[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL03819.1

[Show Plain Result]


## Summary of Sequence Search
    1::249
   43::249     2e-85 100%  249 aa  Y1281_RICCN RecName: Full=Putative adhesin RC1281;Flags: Precursor;
   27::224     3e-32  40%  224 aa  Y1314_RICFE RecName: Full=Putative adhesin RF_1314;Flags:
   26::224     9e-31  38%  224 aa  Y1308_RICM5 RecName: Full=Putative adhesin RMA_1308;Flags:
   27::228     1e-30  38%  228 aa  Y1215_RICB8 RecName: Full=Putative adhesin A1I_01215;Flags:
   29::227     2e-30  37%  227 aa  Y1282_RICCN RecName: Full=Uncharacterized protein RC1282;Flags:
   26::224     2e-30  37%  224 aa  Y5320_RICCK RecName: Full=Putative adhesin A1E_05320;Flags:
   27::224     4e-30  38%  224 aa  Y6425_RICAH RecName: Full=Putative adhesin A1C_06425;Flags:
   26::224     6e-30  37%  224 aa  Y7050_RICRS RecName: Full=Putative adhesin A1G_07050;Flags:
   27::228     6e-30  37%  228 aa  Y1271_RICBR RecName: Full=Putative adhesin RBE_1271;Flags:
   26::220     3e-26  41%  222 aa  Y828_RICPR RecName: Full=Putative adhesin RP828;Flags: Precursor;
   26::223     4e-26  40%  225 aa  Y816_RICTY RecName: Full=Putative adhesin RT0816;Flags: Precursor;
    1::249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxENQWYLKLNAGGVIFNKTKPKGADFKLX
Y1281_RICCN     ------------------------------------------ENQWYLKLNAGGVIFNKTKPKGADFKLX
Y1314_RICFE     -------------------------------------------NDWYLRIDAGAAMFNKEKDKATGVKLK
Y1308_RICM5     ------------------------------------------DNEWYLRIDTGAAMFNEEKDKATGVKLK
Y1215_RICB8     -------------------------------------------DSWYLRVDAGAAMFNKEKDNQTGLKLK
Y1282_RICCN     ------------------------------------------DHEWYLRIDTGAAMFNEEKDKATGVKLK
Y5320_RICCK     ------------------------------------------DNEWYLRIGAGAAMFNKEKDEATSVKLK
Y6425_RICAH     -------------------------------------------NEWYLRVDAGAAMFNKEQDKATSVKLK
Y7050_RICRS     ------------------------------------------DHEWYLRIDTGAAMFNEEKDKATGVKLK
Y1271_RICBR     -------------------------------------------DSWYLRVDAGAAMFNKEKDNQTGLKLK
Y828_RICPR      ------------------------------------------DNEWYLRADAGVAMFNKEQDKATGVKLK
Y816_RICTY      ------------------------------------------DNEWYLRVDAGVAMFNKEKDKTIGVKLK


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXTGFTGEIGAGYYIMDNLRTDLTIGTVASSHLKKSKTYPDGNSFSVKNKPTIVSVLLNGYVD
Y1281_RICCN     XXXXXXXXXTGFTGEIGAGYYIMDNLRTDLTIGTVASSHLKKSKTYPDGNSFSVKNKPTIVSVLLNGYVD
Y1314_RICFE     SN-------TTVPVDLGIGYYISENFRADLTLGTIIGGKLKKSGAATNGTNISASHKPTITRLLINGYVD
Y1308_RICM5     SN-------TTVPVDLGIGYYISENCRADLTLGTIIGGKLKKSGAATNGTNVSASHKPTITRLLINGYVD
Y1215_RICB8     SN-------TAFTGDIGVGNYIAENFRADLTLGTTFSGKLKKSGAVSSGANISASHKPNITRLLINGYVD
Y1282_RICCN     SN-------TTVPVALGIGYYISENFRADLTLGTIIGGKLKKSGAATNATNISASHKPTITRLLINGYVD
Y5320_RICCK     SNMTVSV-------DLGIGYYFSKNFRTDLTLGTIIGGKLKKSGTATNGTNVSVSYKPTITRLLINGYVD
Y6425_RICAH     SN-------TTVPVDLGIGYYIFENFRADLTLGTIIGGKLKASGSATHGTNVSVSHKPTITRLLINGYVD
Y7050_RICRS     SN-------TTVPVALGIGYYISENFRADLTLGTIIGGKLKKSGAATNATNVSASHKPTITRLLINGYVD
Y1271_RICBR     SN-------TAFTGDIGVGNYIAENFRADLTLGTTFSGKLKKSGAVSSGANISASHKPNITRLLINGYVD
Y828_RICPR      SNKAIPI-------DLGIGYYISENVRADLTLGTTIGGKLKKTNTHFTGTNVSVSHKPTVTRLLINGYVD
Y816_RICTY      SNKAMPI-------DLGIGYYIAENVRADLTLGTTIGGKLKKSNAHFTGTNVLVSHKPIVTRLLINGYVD


                         +         .         .         .         .         *         .:210
query           FVDLSMXXXXXXXXXXXXXXXXXIHSKDIKGGVXXXXXXXXXXXXXXAYQLSLGTSFEVAQGVKAELVYS
Y1281_RICCN     FVDLSMXXXXXXXXXXXXXXXXXIHSKDIKGGVXXXXXXXXXXXXXXAYQLSLGTSFEVAQGVKAELVYS
Y1314_RICFE     LTNFDMFDVFAGAGVGPALVKEKITYNGITG-----LSSNTKNRTNISYKLTLGTSAQIADGVKAELAYS
Y1308_RICM5     LTNFDMFDVFAGAGVGPALVKEKITYNGITG-----LSSNTKNRTNISYKLTLGTSAQIADGVKVELAYS
Y1215_RICB8     LSNFEMFDVFAGAGIGASMLKEKVSFSGINSGATVSTSYSSKNTTNLAYKLTLGASSQISDGVKAELAYS
Y1282_RICCN     LTNFDMFDVFAGAGVGSALVKEKITYNGITG-----LSSNTKNRTNISYKLTLGTSAQIADGVKVELAYS
Y5320_RICCK     LTNFNIFDVFAGAGVGPALVKEKITYNGITG-----LASTTKNRTNISYKLTLGTSAQIADDVKVELAYS
Y6425_RICAH     LTNFDLFDVFAGAGVGPALVKEKITYNGITG-----LSSNTKNRTNISYRLTLGTSAQIADGVKAELAYS
Y7050_RICRS     LTNFDMFDVFAGAGVGPALVKEKITYNGITG-----LSSNTKNRTNISYKLTLGTSAQIVDGVKVELAYS
Y1271_RICBR     LSNFEMFDVFAGAGIGASMLKEKVSFSGINSGATVSTSYSSKNTTNLAYKLTLGASSQISDGVKAELAYS
Y828_RICPR      LTSXXXXXXXXXXXXXPALV------KEKISGV-SGLASNTKNKTNVSYKLIFGTSAQIADGVKVELAYS
Y816_RICTY      LTSFDM----FDIFVGAGVGPALVKEKISGASGLASXXXXXXXXXXVSYKLIFGTAAQVADGVKVELAYS


                         .         .         .         +         .         .         .:280
query           WRDYGXXXXXXXXINGDKVKFGGTHYKGHNLMAGLRFDM
Y1281_RICCN     WRDYGXXXXXXXXINGDKVKFGGTHYKGHNLMAGLRFDM
Y1314_RICFE     WIDDGRTKSKNVIYQGTSVSTGGMRYQSHNLTAGIRFDI
Y1308_RICM5     WIDDGRTKSKNVIYPGTSVPTGGMRYQSHNLTAGIRFDI
Y1215_RICB8     WISDGKTKGGNVNLFGGNKQVKGTRYQSHNLTAGLRFDV
Y1282_RICCN     WIDDGRTKSKNVIYQGTSVPTGGMHYQSHNLTAGIRFDI
Y5320_RICCK     WINDGKAKSKNVVYQGQKVQIGGMRYQSHNLTASIRFDI
Y6425_RICAH     WIYDGRTKSKNVIYQGTSVLTGGMRYQSHNLTAGIRFDI
Y7050_RICRS     WIDDGRTKSKNVIYQGTSVPTGGMHYQSHNLTAGIRFDI
Y1271_RICBR     WISDGKTKGGNVKLFGGNKQVKGIRYQSHNLTAGLRFDI
Y828_RICPR      WINDGKTKTHNVMYKGASVQTGGMRYQSHNLTVGVRF--
Y816_RICTY      WIDDGRTKSKHVIHEGASVQTGGMRYQSHNITVGLRF--