[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rcon0:AAL03110.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d5kA.bssp"
#ERROR : Can't open dsspfile "1ek9A.bssp"

## Summary of PDB Search
:125
    9e-20  31%  3d5kA  [x.x.x] OUTER MEMBRANE PROTEIN OPRM
    8e-17  14%  1ek9A  [f.5.1] OUTER MEMBRANE PROTEIN TOLC
:125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPPLKQQRHEQETTLKILVGRIPENIVNGLIYRNKPIDYFPALPVLPKILPSELLEQRPDIKAAEQNLLA
3d5kA           LAQYTRLVAQDQNALVLLLGSGIPANL-----PQGLGLDQTLLTEVPAGLPSDLLQRRPDILEAEHQLMA
1ek9A           ELTARNNLDNAVEQLRQITGNYYPELA-----ALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDL


                         .         .         *         .         .         .         .:140
query           ADVNLKTIKATYFPQISLTGLLGFGSNKLNTLFTNSAETWQVDGNIAGPIFDFGx
3d5kA           ANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTA--
1ek9A           AREQIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAGQNKVGLSFSLPIYQGG-