKYLRNKIGYEEIEKFYVIYLSSSNEVIEFEENSVGTLDRSSVYPREIYKKVI
RADC_HAEIE      -------------------FLLTELQHEEREVFMVLFLDNQHRLIKKERLFLGTINVSAVYPREIIKEAL
RADC_HAEI8      LKQEMLSTPIINDLETVKLFLLTELQHEEREVFMVLFLDNQHRLIKKERLFLGTINVSAVYPREIIKEAL
RADC_METBF      ------------------------MREQKKEKFITLCLDTKNQILKEEVVSIGSLNASIVHPREVFKSAL
RADC_CUPTR      -------------------YLRLTLAPLQHEVFMCLFLDPGNRMVASEELFRGTLTRTSVYPREVARQAL
RADC_AZOSB      ------------------DWLRLRLGHLPHETFCVLLLDARNTLIDAVDLFRGTLTQTSVYPREVVKLAL
RADC_SALAR      -----------------LEFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLSHVEVHPREIVREAI
RADC_METMA      ------------------------MREQKKEKFITLYLDTKNQILKEEVVSIGSLNASIVHPREVFKSAL
RADC_METAC      ------------------------MREQKKEKFITLYLDTKNQILKEEVVSIGSLNASIVHPREVFKSAL
RADC_DESAP      ------------------------------EHFWALVLNTKNRVLAVEKVSVGTLNSSSVHPRELFKNAI
RADC_BURPP      ------------------NYLRLRIGGRPLEVFVSLFLDARHRLIHCEESAQGTLTRMAVYPREIVRRAL
Y510_VIBCH      ------------------EYVRCKLGSYEREVFALLLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVL
RADC_XANC5      ------------------------------EVFAALFLDNRHRAIAFEELFTGTIDGADIHPREVVRRAL
RADC_SHIFL      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_SHIF8      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_SHIBS      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_SHIB3      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_NITEU      LAEELKNGDIMDSPQSVRNYLCLSLKGKPYEVFVGIFLDARHRTIVTEELFNGTLTQASVYPREVVKRAL
RADC_METBU      ---------------------------LKKEHLTALYLDTKNNIIKEEVISIGSLNANIVHPREVFKSAL
RADC_MARAV      -------------------FLTSRLGTYPHEVFAGLFLDNRHRVIQYRELFRGTIDGAAVYPREVVRQAL
RADC_ESCF3      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECOUT      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECOSM      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECOLU      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECOLI      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHRRLFSGTLNHVEVHPREIIREAI
RADC_ECOL6      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECOL5      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECOK1      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECOHS      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECODH      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHRRLFSGTLNHVEVHPREIIREAI
RADC_ECOBW      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHRRLFSGTLNHVEVHPREIIREAI
RADC_ECO8A      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECO81      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECO7I      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECO5E      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECO57      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECO55      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECO45      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECO27      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_ECO24      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAI
RADC_PSE14      ------------------NYLKAQLRHEQHEVFACLFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAM
RADC_ACTPJ      -QQMQVRENINEPYLAVMCF-QAELESEEREVFMVMFLDNQNRLIKKEKMFYGTINQATVYPREIIKEAL
RADC_ACTP7      -QQMQVRENINEPYLAVMCF-QAELESEEREVFMVMFLDNQNRLIKKEKMFYGTINQATVYPREIIKEAL
RADC_ACTP2      -QQMQVRENINEPYLAVMCF-QAELESEEREVFMVMFLDNQNRLIKKEKMFYGTINQATVYPREIIKEAL
RADC_SHIDS      ------------------EFLQSQLTGEEREIFMVIFLDSQHRVITHSRIFSGTLNHVEVHPREIIREAI
RADC_RALEH      ------------------NYLRLTLAPLPHEVFLCLFLDPRNRMVASEEMFRGTLTRTAVYPREVARQAL
RADC_PSESM      ------------------NYLKAQLRHEPHEVFACLFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAL
RADC_XANCP      -------------------YFSQRLRARNYEVFAALFLDSRHRAIAFEELFTGTIDAAEIHPREVVRRAL
RADC_XANC8      -------------------YFSQRLRARNYEVFAALFLDSRHRAIAFEELFTGTIDAAEIHPREVVRRAL
RADC_KLEP3      ---QLVEEAALVSPSTTREFLQSQLTEEEREIFMVIFLDNQNRVLKHSRLFSGTLSHVEVHPREIVREAI
RADC_HAEIN      -------------------FLLTELQHEEREVFMVLFLDNQHRLIKKERLFLGTIYVSAVYPREIIKEAL
RADC_COXBN      ------------------------------EVFACLFLDNRHRIIQFEKLFYGSINQASVHPREIIKRAL
RADC_COXB1      ------------------------------EVFACLFLDNRHRIIQFEKLFYGSINQASVHPREIIKRAL
RADC_CITK8      -KARMMKENALLSPEMTREFLQSQLTGEEREIFLVIFLDARHRVIKHSRLFSGTLNHVEVHPREIIREAI
RADC_DESRM      ------------------------------EHFLALLLNTKNQVLARETISIGTLNSSVVHPRELFKVAI
RADC_BACC4      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAF
RADC_BACC2      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVLHRQTIFIGSLNTSIVHPREVFKEAF
RADC_METFK      -------------------YLSLRIGALPREVFIGIFLDAQHRVLAVEELFSGTLTQTSVYPREVVKCAL
RADC_KLEP7      ------------------EFLQSQLTEEEREIFMVIFLDNQNRVLKHSRLFSGTLSHVEVHPREIVREAI
RADC_ENT38      ------------------DFLQSQLSDAEREVFMVIFLDNQHRVVKHSRMFSGTLRHVEVHPREIVREAI
RADC_BURXL      ------------------NYLRLRIGGRPQEIFVSLFLDARHRLIRCEESAQGTLTRMAVYPREIVRRAL
RADC_BACHK      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAF
RADC_BACCZ      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAF
RADC_BACCQ      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAF
RADC_BACC7      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAF
RADC_BACC3      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAF
RADC_BACC1      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAF
RADC_BACAN      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAF
RADC_BACAC      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAF
RADC_BACAA      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAF
RADC_SYNWW      ------------------------------EHFRVLYLDRKGGLITMQDISIGGLHSSIVHPREVFKTAV
RADC_SACD2      -------------------FVSAQLRHRQSEVFALILLNTQNQLIKFVELFNGTIDSASVYPREVVKTAL
RADC_BACWK      -------------------YMMEEMRFLQQEHFVCLYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAF
RADC_YERE8      -------------------FLQNILSHREREIFLVMFLDNQHRVIRHEEMFTGTISSVEIHPREIVREAL
RADC_IDILO      ------------------DYLTSQLRHQGREVFAILLLDSQHRLLRYEELFQGTINAAPVYPREVIKLVM
RADC_ALKOO      --------------------LMEEMRYLNKEIFNILLLTTKHDIIAIENISVGSLNASIVHPREVFNRAI
RADC_PELPD      ------------------DYFHYELRDCRREYFLVLLLDGKNRIIRRVQVSEGSLNQSIVHPREVFCQAV
RADC_LEPCP      ------------------DYLRLQLGRLDHEVFAVLFLDAQHRLIAYEPLFRGTLTQTSVYPREVLKRXX
RADC_HAEDU      -----------------IMYFQTELEFEEREVFMVLFLDNQNRLIKKEKMFYGTINQATVHPREIIKEAL
RADC_STAHJ      ------------------------MKDLTQEHFVVLLLNSKNIVIKEETIYKGTLNSSVIHPREVFKAAI
RADC_SHEPW      ------------------DYLMRQLGDRAYEVFAILLLDSQHRVIQFVELFRGTINSASVYPRDVVGLVL
RADC_SHEB8      ------------------DYLMRQLADRSYEVFAVLLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_PSEU2      -------------------YLKALLRHEPHEVFGCLFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAM
RADC_CHRSD      -------------------FLTSQLRHLPHEAFAALFLDTQHRVIRFETLSKGTLDSASVYPREVSRRAL
RADC_SHEPA      ------------------DYLMRQLSDRAYEVFAILLLDSQHRVIQFVELFRGTINSASVYPREVVSLVL
RADC_SHEHH      ------------------DYLMRQLSDRAYEVFAILLLDSQHRVIQFVELFRGTINSASVYPREVVSLVL
RADC_SHEAM      ------------------DYLRFQLADRAYEVFAVLLLDSQHRVIQFVELFRGTIDAASVYPRELVSLVL
RADC_AERHH      ------------------DYLQAQLRDRPREVFALLLLDNQHRVIQFVELFYGTLDSASVWPREIVQIAL
RADC_YERPY      -------------------FLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
RADC_YERPS      -------------------FLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
RADC_YERPP      -------------------FLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
RADC_YERPN      -------------------FLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
RADC_YERPG      -------------------FLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
RADC_YERPE      -------------------FLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
RADC_YERPB      -------------------FLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
RADC_YERPA      -------------------FLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
RADC_YERP3      -------------------FLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
RADC_STRA5      --------------------MMLELGDKKQEHLVAIYMDTQNRIIEQRTIFIGTVRRSVAEPREILHYAC
RADC_STRA1      --------------------MMLELGDKKQEHLVAIYMDTQNRIIEQRTIFIGTVRRSVAEPREILHYAC
RADC_SHESR      ------------------DYLMRQLADRSYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SHESM      ------------------DYLMRQLADRSYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SHESA      ------------------DYLMRQLADRSYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SHEON      ------------------DYLMRQLADRSYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_BACLD      ------------------------MGDMRFEHFVCVYLNTKNQVIHKRTVFIGSLNSSIVHPREVFKEAL
YEES_ECOLI      ------------------EWLILNMAGLEREEFRVLYLNNQNQLIAGETLFTGTINRTEVHPREVIKRXX
RADC_STRA3      --------------------MMLELGDKKQEHLVAIYMDTQNRIIEQRTIFIGTVRRSVAEPREILHYAC
RADC_SHEFN      ------------------DYLMRQLADRSYEVFALLLLDTQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SHEB9      ------------------DYLMRQLADRSYEVFAVLLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SHEB5      ------------------DYLMRQLADRSYEVFAVLLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SHEB2      ------------------DYLMRQLADRSYEVFAVLLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SALTY      ------------------EFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_SALTI      ------------------EFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_SALSV      ------------------EFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_SALPC      ------------------EFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_SALHS      ------------------EFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_SALG2      ------------------EFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_SALEP      ------------------EFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_SALDC      ------------------EFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_SALCH      ------------------EFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_SALA4      ------------------EFLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_PSEA6      ------------------------------EVFGMLLLDSQHQLIKFRKMFFGTIDSASVYPRVLVKQAL
RADC_PELPB      -----LNKKIQAARDVF-EYMAGRVPDETKEHLFVLHLNTKNQIIKTELVSVGTLNAALIHPREVFKSAI
RADC_ALKMQ      --------------------LMEEMRYLKKEYFNIALLNTKHEVIAIENISIGSLNASIVHPREVFVVAI
RADC_TOLAT      -------------------YLQAQLRDRPREVFAMLLLDNQHRVLRFCELFFGTIDAASVYPREIVQTVL
RADC_SHESW      ------------------DYLMRQLTDRSYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SHEPC      ------------------DYLMRQLTDRSYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SHELP      ------------------DYLMRQLADRAYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SHEDO      ------------------DYLMRQLADRSYEVFALLLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVL
RADC_SALPK      ------------------EFLQSQLTGEEREIFLVIFLDVQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_SALPA      ------------------EFLQSQLTGEEREIFLVIFLDVQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_CLOBA      ------------------------MSLLKQEILKVIFLNTKNIVIGTKDVFKGSLNTSIVHPREIFKEAV
RADC_BURVG      ------------------DYLRLRIGMRPYEVFVTLYLDARHGLIEVEESARGSLTRMAVYPREIVRRAL
RADC_STRPZ      ------------------------LGDKKQEHLVVLYLDNQNRIIEEKTIFIGTVRRSLAEPREILYYAC
RADC_STRPG      ------------------------LGDKKQEHLVVLYLDNQNRIIEEKTIFIGTVRRSLAEPREILYYAC
RADC_STRPF      ------------------------LGDKKQEHLVVLYLDNQNRIIEEKTIFIGTVRRSLAEPREILYYAC
RADC_STRPD      ------------------------LGDKKQEHLVVLYLDNQNRIIEEKTIFIGTVRRSLAEPREILYYAC
RADC_STRPC      ------------------------LGDKKQEHLVVLYLDNQNRIIEEKTIFIGTVRRSLAEPREILYYAC
RADC_STRPB      ------------------------LGDKKQEHLVVLYLDNQNRIIEEKTIFIGTVRRSLAEPREILYYAC
RADC_STRP8      ------------------------LGDKKQEHLVVLYLDNQNRIIEEKTIFIGTVRRSLAEPREILYYAC
RADC_STRP6      ------------------------LGDKKQEHLVVLYLDNQNRIIEEKTIFIGTVRRSLAEPREILYYAC
RADC_STRP1      ------------------------LGDKKQEHLVVLYLDNQNRIIEEKTIFIGTVRRSLAEPREILYYAC
RADC_STRE4      --------------------MMIELGDKQQEHLVAIYLDSQNKIIEEKTIFIGTVRKSIAEPREILYYAC
RADC_DELAS      MAEQLRERPALASPEAVARYLQLHLAARQHEVFAVLFLDGQHRLIALEEMFRGTLTRTSVYPREVVLRAL
RADC_CLOD6      IKYKIMNPDIQRYYMDSLRYLKK-------EVFKAVLLNTKNEIISDVDVSIGTLSSSLVHPREVFKEAI
RADC_CLOBB      ------------------------MSLLKQEILKVIFLNTKNIVIGTKDVFKGSLNTSIVHPREIFKEAV
RADC_CARHZ      ------------------NYLRYKIGHKKQEQVVVLYLNTKNQLCGENIVAIGGVNHAGVSPGDIFREAV
RADC_SALNS      ------------------EFLQSQLTCEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAI
RADC_CLOB8      ---KAINNDIKTSPKDLASLLMGEMNELNQEVLKVVLLNTKNIVVGIKDVFKGSLNTSVVHPREIFKQAI
RADC_CHLP8      ---KNINRKIQGAQDVF-EYMQGRIPDESKEHLFVLFLNTKNRILSHESVTVGTLTSSLIHPREIFKAAI
RADC_BURS3      LKEKAHEKQPIDSPGAVEDYLRLKIGARPYEVFAAVYLDARHRLIDMEEITRGSLTRMAVYPREIVRRAM
RADC_STRSV      --------------------MQQELGDMRQECLVAIYLNSQNQILHQQTIFMGTVSRSIAEPREILHYAL
RADC_RUBXD      --------------------LRGRIANLDREHFVVVLLNTKNEVIEAPTISVGTLSSSLVHPREVFKPAI
RADC_GEOSW      -------------------YVMEDMRFLSQEHFVAIYLNTKNQVIHRKTIFIGSLNASIVHPREVFKEAI
RADC_CHLCH      ------------------EYMSGRIPDESKEHLFVLHLNTKNQVIKNELISIGTLNTAVIHPREIFKSAI
RADC_ACIF5      -------------------YLSATLRDRCREVFAVIFLDNRHRVLRFEEMFLGTIDGATVHIREVLKRAL
RADC_ACIF2      -------------------YLSATLRDRCREVFAVIFLDNRHRVLRFEEMFLGTIDGATVHIREVLKRAL
RADC_STRPM      ------------------------LGDKKQEHLVVLYLDNQNRIFEEKTIFIGTVRRSLAEPREILYYAC
RADC_STRP3      ------------------------LGDKKQEHLVVLYLDNQNRIFEEKTIFIGTVRRSLAEPREILYYAC
RADC_PARUW      -RQQIKSRYLIEHSSHAYQLVKDELENENREIFMAIFQDTKGYLITYEVISIGSLSQTLVHPREVFYSAI
RADC_STAS1      ------------------DFMMGKMEHLTQEKFIALFLNSKNIIIKQKTIFMGTLNSAIVHPREIYSEAV
RADC_GEOTN      -------------------YVMEDMRFLSQEHFVAIYLNTKNQVIHRKTVFIGSLNASIVHPREVFKEAI
RADC_GEOKA      -------------------YVMEDMRFLSQEHFVAIYLNTKNQVIYRKTVFIGSLNASIVHPREVFKEAI
RADC_STRS7      --------------------MMIELGDKQQEHLVAIYLDSQNKIIEEKTIFIGTVRKSIAEPREILYYAC
RADC_STREM      --------------------MMIELGDKQQEHLVAIYLDSQNKIIEEKTIFIGTVRKSIAEPREILYYAC
RADC_SHESH      ------------------DYLMRQLADRAYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPRDVVCLVL
RADC_GEOUR      ----------------------------RKEYFLTLLLDGKNRILKRVQISEGSLNQSIVHPREVFNQAV
RADC_BURCH      ------------------DCLRLKIGTRQYEVFIAVYLDARNRLIDMEEIARGSLTRMAVYPREIVRRAM
RADC_BURCC      ------------------DCLRLKIGTRQYEVFIAVYLDARNRLIDMEEIARGSLTRMAVYPREIVRRAM
RADC_BURCA      ------------------DCLRLKIGTRQYEVFIAVYLDARNRLIDMEEIARGSLTRMAVYPREIVRRAM
RADC_BACHD      ------------------------------ENFVCLYLNTKNQVLHKQTVFIGSLNASIVHPREVFKEAL
RADC_BACA2      -------------------YVMEDMRFLSQEHFVCLYLNTKNQVIHKRTVFIGSLNSSIVHPREVFKEAF
RADC_AERS4      ------------------DYLQAQLR----EVFALLLLDNQHRVIQFVELFYGTLDSASVWPREIVQIAL
RADC_STAAB      ------------------DYMIPTMKDLTQEHFVILLLNSKNVVIKESCVFKGTLNSSIVHPREIFSIAV
RADC_SHEWM      ------------------DYLMRQLRDRAYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPRDVVSLVL
RADC_VIBSL      -------------------YLSSILRDRQREAFYILFLDNQNRVIKDEVMFEGTIDAASVYPREVVKRXX
RADC_STAAW      ------------------DYMIPTMKDLTQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAV
RADC_STAAS      ------------------DYMIPTMKDLTQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAV
RADC_STAAE      ------------------DYMIPTMKDLTQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAV
RADC_STAAC      ------------------DYMIPTMKDLTQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAV
RADC_STAA8      ------------------DYMIPTMKDLTQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAV
RADC_STAA3      ------------------DYMIPTMKDLTQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAV
RADC_POLNA      ------------------DYLQLQLGSRPHEIFAVLFLDSQHRLIALEELFRGTLTQTSVYPREVVIRXX
RADC_PROVI      ------------------EYMQGRVPDETKEHLFVLHLNTKNQITKCEEVTIGTLNASLIHPREVFKAAI
RADC_BACSK      -----------------------DMRGLQQEHFVALYLNTKNHVIKQKTLFIGSLNASIVHPREVFKEAL
RADC_BACP2      ------------------NFVMEDMRFLTQENFVCLYLNTKNQVLHKHTVFIGSLNSSIVHPREIFKEAF
RADC_STRS2      ------------------------IGHKKQEHLVALYLNTQNQIISQKTIFIGSVNRSIAEPREILHYAV
RADC_METPP      ------------------DYLQLQLASKPHEVFAVLFLDTQHRLLAFEELFRGTLNQASVYPREVVKRXX
RADC_GEOSL      ----------------------------RKEYFMALLLDGKNRIMREIQVSEGSLNQSIVHPREVFNPAV
RADC_COPPD      -------------------YFSSMLMNEGKEHFWILLLDRKNRPIKHVEISVGSSIQTTVDPKEILKQVS
RADC_CHLTE      ------------------EYMKGRIPDETKEHLFVLFLSTKNQILRHETITIGTLTASLIHPREIFKAAI
RADC_VIBPA      -------------------YLSSILRDRQREAFYILFLDNQHRVIKDEILFEGTLDAASVYPREVVKRXX
RADC_THEEB      ------------------------------ERFAVLLLDVRHRLLGSHVITVGTATETLAHPREIFREAV
RADC_MOOTA      ------------------------------ENFRTVSLNTKNQVLGIDNVSVGSLNSSLAHPREVFKDPI
RADC_CLOAB      ------------------------------EHLYVIMLNTKNIVIKISDVSVGSLNSSIVHPREVYVEPI
RADC_BACSU      ------------------------------EHFVCLYLNTKNQVIHKRTVFIGSLNSSIVHPREVFKEAF
RADC_VIBHB      -------------------YLSSILRDRQREAFYILFLDNQHRVIKDEILFEGTLDAASVYPREVVKRXX
RADC_CLONN      ------------------------------EHLRVIMLNTKNIVISCKDVSIGSLNSAIVHPREVFCEAL
RADC_SYNY3      ------------------------------EHFAIVMLDVKNRLLATKVITIGTATETLIHPREIFREVI
RADC_PSYIN      -------------------FLIAKMHNLPYEVFAAILLDTQHRIIRFHEFFFGSIDCATVHPRIIAQKVL
RADC_CHLPB      ------------------DYMYGRVPDESKEHLFVLHLNTKNQIISHHLISVGTLNASLIHPREIYKSAI
RADC_ACIAC      ------------------DYLQLHLGGKPHEVFSVLFLDSQNGLIAMEEMFRGTLSQASVYPREXXXXXX
RADC_PROA2      ------NKKIRSARDVF-DYMQGRLPDEMREHLFLLNLNTKNQIIRHEIISVGTLNASLIHPREIFKEAI
RADC_XYLFT      ------------------------------EVFAVLFLDNRHRAISFEELFHGTINGAEVHPREVVRRAL
RADC_XYLFA      ------------------------------EVFAVLFLDNRHRAISFEELFHGTINGAEVHPREVVRRAL
RADC_THIDA      ------------------DYLRLILRDKEYEVFCCVFLNAQNRVIAVEELFRGTLTQTSVYPREIVKRXX
RADC_SYNP2      ------------------------------ERFAVLCLDVKNTLIATRVVTIGLATETLAHPREIFREVI
RADC_LISMO      ------------------------------EHFHCLFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLAL
RADC_LISMH      ------------------------------EHFHCLFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLAL
RADC_LISMF      ------------------------------EHFHCLFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLAL
RADC_LISMC      ------------------------------EHFHCLFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLAL
RADC_CYAP7      ------------------------------ERFAIVLLNVKNQIIGTKLISIGTATETLVHPREIFREVL
RADC_THICR      --------------------LQHHIGHQSREIFGLVLLDQQNQFIQFVPLFTGTINQATVHIREVLKTVL
RADC_CLOTE      ---------------------------LKQEYLKVILLNTKNYVIKVKDVFIGSLNSSIVHPREIFLEAI
RADC_CLOK5      ------------------------MRGMKQEHLKVILLNTKNMVIGIKNVFIGTLNSSIVHPREIFFYAI
RADC_CLOK1      ------------------------MRGMKQEHLKVILLNTKNMVIGIKNVFIGTLNSSIVHPREIFFYAI
RADC_STAES      ------------------------MKDLEQEHFVVLLLNSKNIVTKQAWVYKGTLNSSIIHPREVFNIAI
RADC_GEOLS      ------------------DFFHHELRDNRKELFLTLLLDGKNRITRKVQVSEGSLNQSIVHPREVFAPAV
RADC_CLOBM      -----------------------DMKYLKQEKLKILILNTKNIVTYIRDVFIGTLNSSIVHPREIFCEAI
RADC_CLOBK      -----------------------DMKYLKQEKLKILILNTKNIVTYIRDVFIGTLNSSIVHPREIFCEAI
RADC_CLOBJ      -----------------------DMKYLKQEKLKILILNTKNIVTYIRDVFIGTLNSSIVHPREIFCEAI
RADC_CLOBH      -----------------------DMKYLKQEKLKILILNTKNIVTYIRDVFIGTLNSSIVHPREIFCEAI
RADC_CLOB6      -----------------------DMKYLKQEKLKILILNTKNIVTYIRDVFIGTLNSSIVHPREIFCEAI
RADC_CLOB1      -----------------------DMKYLKQEKLKILILNTKNIVTYIRDVFIGTLNSSIVHPREIFCEAI
RADC_CHLPD      ------------------EYMAGRVPDITKEHLFVLHLNTKNQIIRNEQVTVGTLNASLAHPREVFKSAI
RADC_CLOBL      -----------------------DMKYLKQEKLKILILNTKNIVKYIRDVFIGTLNSSIVHPREIFCEAI
RADC_LISIN      ------------------------------EHFHCIFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLAL
RADC_ENTFA      ------------------------MKGLQQEHLICIYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAV
RADC_CLOPS      ---------------------------LRQEVLILINLDTKNKVISKKEIFKGGLNSSLVHPREIFKEAV
RADC_ERWCT      -------------------YLQLLLSRREREVFLVLFLDNQHHVIRHQEMFVGTINSVEVHPREIVREXX
RADC_PECCP      -------------------YLQLLLSRREREVFLVLFLDNQHHVIRHQEMFVGTINSVEVHPREIVREXX
RADC_POLSJ      ------------------DYLQLQLGGRPHEIFAVLFLDSQHRLIALEELFRGTLTQTSVYPREXXXXXX
RADC_CLOPE      ---------------------------LRQEVLILINLDTKNKVISKKEIFKGGLNSSLVHPREIFREAV
RADC_CLOP1      ---------------------------LRQEVLILINLDTKNKVISKKEIFKGGLNSSLVHPREIFREAV
RADC_STRU0      ------------------------LGDKKQEHLIAIYLDTQNRIIEEKTIFIGSVRRSIAEPREILHFAC
RADC_MICAN      ------------------------------ERFAVILLDVKNQLIALKVITIGTATETLVHPREIFREVV
RADC_FLAJ1      ------------------------IGELPHEEFWVLFLNNSNKVISKAQLSKGGIAGTIVDVRLVFKLGL
RADC_CYAA5      ----------------------------RREHFAAVFLDSKYRLLGTKVITIGTATETLVDPAEIFRETL
RADC_SALRD      ------------------------------EVFKVVHLNTANVIIGDYTXXXXXXXXXXXXPRGVFEQAI
RADC_PELLD      ------------------EYMSGRIPDETQEHLFVLHLNTKNQVTKCVRVTVGTLNASLIHPREVFKSAI
RADC_PELCD      ------------------------------ERFIALLLDSKNRLLREVGISEGSLTASIVHPRDVFAPVV
RADC_NOSP7      ------------------------------ERFAVVLLDVKNRLLGTQVITIGTATETLASPRDIFREVI
RADC_BORPE      -------------------YCQAALGHRKVEHCIALYLDARLKLIICAEVARGTLTQAQIYPREIVREAL
RADC_TRIEI      ------------------------------EKFAVLLLDVKNRLLGTQVITIGTATETLAHPREIFGEVI
RADC_LISW6      ------------------------------EHFHCIFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLAL
RADC_LACSS      ------------------------------EQLLAVYLDVKNQIIQIKQLYLGTLNSSVAHPREVFKWAV
RADC_LACLA      --------------------LAFEMQNFEQEHLVATYLDGQNRIIEKKTIFIGAVNQATASPREILYHAI
RADC_STRZT      --------------------MQQELGDKKQEHLVALYLXXXXXXXXXXXXXXGSVTRSIAEPREILHYAI
RADC_STRZP      --------------------MQQELGDKKQEHLVALYLXXXXXXXXXXXXXXGSVTRSIAEPREILHYAI
RADC_STRZJ      --------------------MQQELGDKKQEHLVALYLXXXXXXXXXXXXXXGSVTRSIAEPREILHYAI
RADC_STRPN      --------------------MQQELGDKKQEHLVALYLXXXXXXXXXXXXXXGSVTRSIAEPREILHYAI
RADC_STRPJ      --------------------MQQELGDKKQEHLVALYLXXXXXXXXXXXXXXGSVTRSIAEPREILHYAI
RADC_STRPI      --------------------MQQELGDKKQEHLVALYLXXXXXXXXXXXXXXGSVTRSIAEPREILHYAI
RADC_STRP7      --------------------MQQELGDKKQEHLVALYLXXXXXXXXXXXXXXGSVTRSIAEPREILHYAI
RADC_STRP4      --------------------MQQELGDKKQEHLVALYLXXXXXXXXXXXXXXGSVTRSIAEPREILHYAI
RADC_AZOSE      ------------------NWLRLRIGSLPHEVFHVLLLDARNRLIEAVELFRGTLTQTSVYPREXXXXXX
RADC_STRR6      --------------------MQQELGDKKQEHLVALYLXXXXXXXXXXXXXXGSVTRSIAEPREILHYAI
RADC_STRP2      --------------------MQQELGDKKQEHLVALYLXXXXXXXXXXXXXXGSVTRSIAEPREILHYAI
RADC_ACIBT      -----------------LDYLRYELKGEKQEVFAVLCLDAELRKLHFKKLFFGSVQHCAVSVNQTLRYAL
RADC_ACIB5      -----------------LDYLRYELKGEKQEVFAVLCLDAELRKLHFKKLFFGSVQHCAVSVNQTLRYAL
RADC_ACIB3      -----------------LDYLRYELKGEKQEVFAVLCLDAELRKLHFKKLFFGSVQHCAVSVNQTLRYAL
RADC_STRTD      --------------------MMLDIGDKPQEHLVAIYLDTQNRIIQQKTVFIGGVRRSIAEPREILHYAC
RADC_STRT2      --------------------MMLDIGDKPQEHLVAIYLDTQNRIIQQKTVFIGGVRRSIAEPREILYYAC
RADC_STRT1      --------------------MMLDIGDKPQEHLVAIYLDTQNRIIQQKTVFIGGVRRSIAEPREILYYAC
RADC_BORA1      -------------------------------------------------LERGTLGRASVFPREVVREAL
RADC_THEP1      ------------------------------EIVKVICLDTKLNVIGENTLTVGTSDRSLIHPRDVFRTAI
RADC_THEMA      ------------------------------EIVKVICLDTKLNVIGENTLTVGTSDRSLIHPRDVFRTAI
RADC_ANAVT      ------------------------------ERFAVLLLDVKNRLLGTQVITIGTATETLASPREIFREII
RADC_ANASP      ------------------------------ERFAVLLLDVKNRLLGTQVITIGTATETLASPREIFREII
RADC_ALHEH      -------------------YLTARLRHQSREIFACLFLDNRHRVVRYEELFQGTIDAASVYPREVVQRXX
RADC_CYAP4      ------------------------------EKFAVLLLDVRHRLIGTQVITIGTATETIAHPRDIFREVI
RADC_NITOC      -------------------YLVARLRAYPFEVFSCLFLDNRHRVLAFEELFRGTIDGASVHPREVLKRXX
RADC_HAHCH      ------------------EYLSAHLRHYPYEVFAALFLDNQHRVIAYEELFRGTIDSASVHPREVVRRVL
RADC_VEREI      -------------------YLQLQLAAKGHEVFAVLFLDNQNRLLAMEELFRGTLTQTSVYPREXXXXXX
RADC_LACLM      --------------------LAFEMQNFEQEHLTATYLDGQNQIIEKKTIFIGAFNHATASPREILYHAV
RADC_LEGPL      -------------------FLKKRLRDYKNETFAALFLDNQHRIIAYEELFSGTINTATVYPRPIVERVX
RADC_LEGPH      -------------------FLKKRLRDYKNETFAALFLDNQHRIIAYEELFSGTINTATVYPRPIVERVX
RADC_LEGPA      -------------------FLKKRLRDYKNETFAALFLDNQHRIIAYEELFSGTINTATVYPRPIVERVX
RADC_CHLSY      --------------------LLVEMSHLDQEHLRTILLDTKNRVQQITTVYIGSLNSANVRVGEVFKEAV
RADC_CHLAA      --------------------LLVEMSHLDQEHLRTILLDTKNRVQQITTVYIGSLNSANVRVGEVFKEAV
RADC_ACAM1      ------------------------------ERFAVLLLDVKHRLLGTQVVSIGTATETLAHPRDIFREII
RADC_STRGC      --------------------MQQELSHKKQEHLVALYLXXXXXXXXXXXXXXGSLTRSLAEPREILHYAI
RADC_LEGPC      -------------------FLKKRLRDYKNETFAALFLDSQHRIIAYEELFSGTINTATVYPRPIVERVX
RADC_DIAST      MAQQLREREVFDSPQAVQHYLQLHLAGRTHEVFAVLFLDSGNRLIAMEELFRGTLTQTSVYPREXXXXXX
RADC_CHRVO      ------------------DYLRLSIGRREVETFVVIFLSAQNRLIEVEEVFKGTLTETRVYPREVXXXXX
RADC_ROSCS      --------------------MQIEMSHLDQEQLRAICLDTKNRVQKIQTVYVGSLNASMVRIGEVFKEAI
RADC_THISH      -------------------FLAARLRDYPFEVFACLFLDNRHRVIAFEELFRGTIDGASVHPREVVRRXX
RADC_PORGI      ------------------------------EEMWVLLLNQSGKIISMENLSRGGVSETSADVRLIMHKAV
RADC_ACISJ      -------------------YLQLHLAGRTHEVFAVLFLDSGNRLIAMEELFRGTLTQTSVYPREXXXXXX
RADC_PSYWF      ------------------DYITTQIRRESKEVFAVLCLDNGLNLLDYKVLFVGGLSSCSVCVKQVLRHAL
RADC_BORPD      -------------------YFKTALANCAVEHCLALYLDSQLNLITSGELARGTLARASVYPREVVREXX
RADC_AQUAE      ----------------------------RRESLIALYLDLSNRLLDWEVVAIGNVNTVFSKPKDILFKAV
RADC_LARHH      ------------------DYLRLAYGMRVQEVVXXXXXXXXXXXXXVEEVAHGTLTESRVYPREVVKAAL
RADC_DESHY      ------------------------------EHFRVVSLSTKNHXXXXXXXXXXXXXXXXXHPRECFKEAI
RADC_DESHD      ------------------------------EHFRVVSLSTKNHXXXXXXXXXXXXXXXXXHPRECFKEAI
RADC_SERP5      -------------------YLQSLLVHHEREVFLVLFLDNQHRVIRHQEMFAGTISSVVVYPREIVREXX
RADC_ROSS1      --------------------MQIEMSHLDQEQLRAICLDTKNRVQKIQTVYIGSLHTSMVRIGEIFKEPI
RADC_ACIAD      --------NLNSS-RLVLDYLRYELLGEKQEVFAVLCLDSELRKLNFKKLFYGSLNACNISINHTLRYAL
RADC_PSYCK      ------------------DYISTQLRGEPREVFAVLCLDNALNLINFEILFTGGISSCSVCIKHVLRHAL
RADC_CHLAD      --------------------LMVEMSHLDQEHLRTVLLDTKHRVQQINTVYIGSLNSATIRIGEVFKEAV
RADC_PSYA2      ------------------DYISTHLRGEPREVFAVLCLDNALNLINFEILFTGGISSCSVCIKHVLRHAL
RADC_METHJ      ------------------------------EHFLVTTLNGASEVICTRTITMGLLNHSLVHPREVFXXXX
RADC_DECAR      ------------------DWLRLKLASRGHEVFMALWLDAQNQLLKAEELFTGTLTQTSVYPREXXXXXX
RADC_BURTA      ------------------DYLRLLIGTRPREVFVCLFLDARHRLVQTEETAHGSLTRMAVYPREXXXXXX
RADC_BURP6      ------------------DYLRLLIGTRPREVFVCLFLDARHRLVQTEETAHGSLTRMAVYPREXXXXXX
RADC_BURP1      ------------------DYLRLLIGTRPREVFVCLFLDARHRLVQTEETAHGSLTRMAVYPREXXXXXX
RADC_BURP0      ------------------DYLRLLIGTRPREVFVCLFLDARHRLVQTEETAHGSLTRMAVYPREXXXXXX
RADC_BURMS      ------------------DYLRLLIGTRPREVFVCLFLDARHRLVQTEETAHGSLTRMAVYPREXXXXXX
RADC_BURMA      ------------------DYLRLLIGTRPREVFVCLFLDARHRLVQTEETAHGSLTRMAVYPREXXXXXX
RADC_BURM9      ------------------DYLRLLIGTRPREVFVCLFLDARHRLVQTEETAHGSLTRMAVYPREXXXXXX
RADC_BURM7      ------------------DYLRLLIGTRPREVFVCLFLDARHRLVQTEETAHGSLTRMAVYPREXXXXXX
RADC_HALHL      -------------------YLAALLRDHPSEVFGGLFLDNRHRVIGFEELFRGTINGASVYPREXXXXXX
RADC_BORBR      -------------------YCQAALGHRKVEHCIALYLDARLKLIICAEVARGTLTQAQIYPREIVREXX
RADC_BORPA      -------------------YCQAALGHRKVEHCIALYLDARLKLIICAEVARGTLTQAQIYPREIVREXX
RADC_BURCM      ------------------DYLRLRIGTRPHEVFVTLYLDARHGLIDVEESARGSLTRMAVYPREXXXXXX
RADC_BURA4      ------------------DYLRLRIGTRPHEVFVTLYLDARHGLIDVEESARGSLTRMAVYPREXXXXXX


                         .         .         *         .         .         .         .:140
query           FNEASSLILVHHHPSGSPEPSKANIHMTNKIVEKCQTINIIVLNLICSYEYK
RADC_AGRT5      ELSSTALILIHNHPSGDPTPSRADIEMTKTIIDTAKPLGITV----------
RADC_RHISN      ELSATALILAHNHPSGDPTPSRADIEMTKLIAEAAKPLGITV----------
RADC_RHIEC      ELSATAIILVHNHPSGDPTPSRADIDMTKVIIEAAKALDITV----------
RADC_RHIE6      ELSATAIILVHNHPSGDPTPSRADIDMTKVIIEAAKALDITV----------
RADC_RHIME      ELSATALILVHNHPSGDPTPSRADIDMTKLIAEAAKPLGI------------
RADC_RHILW      ELSATAMILVHNHPSGDPTPSRADIDMTKVIIEAAKALDITV----------
RADC_SINMW      ELSATALILVHNHPSGDPTPSCADIEMTKLIAEAAKPLGI------------
RADC_RHIL3      ELSATAMVLVHNHPSGDPTPSRADIDMTKVIIDAAKALDITV----------
RADC_PARDP      ELSASALILVHNHPSGDPTPSQADIGMTNRIVAAAEVMGIAV----------
RADC_RHOCA      ELDASALILVHNHPSGDPTPSQADIAMTDQIRHAAEALGLVL----------
RADC_OCHA4      ELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITV----------
RADC_BRUSU      ELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITV----------
RADC_BRUME      ELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITV----------
RADC_BRUMB      ELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITV----------
RADC_BRUC2      ELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITV----------
RADC_BRUAB      ELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITV----------
RADC_BRUA2      ELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITV----------
RADC_BRUA1      ELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITV----------
RADC_SILPO      ELNASALILVHNHPSGDPTPSQSDIDMTARIRSACEALGL------------
RADC_RHOP2      ELSATAVIMVHNHPSGDPTPSQADIQMTKTIVAIAEPLGVAV----------
RADC_CELJU      AHNAAAVIFAHNHPSGLAEPSQADIRITRRLQEALGLVDIRVLD--------
RADC_AZOVD      AHNAAALILTHNHPSGIAEPSQADFSLTRRLKEALALVDVRVLD--------
YFJY_ECOLI      YFNAAAVILAHNHPSGDTTPSQADKTITQRLVQALQLVDIRV----------
RADC_VIBVY      HYNAAALILAHNHPSGVAEPSQADRRITRRLSDALGLVDIRVLD--------
RADC_VIBVU      HYNAAALILAHNHPSGVAEPSQADRRITRRLSDALGLVDIRVLD--------
RADC_PSEPG      LHNAAALILCHNHPSGSSEPSQDDVHLTLSLKRGLALIDVRVLDHI------
RADC_VIBCM      HHNAAAVILAHNHPSGVAEPSQADRRITDRLRDALGLVEIRVLD--------
RADC_VIBCH      HHNAAAVILAHNHPSGVAEPSQADRRITDRLRDALGLVEIRVLD--------
RADC_VIBC3      HHNAAAVILAHNHPSGVAEPSQADRRITDRLRDALGLVEIRVLD--------
RADC_PSEA7      AHNAAALILTHNHPSGDARPSLADRQLTARLKEALALIDVRVLD--------
RADC_PSEU5      AQNAAAVILTHNHPSGVAEPSQADRQLTQRLKDALALIDVRVLD--------
RADC_PSEPW      MHNAAALILCHNHPSGNSEPSQDDVHMTLALKRGLALIDVRVLDHI------
RADC_JANMA      THNAASVILAHNHPSGSSEPSAADHSLTQALKQALALIDVRVLD--------
RADC_PSEFS      AYNAAALILCHNHPSGSLEPSAADRKLTKLLQKALEVVDVRVLDHI------
RADC_PSEPK      VHNAAALILCHNHPSGISEPSQDDVHLTLSLKRGLALIDVRVLDHI------
RADC_PSEP1      VHNAAALILCHNHPSGISEPSQDDVHLTLSLKRGLALIDVRVLDHI------
RADC_PSEMY      ANNAAAVILTHNHPSGVCEPSQADRVLTQRLKDALALVEVRVLD--------
RADC_RALSO      HHNASALILSHNHPTGHVEPSESDLVLTRELCRALALLDVRVLD--------
RADC_PSEAB      AHNAAALILTHNHPSGDARPSLADRQLTARLKEALALIDVRVLD--------
RADC_PSEA8      AHNAAALILTHNHPSGDARPSLADRQLTARLKEALALIDVRVLD--------
RADC_PSEE4      LHNAAALILCHNHPSGNCEPSQDDVHLTLMLKRSLALIDVRVVD--------
RADC_ALCBS      EHNAAAVILAHNHPSGVAEPSQSDHAITRRLVEALGLVEVRVLD--------
RADC_PSEAE      AHNAAALILTHNHPSGDARPSLADRQLTARLKEALALIDVRVLD--------
RADC_ALTMD      IDNAAAIILVHNHPSGVAEPSHADIRLTTEIKSAMASIDVPVLD--------
RADC_ACTSZ      YCNAAALILAHNHPSGSAEPSASDKQMTKRIQAAAELMEIRVLD--------
RADC_THETN      ERSASSIILVHNHPSGDPTPSREDVEVTKRLVEAGNILGIKVLD--------
RADC_RALPJ      HHNAAAVILAHNHPTGNTEPSESDVILTRELCRALAMLDVIVLD--------
RADC_PHOPR      EFNAVALILAHNHPSGVAEPSQSDLRITRTISDALALVDIRVLD--------
Y1786_VIBCH     NVNAAAVIFAHNHPSGDPEPSQADRRITQRLKDALSLVDIRVLD--------
RADC_PSEPF      ANNAAAVILCHNHPSGNSDPSQADRLLTKRLQKALELIDVRVLD--------
RADC_PASMU      FCNAAALILAHNHPSGNPEPSASDKMVTTKIQAAAELVEIRILD--------
RADC_VIBFM      DYNAAAIILAHNHPSGVAEPSQADRRITKRISDAVELVDIRVLD--------
RADC_PHOLL      KVNASSVILAHNHPSGHAEPSLADKIVTDKVIDACNLVGVKVLD--------
RADC_ALISL      DYNAAAIILAHNHPSGVAEPSQADRRITKRISDAVELVDIRVLD--------
RADC_VIBF1      DYNAAAIILAHNHPSGVAEPSQADRRITKRISDAVELVDIRVLD--------
RADC_VARPS      HHQAAAVVLSHNHPSGSIEPSRADESLTQTLRAALSLIDVRVLD--------
RADC_TERTT      AHNAAAVIFAHNHPSGVAEPSEADRQITDRLCRALQLLDIRTLDHI------
RADC_STRMK      LHNAAAVILSHNHPSGDPEPSSADTRITDELQQALAMVDVRLLD--------
RADC_RHOFD      HHQASSVVLAHNHPSGTVQPSRADEMLTQTLKTTLALIDVRVLD--------
RADC_NEIMF      DEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLD--------
RADC_NEIMB      DEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLD--------
RADC_NEIMA      DEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLD--------
RADC_NEIM0      DEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLD--------
RADC_NEIG2      DEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLD--------
RADC_NEIG1      DEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLD--------
RADC_HERAR      GHNAASVILAHNHPSGTPEPSAADQTLTQALKQALMLIDVRVLD--------
RADC_HAES2      FCNAAALILAHNHPSGVSTPSMADRKMTENIKQLSELMEIRVLD--------
RADC_HAES1      FCNAAALILAHNHPSGVSTPSMADRKMTENIKQLSELMEIRVLD--------
RADC_STRM5      LHNAAAVILSHNHPSGDPEPSSADTRITDELQQALAMVDVRLLD--------
RADC_RALEJ      AHNAASVIVAHNHPSGCCTPSQSDLQMTRMLARALDLIDVRLLD--------
RADC_SYMTH      RRSAHAVILAHNHPSGDPTPSREDREITRRLVQAGRVIGIEVLD--------
RADC_MARMS      QYNAAAVILAHNHPSGIAEPSQADISITDKI---------------------
RADC_PSEF5      AHNAAAVILCHNHPSGICEPSPADRVVTRRLQEALELIDVRVLD--------
RADC_ENTS8      RLNAAGIILAHNHPSGRAEPSRADKMVTERIVKSCQLVDIRVLD--------
RADC_XANOR      LHNAAAVIVGHNHPSGNPEPSKADRAVTKRLLDSLELVDIRLLD--------
RADC_XANOP      LHNAAAVIVGHNHPSGNPEPSKADRAVTKRLLDSLELVDIRLLD--------
YKFG_ECOLI      HFNAAAVILAHNHPSGETTPSQADKTLT------------------------
RADC_STACT      KWSSNAIIVVHNHPSGDVTPSKEDILTTKRLQECGRVLGIELLDHI------
RADC_NITMU      HHNAAAVIFAHNHPSGAAEPSHADAVLTQSLKQALLLVDVRVLD--------
RADC_NITEC      YHNAAAMIFAHNHPSGVAEPSRADEMLTQSLKQALALVDVKVLD--------
RADC_PSEHT      XXXXXXXIFAHNHPSGIAEPSQADKLITNKLQQALQLVDINVLDHI------
RADC_FINM2      KKGANSIILVHNHPSGSLIPSNADIEVTKRLDKVGDLVGIQVLDHI------
RADC_XANOM      LHNAAAVIVGHNHPSGNPEPSEADRAVTKRLLDSLELVDIRLLD--------
RADC_XANAC      LHNAAAVIVGHNHPSGNPEPSEADRAVTKRLLDSLELVDIRLLD--------
RADC_FUSNN      NLNAKSIILAHNHPSDNITPSKSDIELTNEIAKGLKNFGALLIEHI------
RADC_HAEIE      YCNAAALILAHNHPSGVTEPSYSDQLITKKIQDAAELMEICVLD--------
RADC_HAEI8      YCNAAALILAHNHPSGITEPSYSDQLITKKIQDAAELMEIRVLD--------
RADC_METBF      MESSASVIMIHNHPSGDPSPSREDIMVTEKMVEGGKLLGIDVLDHI------
RADC_CUPTR      AHNAAGIIVAHNHPRGTTAPSQSDIHLTRELARTLDLIDVRLLD--------
RADC_AZOSB      DRNAAAVIFAHNHPSGAAEPSSADEQLTRHLKDALALVDIRVLD--------
RADC_SALAR      KLNASAVILAHNHPSGCAEPSKADKHITDRVIKCCQFMDIRVLD--------
RADC_METMA      MESSASVIMVHNHPSGDPSPSREDIMVTEKLVE-------------------
RADC_METAC      LESSASVIMVHNHPSGDPSPSREDIMVTEKLVE-------------------
RADC_DESAP      RRSAAALILVHNHPSGDPAPSPQDIELTQRLFEAGEIVGIKVLDHI------
RADC_BURPP      SLNAASLIVAHNHPSGAVQPSASDCRLTHTLRDALTLIDV------------
Y510_VIBCH      EVNAAAVIFAHNHPSGDSTPSQADRRITERLKDTLALVDVRVLDHI------
RADC_XANC5      LHNAAAVIVGHNHPSGNPEPSEADRAVTKRLLDSLELVDIRLLD--------
RADC_SHIFL      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_SHIF8      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_SHIBS      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_SHIB3      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_NITEU      YHNAAAMIFAHNHPSGIAEPSTADEILTQSLKQALALVDVKVLD--------
RADC_METBU      MESSASVILTHNHPSGDPAPSREDIAVTEKLVEGGKILGISVLD--------
RADC_MARAV      EDNAAAVIFAHNHPSGVAEPSQADISLTRRLKEALGLVDIRVLD--------
RADC_ESCF3      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECOUT      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECOSM      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECOLU      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECOLI      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECOL6      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECOL5      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECOK1      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECOHS      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECODH      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECOBW      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECO8A      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECO81      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECO7I      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECO5E      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECO57      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECO55      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECO45      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECO27      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_ECO24      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_PSE14      AHNAASLILCHNHPSGITTPSRSDIDLTKRLKE-------------------
RADC_ACTPJ      KCNAAAIIVAHNHPSGNCTPSESDRALTKKLEMACDLVGI------------
RADC_ACTP7      KCNAAAIIVAHNHPSGNCTPSESDRALTKKLEMACDLVGI------------
RADC_ACTP2      KCNAAAIIVAHNHPSGNCTPSESDRALTKKLEMACDLVGI------------
RADC_SHIDS      KINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHI------
RADC_RALEH      VHNAAGIIVAHNHPRGTTAPSQSDIRLTHELARTLDLIDVRLLD--------
RADC_PSESM      AHNAASLILCHNHPSGITTPSRSDIDLTKRLKE-------------------
RADC_XANCP      LHNAAAVVVGHNHPSGNPEPSEADRAVTQRLLQALGLVDIRLLD--------
RADC_XANC8      LHNAAAVVVGHNHPSGNPEPSEADRAVTQRLLQALGLVDIRLLD--------
RADC_KLEP3      KVNAAAVILAHNHPSGSPEPSQADRLITERVVKCCRFMEIRVLD--------
RADC_HAEIN      YCNAAALILAHNHPSGITEPSYSDQLITKKIQDAAELMEIRVLD--------
RADC_COXBN      YHNSAALIVAHNHPSGVPDPSQADRAATTHLKEALALIDVRLLDHI------
RADC_COXB1      YHNSAALIVAHNHPSGVPDPSQADRAATTHLKEALALIDVRLLDHI------
RADC_CITK8      KLNASAVILAHNHPSGCAEPSKADKLITERVVKCCQFMDIRVLD--------
RADC_DESRM      RRSAASMILVHNHPSGDPTPSREDIVLTKRLIE-------------------
RADC_BACC4      RRAAASIICLHNHPSGDPTPSREDIAVTKRLVECGQIIGIEVLDHIIIGDHK
RADC_BACC2      RRAAASIICLHNHPSGDPTPSREDIEVTKRLVECGQIIGIEVLDHIIIGDHK
RADC_METFK      RHNAAAMIFAHNHPSGVPEPSQADRALTEALKAALNLIDIRVLD--------
RADC_KLEP7      KVNAAAVILAHNHPSGSPEPSQADRLITERVIKCCRFMEIRVLD--------
RADC_ENT38      KVNAAAVILAHNHPSGCAEPSKADKDITERIIKCCQFMDIHVLD--------
RADC_BURXL      SLNAASLIVAHNHPSGAVQPSASDCRLTHTLRDALTLIDV------------
RADC_BACHK      RRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHIIIGDHK
RADC_BACCZ      RRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHIIIGDHK
RADC_BACCQ      RRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHIIIGDHK
RADC_BACC7      RRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHIIIGDHK
RADC_BACC3      RRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHIIIGDHK
RADC_BACC1      RRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHIIIGDHK
RADC_BACAN      RRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHIIIGDHK
RADC_BACAC      RRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHIIIGDHK
RADC_BACAA      RRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHIIIGDHK
RADC_SYNWW      KKSAASMILVHNHPSGDPTPSQEDIEITRRLIEAGKIMGIEILD--------
RADC_SACD2      SHNAAAVILAHNHPSGIAEPSEPDKAITKRLQQALQLVDIRTLD--------
RADC_BACWK      RRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHIIIGDHK
RADC_YERE8      KVNAAALILAHNHPSGKAEPSQADRLMTTQVIKACSLLDIRVLD--------
RADC_IDILO      QYNAAAVILAHNHPSGVAEPSQADQRVTERVKKALTLIDVALLD--------
RADC_ALKOO      KRSSSAIILAHNHPSGDPNPSGEDINITKRLIEAGNIIGISVLDHI------
RADC_PELPD      KESAAAVILVHNHPTGDPTPSQEDIAITRRLKEAGEIMGIRVLDHI------
RADC_LEPCP      XXXXXXXXXXHNHPSGVAEPSRADEFLTQSLKTALALIDVRVLD--------
RADC_HAEDU      KCNAAAIIVAHNHPSGNCTASQADRQLTQKIKAACHLVEV------------
RADC_STAHJ      RASSNAIIVLHNHPSGDVTPSKEDIETTIRLKECGELLGIQVLDHI------
RADC_SHEPW      EKKAAAVIVCHNHPSGIAEPSTADRRITERLKQALQTIDVSLLD--------
RADC_SHEB8      EKKAAAVIVCHNHPSGNAEPSQADRRITERLKNALATIDVSLLD--------
RADC_PSEU2      AHNAASLILCHNHPSGITTPSRSDIDLTKRLKE-------------------
RADC_CHRSD      ALNAGALIFAHNHPSGVAEPSDADRRITQRLSDALGLFDIRVLD--------
RADC_SHEPA      EKKAAAVIVCHNHPSGIAEPSTADRRITERLKQALQTIDVSLLD--------
RADC_SHEHH      EKKAAAVIVCHNHPSGIAEPSTADRRITERLKQALQTIDVSLLD--------
RADC_SHEAM      EKRAAAVIVCHNHPSGVAEPSQADRRITERLKNALATIDVSLLD--------
RADC_AERHH      KHNAAAVILAHNHPSGVAEPSRADRQITDRITAALALIDIRVLD--------
RADC_YERPY      KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLD--------
RADC_YERPS      KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLD--------
RADC_YERPP      KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLD--------
RADC_YERPN      KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLD--------
RADC_YERPG      KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLD--------
RADC_YERPE      KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLD--------
RADC_YERPB      KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLD--------
RADC_YERPA      KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLD--------
RADC_YERP3      KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLD--------
RADC_STRA5      KNMATSLIIIHNHPSGSPKPSESDLSFTKKIKRSCDHLGIVCLDHI------
RADC_STRA1      KNMATSLIIIHNHPSGSPKPSESDLSFTKKIKRSCDHLGIVCLDHI------
RADC_SHESR      EKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLD--------
RADC_SHESM      EKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLD--------
RADC_SHESA      EKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLD--------
RADC_SHEON      EKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLD--------
RADC_BACLD      KRSAASFICVHNHPSGDPAPSREDIEVTQRLHESGQLLGIELLDHI------
YEES_ECOLI      XXXXXXXXXXXXHPSGEVTPSKADRLITERLVQALGLVDIRV----------
RADC_STRA3      KNMATSLIIIHNHPSGSPNPSESDLSFTKKIKRSCDHLGIVCLDHI------
RADC_SHEFN      EKKAAAVIVCHNHPSGIAEPSQADRRITERIKNALATIDVSLLD--------
RADC_SHEB9      EKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLD--------
RADC_SHEB5      EKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLD--------
RADC_SHEB2      EKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLD--------
RADC_SALTY      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_SALTI      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_SALSV      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_SALPC      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_SALHS      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_SALG2      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_SALEP      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_SALDC      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_SALCH      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_SALA4      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_PSEA6      EDNAAAVILTHNHPSGVAEPSQADEHITARIISAMSLLDIKVLD--------
RADC_PELPB      KESSHAIILVHNHPSGDVEPSNADKQVTDLLKQASTVIQIDLLDHI------
RADC_ALKMQ      KRSSSAIILVHNHPSGDPSPSGEDIRITKRLVEAGKLLGIEVLDHI------
RADC_TOLAT      KHNAAAVILCHNHPSGVAEPSHADRHITERICDALRLIDVRVLD--------
RADC_SHESW      EKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLD--------
RADC_SHEPC      EKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLD--------
RADC_SHELP      EKKAAAVIVCHNHPSGGAEPSHADRRITERLKYALATIDVSLLD--------
RADC_SHEDO      EKRAAAVIICHNHPSGIAEPSQADRRITERLKNALATIDVSLLD--------
RADC_SALPK      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_SALPA      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_CLOBA      NKSSTKIIICHNHPSGDPTPSKEDINITLRIKECGEIMGIQLLDHI------
RADC_BURVG      MLNAASLIIAHNHPSGAVQPSAEDRRLTRVLHEALALVDAKLLD--------
RADC_STRPZ      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_STRPG      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_STRPF      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_STRPD      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_STRPC      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_STRPB      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_STRP8      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_STRP6      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_STRP1      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_STRE4      KNMATSLIVVHNHPSGLTKPSANDYHFTEKIKRSCDYLGLICLDIVSKYDY-
RADC_DELAS      HHHAGAVILAHNHPSGQVQASAADKAVTQNLQAALRLVDIQVLD--------
RADC_CLOD6      RRSASKIIVMHNHPSGSVEPSREDKNITSRLI-KC-----------------
RADC_CLOBB      NKSSAKIIISHNHPSGDPTPSKEDINITLRIKECGEIMGIQLLDHI------
RADC_CARHZ      KIGAYAVIIAHNHPSGDPTPSKEDIDFTGRVKKASEILGIKLLDHIILGENK
RADC_SALNS      KLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLD--------
RADC_CLOB8      SKNSASIIICHNHPSGDPTPSREDINITLRIKE-CG--NIIGIQLV------
RADC_CHLP8      RQSAHSIILVHNHPSGDVQPSNADKQVTSILKKSGDLLQIALLD--------
RADC_BURS3      VHNAAALIVAHNHPSGAVQPSAEDRRLT------------------------
RADC_STRSV      KHLATSIILVHNHPSGSVVPSRNDDEVTQHMKEACEMMGLVLLD--------
RADC_RUBXD      RASAASVVLAHNHPSGRVEPSREDREVTGRVAEAGGIIGIEVLD--------
RADC_GEOSW      KRSAASIICVHNHPSGDPTPSREDIDVTKRLAECGRIIGIELLD--------
RADC_CHLCH      RESAHSIIVVHNHPSGDVNPSNADKKITNELKQAGAFMQIEMLD--------
RADC_ACIF5      ELNAAALIVAHNHPSGVAEPSAADLSLTRRLDQAMQLLDLRLLD--------
RADC_ACIF2      ELNAAALIVAHNHPSGVAEPSAADLSLTRRLDQAMQLLDLRLLD--------
RADC_STRPM      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_STRP3      KNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLHIIVSYK--
RADC_PARUW      RHKAASLIVVHNHPSGDPMPSNQDLKLTQILLEGSRLLGI------------
RADC_STAS1      KCASNAIIVLHNHPSGDTTPSLEDIKTTDRLRECGDILGIQLLD--------
RADC_GEOTN      KRSAASVICVHNHPSGDPTPSREDIDVTKRLAECGRIIGIELLD--------
RADC_GEOKA      KRSAASVICVHNHPSGDPTPSREDIDVTKRLAECGRIIGIELLD--------
RADC_STRS7      KNMATSLIVVHNHPSGLTKPSANDYHFTEKIKRSCDYLGLICLDHI------
RADC_STREM      KNMATSLIVVHNHPSGLTKPSANDYHFTEKIKRSCDYLGLICLDHI------
RADC_SHESH      EKKAAAVIVCHNHPSGVAEPSLADRRITERLKFALETIDVSLLD--------
RADC_GEOUR      RESAAAIILVHNHPTGDPTPSREDIDITRRLREAGDLLGIKVLDHI------
RADC_BURCH      KHNAAALIVAHNHPSGAVQPSAEDRRLT------------------------
RADC_BURCC      KHNAAALIVAHNHPSGAVQPSAEDRRLT------------------------
RADC_BURCA      KHNAAALIVAHNHPSGAVQPSAEDRRLT------------------------
RADC_BACHD      RRSAASLICLHNHPSGDPTPSREDIEVTHRLAQVGKLIGIELLD--------
RADC_BACA2      KRSAASFICVHNHPSGDPTPSREDIEVTRRLFECGNLIGIELLD--------
RADC_AERS4      KHNAAAVILAHNHPSGVAEPSRADRQITDRILAALALIDIRVLD--------
RADC_STAAB      RENANAIIAVHNHPSGDVTPSQEDIITTMRLKE-------------------
RADC_SHEWM      EKKAAAVIVCHNHPSGVAEPSHADRRITERLKCALSTIDVSLLD--------
RADC_VIBSL      XXXXXXXXXXXXXPSGVAEPSQADRRITRRLTDALALVDIRILD--------
RADC_STAAW      RENANAIIAVHNHPSGDVTPSQEDIITTMRLKE-------------------
RADC_STAAS      RENANAIIAVHNHPSGDVTPSQEDIITTMRLKE-------------------
RADC_STAAE      RENANAIIAVHNHPSGDVTPSQEDIITTMRLKE-------------------
RADC_STAAC      RENANAIIAVHNHPSGDVTPSQEDIITTMRLKE-------------------
RADC_STAA8      RENANAIIAVHNHPSGDVTPSQEDIITTMRLKE-------------------
RADC_STAA3      RENANAIIAVHNHPSGDVTPSQEDIITTMRLKE-------------------
RADC_POLNA      XXXXXXXXXXHNHPSGAAQPSRADEMLTQTLKTALALVDVRVLD--------
RADC_PROVI      RESANAIILVHNHPSGDTEPSNADRQVTNLLKQASAVIQIDLLD--------
RADC_BACSK      QSSSASVICLHNHPSGDPSPSPEDISVTKRLRQAGAILGIELLDHI------
RADC_BACP2      KRSAASFICVHNHPSGDPTPSREDIEVTQRLFECGKLIGIQLLD--------
RADC_STRS2      KCMATSIIIVHNHPSGSVQPSRNDLLFTENLKESCEKLGLVLLD--------
RADC_METPP      XXXXXXXXXXHNHPSGVAEPSRAD----------------------------
RADC_GEOSL      RESAAAVILVHNHPTGDPAPSREDLEITRRLREAGDIMGIRVLDHI------
RADC_COPPD      LTSAQALILIHNHPSGDPSPSREDVAVTKQLKQACELVGAQLLDHI------
RADC_CHLTE      RESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLD--------
RADC_VIBPA      XXXXXXXXXXXXXPSGVAEPSQADRRITRRLIDALALVDIRILD--------
RADC_THEEB      RRNASRLIIAHNHPSGNLSPSQADLDLTKQILQAGQLMEIPVLD--------
RADC_MOOTA      RRSAAAIILAHNHPSGDPTPSQEDIMVTRRLVEAGHILGIEVLD--------
RADC_CLOAB      LKHAASIILCHNHPSGDPKPSNEDLNITKRLYECSKFIGIELLDHI------
RADC_BACSU      KRSAASFICVHNHPSGDPTPSREDIEVTRRLFECGNLIGIELLD--------
RADC_VIBHB      XXXXXXXXXXXXXPSGVAEPSQADRRITRRLIDALGLVDIRILD--------
RADC_CLONN      KKNSASIVICHNHPSGDPTPSSEDINVTKRL---------------------
RADC_SYNY3      KQGATRLIVAHNHPSGGLEPSPEDIRLTEFLLQGAQYLQIPVLD--------
RADC_PSYIN      SENAAAIILVHNHPSGDPSASEADKMITQKIVSALQLIDVRVLD--------
RADC_CHLPB      RESSHAIILVHNHPSGDVEPSNADKQVTSILEHAGSILQINLLDHI------
RADC_ACIAC      XXXXXXXXXXXNHPSGQVQPSRADETLTRSLTDALRLVDVRVLDHI------
RADC_PROA2      RESAHAIIVVHNHPSGDVEASNADKQVTAVLKKAGSLLQIELLD--------
RADC_XYLFT      TLNAAAVIVGHNHPSGNREPSPADQMITQRLKNALDLIDV------------
RADC_XYLFA      TLNAAAVIVGHNHPSGNREPSPADRMITQRLKNALDLIDV------------
RADC_THIDA      XXXXXXXXXXXXXPSGVNEPSQADRSLTRRLAEALALVDIRVLD--------
RADC_SYNP2      KHGATRLIIAHNHPSGNVDPSPEDLQLTERLLQSAQILGIPLLD--------
RADC_LISMO      RKSAASIMCFHNHPSGDPTPSSEDLLVTKRLAEAGNIVGITLLDHI------
RADC_LISMH      RKSAASIMCFHNHPSGDPAPSSEDLLVTKRLAEAGNIVGITLLDHI------
RADC_LISMF      RKSAASIMCFHNHPSGDPTPSSEDLLVTKRLAEAGNIVGITLLDHI------
RADC_LISMC      RKSAASIMCFHNHPSGDPTPSSEDLLVTKRLAEAGNIVGITLLDHI------
RADC_CYAP7      KQGATKLIIGHNHPSGNVAPSQEDIDLTEQLLKAATFLNFPLLD--------
RADC_THICR      DHHAAAVILAHNHPSGDPTPSQSDRDLTHQIQQGLQLIETRCLDHI------
RADC_CLOTE      KNNSYSIIICHNHPSGDTTPSKEDINVSNRIKECGKLIGIELLDHI------
RADC_CLOK5      KKNSASIILCHNHPSGDPSPSNEDVNVTFRL-KKC-----------------
RADC_CLOK1      KKNSASIILCHNHPSGDPSPSNEDVNVTFRL-KKC-----------------
RADC_STAES      RESSNSIIVVHNHPSGDVTPSKEDITTTYRLKECGDILGINLLDHI------
RADC_GEOLS      RESAAAVIFIHNHPSGDPAPSREDHEITRRLNEAGEILGIKVLDHI------
RADC_CLOBM      KKNGASIIICHNHPSGDPTPSKEDINITLRL-KKC-----------------
RADC_CLOBK      KKNGASIIICHNHPSGDPTPSKEDINITLRLKE-------------------
RADC_CLOBJ      KKNGASIIICHNHPSGDPTPSKEDINITLRLKE-------------------
RADC_CLOBH      KKNGASIIICHNHPSGDPTPSKEDINITLRLKE-------------------
RADC_CLOB6      KKNGASIIICHNHPSGDPTPSKEDINITLRLKE-------------------
RADC_CLOB1      KKNGASIIICHNHPSGDPTPSKEDINITLRLKE-------------------
RADC_CHLPD      RESAHAIILVHNHPSGDVEPSNADRQVTEILRQAGSFLQIDLLD--------
RADC_CLOBL      KKNGASIIICHNHPSGDPTPSKEDINITLRLKE-------------------
RADC_LISIN      RKSSASIMCFHNHPSGDPAPSSEDLLVTKRLAEAGNIVGITLLDHI------
RADC_ENTFA      KYSSARILLAHNHPSGNPTPSPQDIQFTKRMEECGEMMGIQLLDHI------
RADC_CLOPS      KDSAASIIICHNHPSGDPTPSRDDINITTRLKECGKMMGIELLD--------
RADC_ERWCT      XXXXXXXXXXHNHPSGKAEPSQADRAITEQIVKACLLLEIRVLD--------
RADC_PECCP      XXXXXXXXXXHNHPSGKAEPSQADRAITEQIVKACLLMEIRVLD--------
RADC_POLSJ      XXXXXXXXXXHNHPSGAATPSRADEALTQTLKSALALVDVRVLD--------
RADC_CLOPE      KDSAASIIICHNHPSGDPTPSRDDINITTRLKECGKMMGIELLD--------
RADC_CLOP1      KDSAASIIICHNHPSGDPTPSRDDINITTRLKECGKMMGIELLD--------
RADC_STRU0      RNMATSLIVVHNHPSGLTNPSENDVAFTKKIKRSCDHLGINCLDHI------
RADC_MICAN      KQSATKLIIAHNHPTGSLVPSQDDILLTEQLLQGATYLAIPLLD--------
RADC_FLAJ1      ENGATGLILCHNHPSGELNPSQADKQITKKIKTAGEILDVKILDHLIITETK
RADC_CYAA5      KQGANALIVAHNHPSGNVEPSQQDLDLTEQLLKGMQLIRIPLID--------
RADC_SALRD      LDDAAAVICLHNHPSGNPEPSREDIRITRQLAEAGGTMGIPV----------
RADC_PELLD      RESAHAIILVHNHPSGDTEPSNADRQVTTLLKQASAVIQIDLLD--------
RADC_PELCD      RESAAAVLFVHNHPSGDPSPSREDLDITQRLREVGELMGVRVLDHI------
RADC_NOSP7      RQGATRAIVAHNHPSGNLEPSQEDIELTRQLLAGAQLLGIPVLD--------
RADC_BORPE      RHHAAALILTHNHPGGTXXXXXXXXXMTRQIRQALALIDVRLID--------
RADC_TRIEI      RQGASRVIISHNHPSGNVEPSPEDINLTKQLLAGAQ----------------
RADC_LISW6      RKSSAAIMCFHNHPSGDPTPSSEDLLVTKRLVE-------------------
RADC_LACSS      QYSAAKFILVHNHPSGQLAPSTQDINFTKRIVNCGQLMGITCLDIIGSSQY-
RADC_LACLA      KNLSVGLLVAHNHPSGNLKPSQADKIFTTKIKKSCEDVGI------------
RADC_STRZT      KHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLHLIVSH---
RADC_STRZP      KHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLHLIVSH---
RADC_STRZJ      KHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLHLIVSH---
RADC_STRPN      KHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLHLIVSH---
RADC_STRPJ      KHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLHLIVSH---
RADC_STRPI      KHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLHLIVSH---
RADC_STRP7      KHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLHLIVSH---
RADC_STRP4      KHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLHLIVSH---
RADC_AZOSE      XXXXXXXXXXHNHPSGAAEPSPADELLTRSLKQALELVDIRVLD--------
RADC_STRR6      KHMATSLVLVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLHLIVSH---
RADC_STRP2      KHMATSLVLVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLHLIVSH---
RADC_ACIBT      QQHACQLVIAHNHPFGSPQPSPEDIKLTQQLEQACQLVEIRLLD--------
RADC_ACIB5      QQHACQLVIAHNHPFGSPQPSPEDIKLTQQLEQACQLVEIRLLD--------
RADC_ACIB3      QQHACQLVIAHNHPFGSPQPSPEDIKLTQQLEQACQLVEIRLLD--------
RADC_STRTD      HLMATSLIVVHNHPSGEAYPSRNDIDFTQKIKRSCDDLGICLLD--------
RADC_STRT2      HLMATSLIVVHNHPSGEAYPSRNDIDFTQKIKRSCDDLGICLLD--------
RADC_STRT1      HLMATSLIVVHNHPSGEAYPSRNDIDFTQKIKRSCDDLGICLLD--------
RADC_BORA1      RLHAGAIILAHNHPSGNPQPSAADCAFTQQLSQALALVDIRLVDHI------
RADC_THEP1      RANASGVIVVHNHPSGDPTPSKEDRLITERLKQAGEILGVSLVD--------
RADC_THEMA      RANASGVIVVHNHPSGDPTPSKEDRLITERLKQAGEILGVSLVD--------
RADC_ANAVT      RQGATRTIVAHNHPSGNVEPSPEDIELTRQLLAGAQ----------------
RADC_ANASP      RQGATRTIVAHNHPSGNVEPSPEDIELTRQLLAGAQ----------------
RADC_ALHEH      XXXXXXXXXXXXXPSGVAEPSVADQALTRRLQEALGLVDIRVLD--------
RADC_CYAP4      RQGATRVIVAHNHPSGNVEPSPEDLALTQQLLSGAKFLDIPLLD--------
RADC_NITOC      XXXXXXXXXXXXXPSGVAEPSRADECITQRLKEALALVDIRVLDHI------
RADC_HAHCH      KXXXXXXXXXXXXPSGVAEPSLSDKEITETLRKALRLVDVRVLD--------
RADC_VEREI      XXXXXXXXXXXNHPSGSVQPSRADEALTQTLKSTLALVDVRVLD--------
RADC_LACLM      KNLSVGLLVAHNHPSGNLQPSQADKIFTKKIKNACDNIGI------------
RADC_LEGPL      XXXXXXXXXXHNHPSGLSDASQQDLAITERI---------------------
RADC_LEGPH      XXXXXXXXXXHNHPSGLSDASQQDLAITERI---------------------
RADC_LEGPA      XXXXXXXXXXHNHPSGLSDASQQDLAITERI---------------------
RADC_CHLSY      RRNSAAIIVVHNHPSGEPTPSMEDIEITRQLVSAGRLLDIEVVD--------
RADC_CHLAA      RRNSAAIIVVHNHPSGEPTPSMEDIEITRQLVSAGRLLDIEVVD--------
RADC_ACAM1      RKGATRAIVAHNHPSGQTDPSPEDLELTQQLLSGAQ----------------
RADC_STRGC      KHMATSIILVHNHPSGATRPSRDDDQVTEKIKEACEMMGFVLLD--------
RADC_LEGPC      XXXXXXXXXXHNHPSGLSDASQQDFAITERI---------------------
RADC_DIAST      XXXXXXXXXXXNHPSGSVQPSRAD----------------------------
RADC_CHRVO      XXXXXXXXXXXXXPSGVSEPSSADRVLTDTLKRALELVDIRLLD--------
RADC_ROSCS      RLNSASIIVVHNHPSGDPTPSPEDIVVTRQMIE-------------------
RADC_THISH      XXXXXXXXXXXXXPSGVAEPSRSDEAITRRLRDALALVDIRVLD--------
RADC_PORGI      SHLASAIILAHNHPSGTVRPSEQDIQLTQR-VQKAATL--------------
RADC_ACISJ      XXXXXXXXXXXNHPSGSVQPSRAD----------------------------
RADC_PSYWF      EQGASQIIIAHNHPNQDATPSAADIHLTQTLKLACEAIDL------------
RADC_BORPD      XXXXXXXXXXXNHPSGSAQPSQADRDFTRHMQQALALVEIRLLD--------
RADC_AQUAE      KLSANGIIIAHNHPQGEPSPSNEDLNFTERLKKACELLGFELLD--------
RADC_LARHH      RQHAVAVILAHNHPSGDSGPSLADRELTEALGRALALVDVRLLD--------
RADC_DESHY      RRNSNAIILLHNHPSGDPTPSSEDIDVTRRLSDGGQILGIEVLD--------
RADC_DESHD      RRNSNAIILLHNHPSGDPTPSSEDIDVTRRLSDGGQILGIEVLD--------
RADC_SERP5      XXXXXXXXXXXXXPSGKAEPSHADRLITEQVVNACLLLEIRVLD--------
RADC_ROSS1      RLNSASIIVVHNHPSGDPTPSPEDVVVTRQIIE-------------------
RADC_ACIAD      QQHACHIVIAHNHPFGKAEPSAADLDLTHQLYQACQLVEIKLLD--------
RADC_PSYCK      SHAASQLIIAHNHPHTDAKPSTADNLLTYELKKACDLIDLSLID--------
RADC_CHLAD      RRNSAAIIVVHNHPSGEATPSPEDIQVTRQLVAAGRLLDIEVLD--------
RADC_PSYA2      SHATSQLIIAHNHPHTDATPSTADNLLTYELKKACDLIDLSLID--------
RADC_METHJ      XXXXXXXXXXHNHPSGNPEPSSEDITVTRQLSEAGKILGISLLD--------
RADC_DECAR      XXXXXXXXXXXXXPSGIAEPSRADEMLTRSLKEALAMVDVKVLD--------
RADC_BURTA      XXXXXXXXXXXXXPSGAVRPSAADRHLTRVLRDALALVDVQLID--------
RADC_BURP6      XXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLID--------
RADC_BURP1      XXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLID--------
RADC_BURP0      XXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLID--------
RADC_BURMS      XXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLID--------
RADC_BURMA      XXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLID--------
RADC_BURM9      XXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLID--------
RADC_BURM7      XXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLID--------
RADC_HALHL      XXXXXXXXXXXXXPSGITEPSAADEALTHRLREALGLVDVRLLD--------
RADC_BORBR      XXXXXXXXXXXNHPGGTXXXXXXXXXMTRQIRQALALIDVRLID--------
RADC_BORPA      XXXXXXXXXXXNHPGGTXXXXXXXXXMTRQIRQALALVDVRLID--------
RADC_BURCM      XXXXXXXXXXXXXPSGAVQPSAEDRRLTRVLHEALALIDAKLLD--------
RADC_BURA4      XXXXXXXXXXXXXPSGAVQPSAEDRRLTRVLHEALALIDAKLLD--------