[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rcon0:AAL03713.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ahjB.bssp"
#ERROR : Can't open dsspfile "2ahjD.bssp"
#ERROR : Can't open dsspfile "1ahjB.bssp"
#ERROR : Can't open dsspfile "2e87A.bssp"
#ERROR : Can't open dsspfile "3a1tA.bssp"
#ERROR : Can't open dsspfile "3defA.bssp"
#ERROR : Can't open dsspfile "3a1uB.bssp"
#ERROR : Can't open dsspfile "3a1vB.bssp"
#ERROR : Can't open dsspfile "2dbyA.bssp"
#ERROR : Can't open dsspfile "3a1vA.bssp"
#ERROR : Can't open dsspfile "3eg5B.bssp"
#ERROR : Can't open dsspfile "1a2kE.bssp"
#ERROR : Can't open dsspfile "1eftA.bssp"
#ERROR : Can't open dsspfile "2dwqB.bssp"
#ERROR : Can't open dsspfile "1aipA.bssp"
#ERROR : Can't open dsspfile "2clsB.bssp"
#ERROR : Can't open dsspfile "3ddcA.bssp"
#ERROR : Can't open dsspfile "3ea5C.bssp"
#ERROR : Can't open dsspfile "3cwzA.bssp"
#ERROR : Can't open dsspfile "2dwqA.bssp"
#ERROR : Can't open dsspfile "2bnxA.bssp"
#ERROR : Can't open dsspfile "2ce2X.bssp"
#ERROR : Can't open dsspfile "2c5lA.bssp"
#ERROR : Can't open dsspfile "621pA.bssp"
#ERROR : Can't open dsspfile "1e96A.bssp"
#ERROR : Can't open dsspfile "2ahoA.bssp"
#ERROR : Can't open dsspfile "2b7cA.bssp"
#ERROR : Can't open dsspfile "3a1sB.bssp"
#ERROR : Can't open dsspfile "521pA.bssp"
#ERROR : Can't open dsspfile "3bfkB.bssp"
#ERROR : Can't open dsspfile "2atxA.bssp"
#ERROR : Can't open dsspfile "1b23P.bssp"
#ERROR : Can't open dsspfile "1an0B.bssp"
#ERROR : Can't open dsspfile "2cxxB.bssp"
#ERROR : Can't open dsspfile "221pA.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "2cjwA.bssp"
#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "1a2kD.bssp"
#ERROR : Can't open dsspfile "1dpfA.bssp"
#ERROR : Can't open dsspfile "1byuB.bssp"
#ERROR : Can't open dsspfile "3bbpA.bssp"
#ERROR : Can't open dsspfile "3bc1A.bssp"
#ERROR : Can't open dsspfile "2efcB.bssp"
#ERROR : Can't open dsspfile "1cc0A.bssp"
#ERROR : Can't open dsspfile "1ceeA.bssp"
#ERROR : Can't open dsspfile "2c77A.bssp"
#ERROR : Can't open dsspfile "2dykA.bssp"
#ERROR : Can't open dsspfile "1a4rA.bssp"
#ERROR : Can't open dsspfile "1aipE.bssp"
#ERROR : Can't open dsspfile "3doeA.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"
#ERROR : Can't open dsspfile "2bkuA.bssp"
#ERROR : Can't open dsspfile "1d5cA.bssp"
#ERROR : Can't open dsspfile "3bc1E.bssp"
#ERROR : Can't open dsspfile "3bb3A.bssp"
#ERROR : Can't open dsspfile "121pA.bssp"
#ERROR : Can't open dsspfile "1as2A.bssp"
#ERROR : Can't open dsspfile "2bmeB.bssp"
#ERROR : Can't open dsspfile "3a1uA.bssp"
#ERROR : Can't open dsspfile "2dfkD.bssp"
#ERROR : Can't open dsspfile "1bh2A.bssp"
#ERROR : Can't open dsspfile "1egaB.bssp"
#ERROR : Can't open dsspfile "2d74A.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "3bfkE.bssp"
#ERROR : Can't open dsspfile "1an0A.bssp"
#ERROR : Can't open dsspfile "2c2hA.bssp"
#ERROR : Can't open dsspfile "3bfkC.bssp"
#ERROR : Can't open dsspfile "3e5hA.bssp"
#ERROR : Can't open dsspfile "3c5cB.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "3cw2B.bssp"
#ERROR : Can't open dsspfile "1ecrA.bssp"
#ERROR : Can't open dsspfile "1egaA.bssp"
#ERROR : Can't open dsspfile "3c5cD.bssp"
#ERROR : Can't open dsspfile "1cluA.bssp"
#ERROR : Can't open dsspfile "3c5cA.bssp"
#ERROR : Can't open dsspfile "1ajeA.bssp"
#ERROR : Can't open dsspfile "2e9sA.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "3bfkA.bssp"
#ERROR : Can't open dsspfile "1ds6A.bssp"
#ERROR : Can't open dsspfile "2cxxA.bssp"
#ERROR : Can't open dsspfile "3ch5A.bssp"
#ERROR : Can't open dsspfile "2atvA.bssp"
#ERROR : Can't open dsspfile "2bvnB.bssp"
#ERROR : Can't open dsspfile "2b6hA.bssp"
#ERROR : Can't open dsspfile "2a5dA.bssp"
#ERROR : Can't open dsspfile "3ea5A.bssp"
#ERROR : Can't open dsspfile "1doaA.bssp"
#ERROR : Can't open dsspfile "1cf4A.bssp"
#ERROR : Can't open dsspfile "3eg5A.bssp"
#ERROR : Can't open dsspfile "2cxxC.bssp"
#ERROR : Can't open dsspfile "1byuA.bssp"
#ERROR : Can't open dsspfile "2c2hB.bssp"
#ERROR : Can't open dsspfile "1a2bA.bssp"
#ERROR : Can't open dsspfile "2al7A.bssp"
#ERROR : Can't open dsspfile "3bjiD.bssp"
#ERROR : Can't open dsspfile "1e0sA.bssp"
#ERROR : Can't open dsspfile "3a1sA.bssp"
#ERROR : Can't open dsspfile "2dy1A.bssp"
#ERROR : Can't open dsspfile "3bh7A.bssp"
#ERROR : Can't open dsspfile "1cxzA.bssp"
#ERROR : Can't open dsspfile "2efhB.bssp"
#ERROR : Can't open dsspfile "2aseA.bssp"
#ERROR : Can't open dsspfile "2bmdA.bssp"
#ERROR : Can't open dsspfile "2bmeA.bssp"
#ERROR : Can't open dsspfile "1am4D.bssp"
#ERROR : Can't open dsspfile "1as0A.bssp"
#ERROR : Can't open dsspfile "1cipA.bssp"
#ERROR : Can't open dsspfile "1a2kC.bssp"
#ERROR : Can't open dsspfile "2bv3A.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "3bh6A.bssp"
#ERROR : Can't open dsspfile "2bcjQ.bssp"
#ERROR : Can't open dsspfile "2bcgY.bssp"
#ERROR : Can't open dsspfile "3dpuA.bssp"
#ERROR : Can't open dsspfile "2dpxB.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2bmjA.bssp"
#ERROR : Can't open dsspfile "2e1rA.bssp"
#ERROR : Can't open dsspfile "2c78A.bssp"
#ERROR : Can't open dsspfile "2d7cA.bssp"
#ERROR : Can't open dsspfile "2dfkB.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2dcuA.bssp"
#ERROR : Can't open dsspfile "2e9sC.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "2bvnA.bssp"
#ERROR : Can't open dsspfile "2dpxA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"

## Summary of PDB Search
:445
    2e-22   9%  2ahjB  [b.34.4] NITRILE HYDRATASE
    8e-22   9%  2ahjD  [b.34.4] NITRILE HYDRATASE
    5e-21  10%  1ahjB  [b.34.4] NITRILE HYDRATASE (SUBUNIT BETA)
    5e-20  12%  2e87A  [x.x.x] HYPOTHETICAL PROTEIN PH1320
    2e-15  35%  3a1tA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-13  19%  3defA  [x.x.x] T7I23.11 PROTEIN
    8e-13  33%  3a1uB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    4e-11  18%  3a1vB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    4e-11  16%  2dbyA  [x.x.x] GTP-BINDING PROTEIN
    3e-10  19%  3a1vA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-10  10%  3eg5B  [x.x.x] PROTEIN DIAPHANOUS HOMOLOG 1
    2e-09   9%  1a2kE  [c.37.1] RAN
    3e-09  21%  1eftA  [x.x.x] ELONGATION FACTOR TU
    4e-09  16%  2dwqB  [x.x.x] GTP-BINDING PROTEIN
    2e-08  21%  1aipA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    5e-08  15%  2clsB  [x.x.x] RHO-RELATED GTP-BINDING PROTEIN RHO6
    5e-08  27%  3ddcA  [x.x.x] GTPASE HRAS
    7e-08  16%  3ea5C  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    8e-08  15%  3cwzA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    9e-08  18%  2dwqA  [x.x.x] GTP-BINDING PROTEIN
    1e-07  12%  2bnxA  [x.x.x] DIAPHANOUS PROTEIN HOMOLOG 1
    1e-07  25%  2ce2X  [x.x.x] GTPASE HRAS
    1e-07  25%  2c5lA  [c.37.1 (1he8B)] GTPASE HRAS
    2e-07  27%  621pA  [x.x.x] H-RAS P21 PROTEIN
    2e-07  22%  1e96A  [c.37.1] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
    2e-07  11%  2ahoA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    2e-07  16%  2b7cA  [x.x.x] ELONGATION FACTOR 1-ALPHA
    3e-07  24%  3a1sB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-07  22%  521pA  [x.x.x] H-RAS P21 PROTEIN
    3e-07  18%  3bfkB  [x.x.x] SMALL GTPASE RAB11
    4e-07  20%  2atxA  [x.x.x] SMALL GTP BINDING PROTEIN TC10
    4e-07  22%  1b23P  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    4e-07  12%  1an0B  [c.37.1] CDC42HS-GDP
    5e-07  20%  2cxxB  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    7e-07  26%  221pA  [x.x.x] H-RAS P21 PROTEIN
    9e-07   6%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    1e-06  17%  2cjwA  [x.x.x] GTP-BINDING PROTEIN GEM
    1e-06  17%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA
    1e-06  10%  1a2kD  [c.37.1] RAN
    1e-06  18%  1dpfA  [c.37.1] RHOA
    1e-06  10%  1byuB  [c.37.1] PROTEIN (GTP-BINDING PROTEIN RAN)
    2e-06  21%  3bbpA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    2e-06  13%  3bc1A  [x.x.x] RAS-RELATED PROTEIN RAB-27A
    2e-06  15%  2efcB  [x.x.x] SMALL GTP-BINDING PROTEIN-LIKE
    2e-06  25%  1cc0A  [c.37.1] TRANSFORMING PROTEIN RHOA
    2e-06  22%  1ceeA  [c.37.1] GTP-BINDING RHO-LIKE PROTEIN
    2e-06  20%  2c77A  [x.x.x] ELONGATION FACTOR TU-B
    2e-06  24%  2dykA  [x.x.x] GTP-BINDING PROTEIN
    3e-06  14%  1a4rA  [c.37.1] G25K GTP-BINDING PROTEIN
    3e-06  22%  1aipE  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    3e-06  25%  3doeA  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 2
    3e-06  10%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    3e-06  12%  2bkuA  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    3e-06  28%  1d5cA  [c.37.1] RAB6 GTPASE
    4e-06  18%  3bc1E  [x.x.x] RAS-RELATED PROTEIN RAB-27A
    5e-06  11%  3bb3A  [x.x.x] T7I23.11 PROTEIN
    5e-06  27%  121pA  [c.37.1 (1bkdR)] H-RAS P21 PROTEIN
    5e-06  17%  1as2A  [x.x.x] GIA1
    5e-06  25%  2bmeB  [x.x.x] RAS-RELATED PROTEIN RAB4A
    5e-06  39%  3a1uA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    6e-06  20%  2dfkD  [x.x.x] CELL DIVISION CYCLE 42 ISOFORM 1
    6e-06  17%  1bh2A  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN
    6e-06  48%  1egaB  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    6e-06   9%  2d74A  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    7e-06  23%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    9e-06  20%  3bfkE  [x.x.x] SMALL GTPASE RAB11
    9e-06  11%  1an0A  [c.37.1] CDC42HS-GDP
    1e-05  13%  2c2hA  [x.x.x] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 3
    2e-05  20%  3bfkC  [x.x.x] SMALL GTPASE RAB11
    2e-05  19%  3e5hA  [x.x.x] RAS-RELATED PROTEIN RAB-28
    2e-05  20%  3c5cB  [x.x.x] RAS-LIKE PROTEIN 12
    2e-05   8%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    2e-05  25%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    2e-05  13%  3cw2B  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT GAMMA
    2e-05  11%  1ecrA  [e.2.1] PROTEIN (REPLICATION-TERMINATOR PROTEIN)
    2e-05  48%  1egaA  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    2e-05  20%  3c5cD  [x.x.x] RAS-LIKE PROTEIN 12
    2e-05  24%  1cluA  [c.37.1] TRANSFORMING PROTEIN P21/H-RAS-1
    2e-05  20%  3c5cA  [x.x.x] RAS-LIKE PROTEIN 12
    2e-05  20%  1ajeA  [x.x.x] CDC42HS
    2e-05  18%  2e9sA  [x.x.x] RAS-RELATED PROTEIN RAB-6B
    3e-05  33%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    3e-05  17%  3bfkA  [x.x.x] SMALL GTPASE RAB11
    3e-05  16%  1ds6A  [c.37.1] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
    3e-05  26%  2cxxA  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    3e-05  17%  3ch5A  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    4e-05  36%  2atvA  [x.x.x] RAS-LIKE ESTROGEN-REGULATED GROWTH INHIBITOR
    4e-05  26%  2bvnB  [x.x.x] ELONGATION FACTOR TU
    5e-05   7%  2b6hA  [x.x.x] ADP-RIBOSYLATION FACTOR 5
    6e-05  14%  2a5dA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    6e-05  11%  3ea5A  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    7e-05  14%  1doaA  [c.37.1] PROTEIN (GTP-BINDING PROTEIN)
    8e-05  23%  1cf4A  [c.37.1] PROTEIN (CDC42 HOMOLOG)
    8e-05  21%  3eg5A  [x.x.x] CELL DIVISION CONTROL PROTEIN 42 HOMOLOG
    8e-05  32%  2cxxC  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    8e-05  10%  1byuA  [c.37.1] PROTEIN (GTP-BINDING PROTEIN RAN)
    9e-05  16%  2c2hB  [x.x.x] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 3
    9e-05  26%  1a2bA  [x.x.x] TRANSFORMING PROTEIN RHOA
    1e-04  12%  2al7A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE 10C
    1e-04  32%  3bjiD  [x.x.x] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
    1e-04  16%  1e0sA  [c.37.1] ADP-RIBOSYLATION FACTOR 6
    1e-04  39%  3a1sA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-04  20%  2dy1A  [x.x.x] ELONGATION FACTOR G
    2e-04  24%  3bh7A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
    2e-04  24%  1cxzA  [c.37.1] PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-
    2e-04  36%  2efhB  [x.x.x] SMALL GTP-BINDING PROTEIN-LIKE
    2e-04  22%  2aseA  [x.x.x] CELL DIVISION CONTROL PROTEIN 42 HOMOLOG
    3e-04  15%  2bmdA  [x.x.x] RAS-RELATED PROTEIN RAB4A
    3e-04  29%  2bmeA  [x.x.x] RAS-RELATED PROTEIN RAB4A
    3e-04  14%  1am4D  [c.37.1] CDC42HS
    3e-04  17%  1as0A  [x.x.x] GIA1
    3e-04  17%  1cipA  [c.37.1 - a.66.1] PROTEIN (GUANINE NUCLEOTIDE-BINDING PROTEIN
    3e-04  12%  1a2kC  [c.37.1] RAN
    3e-04  13%  2bv3A  [x.x.x] ELONGATION FACTOR G
    3e-04  23%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA
    3e-04  22%  3bh6A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
    4e-04  15%  2bcjQ  [x.x.x] G ALPHA I1, GUANINE NUCLEOTIDE-BINDING PROTEIN
    4e-04  56%  2bcgY  [x.x.x] GTP-BINDING PROTEIN YPT1
    4e-04  10%  3dpuA  [x.x.x] RAB FAMILY PROTEIN
    4e-04  18%  2dpxB  [x.x.x] GTP-BINDING PROTEIN RAD
    4e-04  24%  421pA  [x.x.x] H-RAS P21 PROTEIN
    4e-04  24%  2bmjA  [x.x.x] CENTAURIN GAMMA 1
    4e-04  13%  2e1rA  [x.x.x] ELONGATION FACTOR 2
    5e-04  20%  2c78A  [x.x.x] ELONGATION FACTOR TU-A
    6e-04  24%  2d7cA  [x.x.x] RAS-RELATED PROTEIN RAB-11A
    6e-04  32%  2dfkB  [x.x.x] CELL DIVISION CYCLE 42 ISOFORM 1
    6e-04  26%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    6e-04  17%  1e2nB  [c.37.1] THYMIDINE KINASE
    7e-04  19%  2dcuA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    8e-04  44%  2e9sC  [x.x.x] RAS-RELATED PROTEIN RAB-6B
    8e-04  12%  4dcgA  [x.x.x] VP39
    8e-04  25%  2bvnA  [x.x.x] ELONGATION FACTOR TU
    9e-04  19%  2dpxA  [x.x.x] GTP-BINDING PROTEIN RAD
    0.001  21%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    0.001  13%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
:445

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFKSPG
2ahjB           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
2e87A           -----------------------------------------------------------------FERPT
3a1tA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2clsB           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2bnxA           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1as2A           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
2c2hA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
3c5cD           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
2atvA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
2b6hA           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
1doaA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
2c2hB           ----------------------------------------------------------------------
1a2bA           ----------------------------------------------------------------------
2al7A           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
1as0A           ----------------------------------------------------------------------
1cipA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2bcjQ           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
3dpuA           ----------------------------------------------------------------------
2dpxB           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2e9sC           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
2dpxA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNKFDLTAAEGIADLINAETIMQH
2ahjB           ----------------------------------------LAGVQGFGKVPHTVNADIGPTFHAEWEHLP
2ahjD           ----------------------------------------LAGVQGFGKVPHTVNADIGPTFHAEWEHLP
1ahjB           ------------------------------------------------KVPHTVDADIGPTFHAEWEHLP
2e87A           VLTADELIDKAFRRAEKA----------ASSFKPRGNKVKKARLREELRVRTVSNVVRDNLRKVLERTPG
3a1tA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
3eg5B           ------------------------------------------RSGLRDMHLLSCLESLRVSLTSHPVSWV
1a2kE           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2clsB           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2bnxA           -----------------------------------------------------LRSGLRDMHLLSCLESL
2ce2X           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1as2A           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
2c2hA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
3c5cD           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
2atvA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
2b6hA           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
1doaA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
2c2hB           ----------------------------------------------------------------------
1a2bA           ----------------------------------------------------------------------
2al7A           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
1as0A           ----------------------------------------------------------------------
1cipA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2bcjQ           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
3dpuA           ----------------------------------------------------------------------
2dpxB           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2e9sC           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
2dpxA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KQAIRQASGKLEALYNNWRSQLLKMLSLLEAYIDFPDEDIPDTVLNEVTNTHTILVNTISEYLNDNRKGE
2ahjB           YSLMFAGVAELGAFVDEVRYVVERMEPRHYMMTPYYERYVVATLMVEKGILTQDELESLAGGPFPLSRPS
2ahjD           YSLMFAGVAELGASVDEVRYVVERMEPRHYMMTPYYERYVVATLMVEKGILTQDELESLAGGPFPLSRPS
1ahjB           YSLMFAGVAELGAFVDEVRYVVERMEPRHYMMTPYYERYVVATLMVEKGILTQDELESLAGGPFPLSRPS
2e87A           LSTLDRDTFHKAAGIDWAIRIIRELEERYVERIRYSNDPNEIAELRFYGRVASVLRYLNKAREVLKDLPV
3a1tA           ----------------------------------------------------------------------
3defA           ------------------------------------------------------FPAATQEKLIEFFGKQ
3a1uB           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
3eg5B           QTFGAEGLASLLDILKRLHDEKDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGILLVRAMDPAVPNMMID
1a2kE           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2clsB           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2bnxA           RVSLNNNPSWVQTFGAEGLASLLDILKRLHDEKEETSGNYDSRCLKAFMNNKFGIKTMLETEEVPNMMID
2ce2X           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
2ahoA           ---------------------------------------------------------------------P
2b7cA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3doeA           ------------------------------------------------------------------KKMK
2a5fA           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
3bb3A           ------------------------------------------------------------EWVGFQQFPA
121pA           ----------------------------------------------------------------------
1as2A           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
2c2hA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1ecrA           ---------------------------------------------------------QMEQELAIFAAHL
1egaA           ----------------------------------------------------------------------
3c5cD           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
2atvA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
2b6hA           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
1doaA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
2c2hB           ----------------------------------------------------------------------
1a2bA           ----------------------------------------------------------------------
2al7A           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
1e0sA           --------------------------------------------------------------------GK
3a1sA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
1as0A           ----------------------------------------------------------------------
1cipA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2bcjQ           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
3dpuA           ----------------------------------------------------------------------
2dpxB           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2e1rA           ------------------------------------------------------MVAFTVDQMR--SLMD
2c78A           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2e9sC           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
2dpxA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDI
2ahjB           ESEGRPAPVETTTFEVGQRVRVRDEYVPG---HIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAEP
2ahjD           ESEGRPAPVETTTFEVGQRVRVR---DEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAEP
1ahjB           ESEGRPAPVETTTFEVGQRVRVRDEYVPG---HIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAEP
2e87A           VDLEIPTVVIAGHPNVGKSTLLKALTTAKPEIASYPFTTRGINVGQFEDGYFRYQIIDTPGLLD-RPISE
3a1tA           -----VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSS
3defA           KDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFQAGL-RPVMVSRTMGGFTINIIDTPGLVEAGYVN
3a1uB           -----VKVALAGCPNVGKTSLFNALTGTKQYVAN-----TVEKKEGVFTYKGYTINLIDLPGTYSLGYSS
3a1vB           -----VKVALAGCPNVGKTSLFNALTGTKQYVAN--WPGVTVEKKEVFTYKGYTINLIDLPGTYSLGYSS
2dbyA           -----LAVGIVGLPNVGKSTLPFATIDKNVGVVPLEDERLYALGERVPPVVPTHVEFVDIAGLVKGAH--
3a1vA           -----VKVALAGCPNVGKTSLFNALT-GTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSS
3eg5B           AAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIALKVGCLQLINALITPAEEL
1a2kE           -----FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGL
1eftA           --KPHVNVGTIGHVDHGKTTLVKDYGDIDKAPEERARGITINTAHVEYETAKRHYSHVDCPGHADY----
2dwqB           -----LAVGIVGLPNVGKSTLFNALTRANAL-AKNVGVVPLEDERLYALQRTF-AKGERVPPVVPTHVEF
1aipA           ------NVGTIGHVDHGKTTL--------TAALTYVTAAENPTAHVEYETAKRHYSHVDCPGHADY----
2clsB           -----CKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGS--PYYDN
3ddcA           ------KLVVVGAGGVGKSALTIQLIQNHFVEKYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSA--
3ea5C           -----FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGL
3cwzA           -----FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGLER-FRS
2dwqA           -----LAVGIVGLPNVGKSTLKNVGVVPLEDERLYALQRTFAKGERVPPVVPTHVEFVDIAGLVK--GAH
2bnxA           AAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIALKVGCLQLINALITP----
2ce2X           ------KLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTA---------
2c5lA           ------KLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTA---------
621pA           -----YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEE-----
1e96A           -----IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLED-----
2ahoA           KVQPEVNIGVVGHVDHGKTTLVQAITGIWTSGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDE
2b7cA           --KSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGIT
3a1sB           -----VKVALAGCPNVGKTSLFN-ALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSS
521pA           ------KLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLD--------------
3bfkB           -----FKIVLIGDSGVGKSNLLSRFTRDEFNLESKSTIGVEFATKSIQLKNNKIIKAQIWDTAGQERYRA
2atxA           -----LKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYD-----------
1b23P           -----VNVGTIGHVDHGKTTLVKDYGDIDKAPEERARGITINTAHVEYETAKRHYSHVDCPGHADY----
1an0B           -----IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVIGGEPYTLGLFDTAGQED------
2cxxB           ------TIIFAGRSNVGKSTLIYRLTGKKVRRKIIEIEWKNHKIIDPGFGFGLPKEVQERIKDEI-----
221pA           -----YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEESYRKQVVIDGETCLLDILDTAGQ-------
3cbqA           -----FKVMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVDKEEVTLVVYDIWEQGDAGGW
2cjwA           -----YRVVLIGEQGVGKSTLANIFAGVHDSEVLGEDTYERTLMVDGESATIILLDMWENEWLHD-----
3cb4D           -------------KNIRNFSIIAHISTLSDRIIQICGGQSVTLDYKASDGETYQLNFIDTPGHVD-----
1a2kD           -----FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQ-EKFGG
1dpfA           -----KKLVIVGDVACGKTCLLIVFSKDQFPAVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDR--
1byuB           -----FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGL
3bbpA           -----FKLVFLGEQSVGKTSLITRFMYDSFDNT-YQATIGIDFLSKTMYLEDRTVRLQLWDTAGLERFRS
3bc1A           -----IKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAVGRGQRIHLQLTA
2efcB           -----AKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQ-TLAVNDATVKFEIWDTAGQERYHS
1cc0A           -----KKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED-----
1ceeA           -----IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQ-------
2c77A           -----VNVGTIGHVDHGKTTLVKDYGDIDKAPEERARGITINTAHVEYETAKRHYSHVDCPGHADYIKNM
2dykA           ------KVVIVGRPNVGKSSLFNRLLKKRSDLKEGVVETDRGRFLLVDTGGLWSGDKWEKKIQEKVDRAL
1a4rA           -----IKCVVVGDVAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDR--
1aipE           -----VNVGTIGHVDHGKTTLTAALTYVTAAE---------NPAHVEYETAKRHYSHVDCPGHA------
3doeA           QKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHR-----------------------
2a5fA           -----MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPL-----
2bkuA           -----FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHPLVFHTNRGPIKFN-------------
1d5cA           ------KLVFLGEQAVGKTSIITRFYDTFDNNYQSTIGIDFLSKTLYLDEGPVRLQLWDTAGQE------
3bc1E           -----IKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRAGQRIHLQLWDTAGLERFRS
3bb3A           ATQEKLIEFFGKLKQKDMNSMVNSLIGEQVVRVSPFGLRPVMV---SRTMGGFTINIIDTPGLVEAGYVN
121pA           -----YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSA--
1as2A           -----VKLLLLGAVESGKSTIVKQMKIIHEAGYSEE-ECKQYKAVVYSNTIQSIIAIIRAMG--------
2bmeB           -----FKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKY-----------------
3a1uA           -----VKVALAGCPNVGKTSLFNA-LTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYS-----
2dfkD           -----IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDT----------
1bh2A           -----VKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVV-YSNTIQSIIAIIRAMG--------
1egaB           -----GFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIY-------------
2d74A           -----VNIGMVGHVDHGKTTLTKALTGVWTDTLRRGITIKIGFADAEIRRCSNCGRYSTS----------
2a78A           -----HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLD---------------------
3bfkE           -----FKIVLIGDSGVGKSNLLSRFTRDEFNLGVEFATKSIQLKIIKAQIWDTARAITS-----------
1an0A           -----IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVIGGEPYTLGLFDTAGQEDYDRLRP
2c2hA           ----AIKCVVVGDGAVGKTCLLISYTTNAFPGDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQT
3bfkC           -----FKIVLIGDSGVGKSNLLSRFTRDEFNLESKGVEFATKSIQLKNNKIIKAQIWDTAGITS------
3e5hA           -----LKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNL-----------------
3c5cB           -----VNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSEETVDHQPVHLRVMD-----------
1ckvA           -VHESDTVVLVLKKSDEINTFIE-EILLTDYKKNVNPTVNVEDRAGYWWIKANGKIEVDCDEIS------
1agpA           -----YKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVID---------------------
3cw2B           -----VNIGVVGHVDHGKTTLVQAITGIWTSTIKLGYAETNIGVCESCKKPEAYVTEEPKFLRRISFIDA
1ecrA           EQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDN
1egaA           -----GFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIY-------------
3c5cD           -----VNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSEETVDHQPVHLR--------------
1cluA           -----YKLVVVGAPGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR------
3c5cA           -----VNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSEETVDHQPVHLR--------------
1ajeA           -----IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRL-
2e9sA           -----FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGI-DFLSKTMYLEDRTVRLQLWDTAGQERFRS
3cphA           -----MKILLIGDSGVGKSCLLVRFVEDKFNP--------------------------------------
3bfkA           -----FKIVLIGDSGVGKSNLLSRFTRDEFNLGVEFATKSIQLNNKIIKAQIWDTAITSAYYRG------
1ds6A           -----IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLG--------------
2cxxA           ------TIIFAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRK-----------------------------
3ch5A           -----FKLVLVGDGGTGKTTFVKRHLTGEFEKKY------------------------------------
2atvA           ---AEVKLAIFGRAGVGKSALVVRFLTKRFI---------------------------------------
2bvnB           ------NVGTIGHVDHGKTTLTA-------AITTVLAGITINTSHVEYDTPTRHYAHVDCPGHADY----
2b6hA           -----MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGRPLWRHYFQNTQG
2a5dA           -----MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYK-----------------------
3ea5A           -----FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWD-TAGQEKFGG
1doaA           -----IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDT--AGQEDYDR
1cf4A           -----IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG--------
3eg5A           -----IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVF-------------------------------
2cxxC           ------TIIFAGRSNVGKSTLIYRLTGKKVRGVT------------------------------------
1byuA           -----FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHP-LVFHTNRGPIKFNVWDTAGQEKFGG
2c2hB           -----IKCVVVGDGAVGKTCLLISYTTNAFPGEYIDNYSANVMVDGKPVNLGLWDTAGQEDYD-------
1a2bA           -----KKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVF-------------------------------
2al7A           --KEEMELTLVGLQYSGKTTFVNVIAVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYC----------
3bjiD           ----AIKCVVVGDGAVGKTCLLISYT--------------------------------------------
1e0sA           VLSKIFRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYK-----------------------
3a1sA           -----VKVALAGCPNVGKTSLFNALT-GTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGY--
2dy1A           -----RTVALVGHAGSGKTTLTEALLYKTGAKTTDYTPEAKLHRTTPLLFRGHRVFLLDAPGYGDF----
3bh7A           -----VRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQ-----------------------
1cxzA           -----KKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVFENYV---------------------------
2efhB           -----AKLVLLGDVGAGKSSLVLRFVA-------------------------------------------
2aseA           -----IKCVVVGDGAVGKTCLLISYTTNKLPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQED-----
2bmdA           -----FKFLVIGNAGTGKSCLLHQFIEKKFKEFGSKIINVGGKYVKLQIWDTAGQERFRS----------
2bmeA           -----FKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIG-------------------------------
1am4D           -----IKCVVVGDGAVGKTCLLISYTTNKFYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD------
1as0A           -----VKLLLLGAVESGKSTIVKQMKIIHEAGYSEEECKQYKAVV-YSNTIQSIIAIIRAMG--------
1cipA           -----VKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVV-YSNTIQSIIAIIRAMGRLK-----
1a2kC           -----FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVW--------DTA
2bv3A           -----RNIGIAAHIDAGKTTTTERIL--YYTGRIHKRGITITAAVTTCFWKDHRINIIDA----------
3degC           -MKNIRNFSIIAHIDHGKSTLSDRIIQICGGL--------------------------------------
3bh6A           -----VRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDI--------------
2bcjQ           -----LKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLV-YQNIFTAMQAMIRAMDTLK-----
2bcgY           -----FKLLLIGNSGVGKSCLLL-----------------------------------------------
3dpuA           -----YFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTNIKGLENDDELKECLFHFWDFGGQEI-----
2dpxB           ------KVLLLGAPGVGKSALARIFGGVEHTYDRSIVVDGEEASLMVYDIWMGDAYVIVYSVTDKGSFEK
421pA           ----EYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVID---------------------
2bmjA           -----LRLGVLGDARSGKSSLIHRFLTGSYQVLEKTES--------------------------------
2e1rA           KVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAAKERGITIKSTAISLYSEMSDEDVKEIKQK------
2c78A           -----VNVGTIGHVDHGKTTLVKDYGDIDKAPEERARGITINTAHVEYETAKRHYSHVDCPGHADYIKNM
2d7cA           -----FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDG-------------------
2dfkB           -----IKCVVVGDGAVGKTCLLISYTT-------------------------------------------
1ek0A           -----IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFL---------------------------
1e2nB           -MPTLLRVYIDGPHGMGKTTTTQLLVAL---GSRDDIVYVPEPMTYWRVLGASETI--------------
2dcuA           -----VNIGMVGHVDHGKTTLTKALTGVWTDT--------------------------------------
2e9sC           -----FKLVFLGEQSVGKTSLIT-----------------------------------------------
4dcgA           ---GILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRH-------------------------
2bvnA           -------VGTIGHVDHGKTTLT-------AAITTVLAGITINTSHVEYDTPTRHYAHVDCPGHADYVKNM
2dpxA           -----YKVLLLGAPGVGKSALARIFGGVEHTYDRSIVVDGEEASLMVYDIWLPGHCMAMGDAY-------
3c14C           ---ATHRLLLLGAGESGKSTIVKQMRI-------------------------------------------
3cddC           -------LKAGGKIYQGWTKIGITRSLEASGAFD----LETYKFQYKAFIEPIKQGQACTVDIGGE----


                         .         *         .         .         .         .         +:350
query           IEQEGIKRAINSAKTADIKIIMFDAEKLDSSXXXXXXXXXXXXXXXXXXKIDLIEASKIFSIENKYKCLR
2ahjB           TYHVKFAAEELFGSDTDGGSVVVDL---------------------------------------------
2ahjD           TYHVKFAAEELFGSDTDGGSVVVDL---------------------------------------------
1ahjB           TYHVKFAAEELFGSDTDGGSVVVDL---------------------------------------------
2e87A           RNEIEKQAILALRYLGNLIIYIFDPSEHCGFFEEVHGEFKDLPFLVVINKIDVADEENIKRLEKGLNPIK
3a1tA           ID-EKIARDYLLKGDADLVILVADSVNPE-----------------------------------------
3defA           HQALELIKGFLVNRTIDVLLYVDRL---------------------------------------------
3a1uB           ID-EKIARDYLLKGDADLVILVADSVNPE-----------------------------------------
3a1vB           ID-EKIARDYLLKGDADLVILVADSVNPEQSYLLLEILEMEKKVILAMTKKTGMKIDYELQKHLGIPVVF
2dbyA           KGEGLGNQFLAHIREVAAIAHVLRCFPDP-----------------------------------------
3a1vA           IDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQVVF
3eg5B           DFRVHIRSELMRLGLHQVLQELREIE--------------------------------------------
1a2kE           RDG--YYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKFHRKKNLQYYD
1eftA           -----IKNMITGAAQMDGAILVVSA---------------------------------------------
2dwqB           VDIAGVNQFLAHIREVAAIAHVLRC---------------------------------------------
1aipA           -----IKNMITGAAQMDGAILVVSA---------------------------------------------
2clsB           VRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAP
3ddcA           ----------------------------------------------------------------------
3ea5C           RDG--------YYIQAQCAIIMFDV---------------------------------------------
3cwzA           LIPSYIRDS-------------------------------------------------------------
2dwqA           KGEGLGNQFLAHIREVAAIAHVLRC---------------------------------------------
2bnxA           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
2ahoA           PKFLRRISFIDAPGHEVLMATM------------------------------------------------
2b7cA           -----IDIALWKFETPKYQVTVID----------------------------------------------
3a1sB           ID-EKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEEKKVILATAIDEAKKTGKILQKHLGIPVVF
521pA           ----------------------------------------------------------------------
3bfkB           ITSAYYRGAVGALLVYDITKKNSFENIEK-----------------------------------------
2atxA           ----------------------------------------------------------------------
1b23P           -----IKNMITGAAQMDGAILVVSA---------------------------------------------
1an0B           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
3cbqA           LRDHCLQTGVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIE
2cjwA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
1a2kD           LRDGYYIQAQCAIIMFDV-TSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKFHRKKNLQYYD
1dpfA           ARPLSYPDTDVILMCFSIDSPDSL----------------------------------------------
1byuB           -----RDGYYIQAQCAIIMFDVTSRKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSKKNLQYYD
3bbpA           LIPSYIRDSTVAVVVYDI----------------------------------------------------
3bc1A           GLERFRSLTTAFFRDAMGFLLLFDLTNEQS----------------------------------------
2efcB           LAPMYYRGAAAAIIVFDV----------------------------------------------------
1cc0A           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
2c77A           ITG---------AAQMDGAILVVSA---------------------------------------------
2dykA           EDAEVV----------------------------------------------------------------
1a4rA           LRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQ--
1aipE           ---DYIKNMITGAAQMDGAILVVSA---------------------------------------------
3doeA           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3bc1E           LTTAFFRDA-------------------------------------------------------------
3bb3A           HQALELIKGFLVNRTIDVLLYVDRLDVYRVAITQTFGKEIWCKTLLVLTHAQFSPPDELSFSSKRSDSLL
121pA           ----------------------------------------------------------------------
1as2A           --RLKI-DFGDAARADDARQLFV-----------------------------------------------
2bmeB           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
1bh2A           --RLKI-DFGDAARADDARQLFV-----------------------------------------------
1egaB           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
1an0A           LSYPQTDVFLVCFSVVSPSSFENVKEK---WVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKP
2c2hA           D-VFLICFSLVSPASFENVRAKWYP---------------------------------------------
3bfkC           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3cw2B           PGHELMATMLSGAALMDGAILVVAA---------------------------------------------
1ecrA           LSQALVSHIQHINKLKTTFEHIVTV---------------------------------------------
1egaA           ----------------------------------------------------------------------
3c5cD           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
2e9sA           LIPSYIRDSTVAVVVYDITNLNSFQQ--------------------------------------------
3cphA           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
2atvA           ----------------------------------------------------------------------
2bvnB           -----VKNMITGAAQMDGAILVVAA---------------------------------------------
2b6hA           LIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQA
2a5dA           ----------------------------------------------------------------------
3ea5A           LRDGYYIQAQCAIIMFD-----------------------------------------------------
1doaA           LRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQ--
1cf4A           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
1byuA           LRDGYYIQAQCAIIMFDV-TSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKFHRKKNLQYYD
2c2hB           ----------------------------------------------------------------------
1a2bA           ----------------------------------------------------------------------
2al7A           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
2dy1A           -----VGEIRGALEAADAALVAVSAE--------------------------------------------
3bh7A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
1as0A           --RLKI-DFGDAARADDARQLF------------------------------------------------
1cipA           ----------------------------------------------------------------------
1a2kC           GQEKFGGLRDGYYIQAQCAIIMFDVTSRVTWHRDLVRVCENIPIVLCGNKVDIKDRKVKFHRKKNLQYYD
2bv3A           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2bcjQ           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
3dpuA           ----------------------------------------------------------------------
2dpxB           ASE-------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
2c78A           ITG---------AAQMDGAILVVSA---------------------------------------------
2d7cA           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2e9sC           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
2bvnA           I---------------------------------------------------------------------
2dpxA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VSVKNNIALSSILKNIENIAENMAGFTETPYITNQRHRNYLQQALSHLTAFSLDNDLVLATEDIxxxxxx
2ahjB           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
2e87A           ISALKGTGIDLVKEEIIKTLRPLAEKVAREKIERELRR--------------------------------
3a1tA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3a1vB           TSSVTGEGLEELKEKIVEYAQKNTILHRMILDYGEKVESEIKK---------------------------
2dbyA           ----------------------------------------------------------------------
3a1vA           TSSVTGEGLEELKEKIVEYAQKNTHRMILDYGEKVESE--------------------------------
3eg5B           ----------------------------------------------------------------------
1a2kE           ISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPAL-------------------------
1eftA           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2clsB           ISYEQGCAIAKQLGAEI--------YLEGSAFTSEKSIHSIFRTASM-----------------------
3ddcA           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2bnxA           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
3a1sB           TSSVTGEGLEELKEKIVEYAQKNTILHILDY---------------------------------------
521pA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
3cbqA           TSAALHHNTRELFEGAVRQIRL------------------------------------------------
2cjwA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
1a2kD           ISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPAL-------------------------
1dpfA           ----------------------------------------------------------------------
1byuB           ISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDE------
3bbpA           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
3bb3A           KTIRAGSKMRKQEFEDSAIAVVYAENSGRC-SKNDKDEKALPNGEAWIPNLAITDVATNQRKAI------
121pA           ----------------------------------------------------------------------
1as2A           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
1an0A           ITPETAEKLARDLKAVK-----------------------------------------------------
2c2hA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
3c5cD           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
2atvA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
2b6hA           TCATQGTGLYDGLDWLSHELSK------------------------------------------------
2a5dA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
1doaA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
1byuA           ISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPAL-------------------------
2c2hB           ----------------------------------------------------------------------
1a2bA           ----------------------------------------------------------------------
2al7A           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
1as0A           ----------------------------------------------------------------------
1cipA           ----------------------------------------------------------------------
1a2kC           ISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPAL-------------------------
2bv3A           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2bcjQ           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
3dpuA           ----------------------------------------------------------------------
2dpxB           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2e9sC           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
2dpxA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxx
2ahjB           -------------------------
2ahjD           -------------------------
1ahjB           -------------------------
2e87A           -------------------------
3a1tA           -------------------------
3defA           -------------------------
3a1uB           -------------------------
3a1vB           -------------------------
2dbyA           -------------------------
3a1vA           -------------------------
3eg5B           -------------------------
1a2kE           -------------------------
1eftA           -------------------------
2dwqB           -------------------------
1aipA           -------------------------
2clsB           -------------------------
3ddcA           -------------------------
3ea5C           -------------------------
3cwzA           -------------------------
2dwqA           -------------------------
2bnxA           -------------------------
2ce2X           -------------------------
2c5lA           -------------------------
621pA           -------------------------
1e96A           -------------------------
2ahoA           -------------------------
2b7cA           -------------------------
3a1sB           -------------------------
521pA           -------------------------
3bfkB           -------------------------
2atxA           -------------------------
1b23P           -------------------------
1an0B           -------------------------
2cxxB           -------------------------
221pA           -------------------------
3cbqA           -------------------------
2cjwA           -------------------------
3cb4D           -------------------------
1a2kD           -------------------------
1dpfA           -------------------------
1byuB           -------------------------
3bbpA           -------------------------
3bc1A           -------------------------
2efcB           -------------------------
1cc0A           -------------------------
1ceeA           -------------------------
2c77A           -------------------------
2dykA           -------------------------
1a4rA           -------------------------
1aipE           -------------------------
3doeA           -------------------------
2a5fA           -------------------------
2bkuA           -------------------------
1d5cA           -------------------------
3bc1E           -------------------------
3bb3A           -------------------------
121pA           -------------------------
1as2A           -------------------------
2bmeB           -------------------------
3a1uA           -------------------------
2dfkD           -------------------------
1bh2A           -------------------------
1egaB           -------------------------
2d74A           -------------------------
2a78A           -------------------------
3bfkE           -------------------------
1an0A           -------------------------
2c2hA           -------------------------
3bfkC           -------------------------
3e5hA           -------------------------
3c5cB           -------------------------
1ckvA           -------------------------
1agpA           -------------------------
3cw2B           -------------------------
1ecrA           -------------------------
1egaA           -------------------------
3c5cD           -------------------------
1cluA           -------------------------
3c5cA           -------------------------
1ajeA           -------------------------
2e9sA           -------------------------
3cphA           -------------------------
3bfkA           -------------------------
1ds6A           -------------------------
2cxxA           -------------------------
3ch5A           -------------------------
2atvA           -------------------------
2bvnB           -------------------------
2b6hA           -------------------------
2a5dA           -------------------------
3ea5A           -------------------------
1doaA           -------------------------
1cf4A           -------------------------
3eg5A           -------------------------
2cxxC           -------------------------
1byuA           -------------------------
2c2hB           -------------------------
1a2bA           -------------------------
2al7A           -------------------------
3bjiD           -------------------------
1e0sA           -------------------------
3a1sA           -------------------------
2dy1A           -------------------------
3bh7A           -------------------------
1cxzA           -------------------------
2efhB           -------------------------
2aseA           -------------------------
2bmdA           -------------------------
2bmeA           -------------------------
1am4D           -------------------------
1as0A           -------------------------
1cipA           -------------------------
1a2kC           -------------------------
2bv3A           -------------------------
3degC           -------------------------
3bh6A           -------------------------
2bcjQ           -------------------------
2bcgY           -------------------------
3dpuA           -------------------------
2dpxB           -------------------------
421pA           -------------------------
2bmjA           -------------------------
2e1rA           -------------------------
2c78A           -------------------------
2d7cA           -------------------------
2dfkB           -------------------------
1ek0A           -------------------------
1e2nB           -------------------------
2dcuA           -------------------------
2e9sC           -------------------------
4dcgA           -------------------------
2bvnA           -------------------------
2dpxA           -------------------------
3c14C           -------------------------
3cddC           -------------------------