[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rcon0:AAL03106.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dhhA.bssp"
#ERROR : Can't open dsspfile "3d9bA.bssp"
#ERROR : Can't open dsspfile "3cuzA.bssp"
#ERROR : Can't open dsspfile "2c5mA.bssp"
#ERROR : Can't open dsspfile "3cv2B.bssp"
#ERROR : Can't open dsspfile "3cv2A.bssp"
#ERROR : Can't open dsspfile "2d9rA.bssp"

## Summary of PDB Search
:169
    2e-34  25%  2dhhA  [x.x.x] ACRB[MASQUE : MEMB(X) 253 / COIL(x) 0]
    2e-33  25%  3d9bA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B[MASQUE : MEMB(X) 253
    2e-20  11%  3cuzA  [x.x.x] MALATE SYNTHASE A
    4e-20  10%  2c5mA  [x.x.x] CTP SYNTHASE
    4e-19  10%  3cv2B  [x.x.x] MALATE SYNTHASE A
    3e-09  12%  3cv2A  [x.x.x] MALATE SYNTHASE A
    6e-04  12%  2d9rA  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN
:169

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDYYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNNIGLDQVSNIISSANVNLPTGALYGT
2dhhA           ISDYVAANMKDAISRTSGVGDVQLFGSQ-YAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGT
3d9bA           ---YVAANMKDAISRTSGVGDVQLFGSQ-YAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGT
3cuzA           ---DGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRANIRVA-VQ
2c5mA           TDAIQEWVMRQALIPEPQVCVIELGGTV-GDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQ
3cv2B           NGHDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRANIRVA---
3cv2A           --HDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRAN-------
2d9rA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLKNIGKTIDSVANNKIAAWYRDKPGVILAIQKQPDTTN
2dhhA           PPVKSIIAQTRLTSTEEFKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEFNGQPASGLGIK-LATGAN
3d9bA           PPVKSIIAQTRLTSTEEFKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEFNGQPASGLGIK-LATGAN
3cuzA           YIEAWISGNGCVP----------IYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFRQMLG-EE
2c5mA           KTKPTQNSVRELRGLGLSPDLVVRCSNPLDTSVKEKISMFCHVEPEQV-ICVHDVSSIYRVPLLLEE-QG
3cv2B           ---------VQYIEAWISGNGVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFRQMLG-EE
3cv2A           -----IRVAVQYIEAWISGNGVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFRQMLG-EE
2d9rA           --------------PIEFDAIIRVPDDAAYVEIPFDVKTVYGKGRVRVNATFDGYP-YTGYIVRGLP-CH


                         +         .         .         .         .         *         .:210
query           TIEIVDSIKEVLPLLRRQIPEGININIMF
2dhhA           ALDTAAAIRAELAKMEPFFPSGLKIVYPY
3d9bA           ALDTAAAIRAELAKMEPFFPSGLKIVYPY
3cuzA           MKVIASELGEERFSQGRFDDAAR------
2c5mA           VVDYFLRRL--------------------
3cv2B           MKVIASELGEERFSQGRFDDAAR------
3cv2A           MKVIASELGEERFSQGRFDDAA-------
2d9rA           ILGLRQDIRRAIG----------------