[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rcon0:AAL03749.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e0dA.bssp"
#ERROR : Can't open dsspfile "3c94A.bssp"
#ERROR : Can't open dsspfile "1d2tA.bssp"
#ERROR : Can't open dsspfile "2anuE.bssp"
#ERROR : Can't open dsspfile "2anuD.bssp"
#ERROR : Can't open dsspfile "3dcpB.bssp"
#ERROR : Can't open dsspfile "2anuF.bssp"
#ERROR : Can't open dsspfile "2anuA.bssp"
#ERROR : Can't open dsspfile "2anuB.bssp"
#ERROR : Can't open dsspfile "2anuC.bssp"
#ERROR : Can't open dsspfile "3dcpC.bssp"
#ERROR : Can't open dsspfile "2a8lA.bssp"
#ERROR : Can't open dsspfile "41biA.bssp"
#ERROR : Can't open dsspfile "3dcpA.bssp"
#ERROR : Can't open dsspfile "3e0fA.bssp"
#ERROR : Can't open dsspfile "2c57B.bssp"
#ERROR : Can't open dsspfile "2eduA.bssp"

## Summary of PDB Search
:1181
      0.0  37%  3e0dA  [x.x.x] DNA POLYMERASE III SUBUNIT ALPHA
    3e-27   8%  3c94A  [x.x.x] EXODEOXYRIBONUCLEASE I
    1e-25  10%  1d2tA  [a.111.1] ACID PHOSPHATASE
    1e-20  10%  2anuE  [x.x.x] HYPOTHETICAL PROTEIN TM0559
    6e-19   7%  2anuD  [x.x.x] HYPOTHETICAL PROTEIN TM0559
    2e-18  12%  3dcpB  [x.x.x] HISTIDINOL-PHOSPHATASE
    3e-18  12%  2anuF  [x.x.x] HYPOTHETICAL PROTEIN TM0559
    5e-18  10%  2anuA  [x.x.x] HYPOTHETICAL PROTEIN TM0559
    7e-17   9%  2anuB  [x.x.x] HYPOTHETICAL PROTEIN TM0559
    8e-16  11%  2anuC  [x.x.x] HYPOTHETICAL PROTEIN TM0559
    3e-15  13%  3dcpC  [x.x.x] HISTIDINOL-PHOSPHATASE
    3e-15  10%  2a8lA  [x.x.x] THREONINE ASPARTASE 1
    7e-15  15%  41biA  [x.x.x] INTERLEUKIN-1 BETA
    5e-12  10%  3dcpA  [x.x.x] HISTIDINOL-PHOSPHATASE
    1e-10  12%  3e0fA  [x.x.x] PUTATIVE METAL-DEPENDENT PHOSPHOESTERASE
    3e-05  16%  2c57B  [x.x.x] 3-DEHYDROQUINATE DEHYDRATASE
    3e-05  21%  2eduA  [x.x.x] KINESIN-LIKE PROTEIN KIF22
:1181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKGLQPIHGVILN
3e0dA           ----FAHLHQHTQFSLLNGAAKLQDLLKWVKETEDPALAMTDHGNLFGAVEFYKKATAMGVKPIIGYEAY
3c94A           --------------------------------------------AMAKLVKTRQPRLFDYLFTHRNKHKL
1d2tA           ----------------------------------------------------------------------
2anuE           -EWLLCDFHVHTNSD---GHLPLGEVVDLFGKHGVDVVSITDHIVDRRTLEQRKRNGEPLGAITEDKFQD
2anuD           -EWLLCDFHVHTNSD---GHLPLGEVVDLFGKHGVDVVSITDHIVDRRTLEQRKRNGEPLGAITEDKEQK
3dcpB           -----RDGHTHTEFC-PHGTHDDVEEVLKAIELDFDEYSIVEHAPLSSEFKNTAGDKEAVTTASSDLLIH
2anuF           -EWLLCDFHVHTNSD---GHLPLGEVVDLFGKHGVDVVSITDHIVDRRTLEQRKRNGEPLGAITEDKFQD
2anuA           -EWLLCDFHVHTNSDG---HLPLGEVVDLFGKHGVDVVSITDHIVDRRTLEQRKRNGEPLGAITEDKFQD
2anuB           -EWLLCDFHVHTNSD---GHLPLGEVVDLFGKHGVDVVSITDHIVDRRTLEQRKRNGEPLGAITEDKFQD
2anuC           -EWLLCDFHVHTNSD---GHLPLGEVVDLFGKHGVDVVSITDHIVDRRTLEQRKRNGEPLGAITEDKFQD
3dcpC           -----RDGHTHTEFC-PHGTHDDVEEVLKAIELDFDEYSIVEHAPLSSEFKNTAGDKEAVTTASASDLPY
2a8lA           ------RLLCEGQKGGRIPPCFLVGEYRWAVDHGIPAVVVDHEGNVAAAVSALKHPGRVGQAALTAVSTS
41biA           ----------------------------------------------------------------------
3dcpA           -----RDGHTHTEFC-PHGTHDDVEEVLKAIELDFDEYSIVEHAPLSSEFKNTAGDKEAVTTASSDLLIH
3e0fA           PPAQGWDIHCHTVFS--DGTETPRTLVEQARKLGLHGVAIADHDTTAGWDEATEASEEIGLPLLLGTEIT
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVGKCL
3e0dA           VAAESRFYFHLTLLAKDFTGYQNLVRLASRAYLEGFYEKP-RIDREILREHAQGLIALSGCLGAEIPQFI
3c94A           MALIDVPQMKPLVHVSGMFGAWRGNTSWVAPLAWHPENRN-AVIMVDLAGDISPLLEL---DSDTLRERL
1d2tA           ----------------------------------------------------------------------
2anuE           YLKRLW------REQKRAWEEYGILIPGVEITNNTDLYHIVAVDVKEYVDPSLPVEEIV--------EKL
2anuD           RAWEEYGILIPGVEITNNTDLYHIVAVDVKEYVDPSLPVEEIV-EKLKEQNALVIAA-------------
3dcpB           IGFEVDYLIGYEDFTRDFLGGFRSIDFSAEDYNEG-IVQFYGGFEQAQLAYLEGVKQSIEADLGLFFGED
2anuF           YLKRLWREQKGILIPGVEITNNTDLYHI-------------------VAVDVKEYVDPSLPVEEIV-EKL
2anuA           YLKRLWREYGILIPGVEITNNTDLYHIVAVDVKEYVDPSL-PVEEIVEKLKEQNALVIAAHPDRKKL---
2anuB           EQKRAWEEYGILIPGVEITNNTDLYHIVA-VDVKEYVDPSLPVEEIVEKLKEQNAL------------VI
2anuC           YLKRLWREQKRAWE-----EYGILIPGVEITNNTDLYHIVAV-DVKEYVDPSLPVEEIVEKLKEQNALVI
3dcpC           YFKKNHIKKKLLIHFLEGQGGFRSIDFSAEDYNEGIVQFY-GGFEQAQLAYLEGVKQSIEADLGLFFGED
2a8lA           GCGEHLVRTILARECSHALQAEDAHQALLETMQN---KFISSPFLASEDGVLGGVIVLRSCLLVEFLWSH
41biA           ----------------------------------------------------------------------
3dcpA           IGFEVDYLIGYEDFTRDFLGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGVKQSIEADLGLFKFGED
3e0fA           AVDEDVSVHLISSFANTRAARLRRTKRVERLSQDFPITWDDVLAQVKEGERTTIGRPHIADALVAAGVYE
2c57B           -----------------------------------------------LDQIHEIMQTFVKQGNLDVELEF
2eduA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LARNEEQAMLFARKLQEILGDRFYFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAH
3e0dA           LQDRLDLAEARLNEDLSIFGDRFFIEIQNHGLPEQKKVNQVLKEFARKYGLGMVATNNGHYVRKEDARAH
3c94A           YTAKTD----LNAAVPVKLHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKILRENPQVREKVVAIFA
1d2tA           ----------------------------------------------------------------------
2anuE           KEQNALVIAAHPDRKHLSWYLWANERFKDTFDAWEIANRDDLFNSVGVKKYRYVANSDFHELWKSEKNIE
2anuD           -------------HPDRKWYLWANERFKDTFDAWEIANRDDLFNSVGVKKYRYVANSDFHELWH-VYSWK
3dcpB           TSDFSEEVEKFRVILALVKKRDYELDFNTAPLCGETYPPKKIVTLASELQIPFVYGSDSHGVQ--DIGRG
2anuF           KEQNALVIAAHPDRKHLSWYLWANERFKDTFDAWEIANRDDLFNSVGVKKYRYVANSDFHELWKSEKNIE
2anuA           -----------------SWYLWANERFKDTFDAWEIANRDDLFNSVGVKKYRYVANSDFHELWKSEKNIE
2anuB           AA-----------HPDRKWYLWANERFKDTFDAWEIANRDDLFNSVGVKKYRYVANSDFHELWHVYSWKT
2anuC           AAH-PDRKKSWYLWANERFKDTFDA--------WEIANRDDLFNSVGVKKYRYVANSDFHELWKSEKNIE
3dcpC           TSDFSEEVEKFRVILALVKKRDYELDFLFKPLCGETYPPKKIVTLASELQIPFVYGS----------DSH
2a8lA           TTESMCVGYMSAQDGKAKTH-ISRLPPG-AVAGQSVAIEGGVCRL-------------------------
41biA           ----------------------------------------------------------------------
3dcpA           TSDFSEEVEKFRVILALVKKRDYELDFLFKPLCGETYPPKKIVTLASELQIPFVYGSDSHGVQDIGRGYS
3e0fA           TRSDAFADAVSAK-------SKYYIPTPSPSTHEVI----AAVKGAGGVVVAAHAGDPQRNRRLLSDEQL
2c57B           FQTNFEGEII--DKIQESVGSDYEGIIIN---PGAFSHTSIAIADAMLAGKPVIEVHLTNIQAREEFRKN
2eduA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DVLLCISAGVTKEYLDRKTVSENCYFKSPHEMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATE
3e0dA           EVLLAIQSKTTLDDPERRFPCDEFYVKTPEEMRAMLPEAEWPFDNTVEIARMCDVDLPIGDKMVYRIFPL
3c94A           SDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLFNYRARNFPGTLDY--------
1d2tA           ----------------------------------------------------------------------
2anuE           AIKEAIRKNTDVAIYLR-----------------------------------------------------
2anuD           TLVKSEKNIEAIKEAIRKNTDVAIYLR-------------------------------------------
3dcpB           YSTYC-----------------------------------------------------------------
2anuF           AIKEAIRKNTDVAIYLRK----------------------------------------------------
2anuA           AIKEAIRKNTDVAIYLRK----------------------------------------------------
2anuB           LVKSEKNI--------------------------------------------------------------
2anuC           AIKEAIRKNTD-----------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           ----------------------------------------------------------------------
3dcpA           TYCQKL----------------------------------------------------------------
3e0fA           DAIADGLDGLEVLTIAARLVTGGSDWHGKGKPNGLDDTVREILCRGVDLIGR------------------
2c57B           SYTGAACGGV------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NISETDLIKKDAKEGLLARLATKFKSENIALENQEALKTEYFARLNYELDIICNMNFAGYFLIVSDFIKW
3e0dA           GRTEAQYLRELTFLGLLRRYPDRITEAFYELRKREWTAEAILHRALYELSVIERMGFPGYFLIVQDYINW
3c94A           --------------------------------------AEQQRWLEHRRQVFTPEFLQGYADELQMLVQQ
1d2tA           ----------------------------------------------------------------------
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           ----------------------------------------------------------------------
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS
3e0dA           ARGHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRERDRVIQYVRE
3c94A           YAD-------------------------------------------------------------------
1d2tA           ----------------------------------------------------------------------
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           ----------------------------------------------------------------------
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREVPELANAAKGN
3e0dA           RYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKPLQEAFEAEPELRAEMEKD
3c94A           ----------------------------------------------------------------------
1d2tA           ----------------------------------------------------------------------
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           ----------------------------------------------------------------------
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA
3e0dA           ---------ERIRQVIEVAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMRDQE-GRPVTQYDMGAVEAL
3c94A           ----------------------------------------------------------------------
1d2tA           ----------------------------------------------------------------------
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           -----------------------------------LVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEES
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLK
3e0dA           GLLKMDFLGLRTLTFLDEARRIVKEKGVELDYDRLPLDDPKTFELLSRGETKGVFQLESGGMTATVRGLK
3c94A           ----------------------------------------------------------------------
1d2tA           ------------------------------------------------------------NDTTTKPDLY
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           NDKIPVALGLKEKNLYLSCVLKDDKQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTS
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLQPILEETYGVVIYQEQVQRIAQVLAGYT
3e0dA           PRRLEDIIALVSLYRPGPMEHIPTYIRRHHGQEPVSYAEKYLRPILDETYGIPVYQEQIMQIASQVAGYS
3c94A           ----------------------------------------------------------------------
1d2tA           YLKNSEAINSLALLPPPPAVLLRNTERGKLAAEDANLSSGGVANAFSGAFGSPITEKDAPALHKLLTNMI
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           QA--------------------------------------------------------------------
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LGAADLLRRAMGXXXXXXXXXXXXXXXXGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQT
3e0dA           LGEADLLRRAMGKKRVEEMQKHRERFVRGAKERGVPEEEANRLFDMLEAFANYGFNKSHAAAYSLLSYQT
3c94A           ----------------------------------------------------------------------
1d2tA           EDAGDLATRSAKDHYMRI--------------RPFAFYGVSTCNTQDKLSKNGSYPSGHTSGWATALVLA
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           ----------------------------------------------------------------------
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           AYLKANYPAAFLVACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKFSDTVIPHSVKPVIP
3e0dA           AYVKAHYPVEFMAALLSVERHDSDKVAEYIRDARALGIPVLPPDVNRSGFDFKVV-GEEILF--------
3c94A           ----------------------------------------------------------------------
1d2tA           EINPQRQNEILKRGYE------------------------------------------------------
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           ----------------------------------------------------------------------
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           RLDRGIQKISKDTVVKPRCDXXXXXXXXXXXXXXVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINS
3e0dA           ----GLSAVK-----------------------NVGEMAARAILEERERGGPFKSLGDFLKRLPEQVVNK
3c94A           ----------------------------------------------------------------------
1d2tA           ----------------------------------------------------------------------
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           ----------------------------------------------------------------------
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------IGPKKAQLIVGWRELHGPFSQVEDLERV---EGITG


                         .         .         .         +         .         .         .:980
query           KLLENLIKSGCFDELHDNRLQLLSSIPKLLSYSTAYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLA
3e0dA           RALESLVKAGALDAFG-DRARLLASLEPLLRWAAETRERGRSGLVGLFAEVE-EPPLVEASPLDEITMLR
3c94A           ----------------------------------------------------------------------
1d2tA           ----------------------------------------------------------------------
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           ----------------------------------------------------------------------
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           KQMESFLKANILGLA-------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           FYEFEAMGLFISNHPLTEYQEIFSRLNILNTADLHNNLPDGTNRVNLAGVIQKKDSRMSARGRFVTLVLS
3e0dA           -YEKEALGIYVSGHPVLRYPGLVASCTIEELSEFVRELP-GKPKVLLSGMVEEVRFTLSDETGALEVVKE
3c94A           ----------------------------------------------------------------------
1d2tA           ----------------------------------------------------------------------
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           ----------------------------------------------------------------------
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           Dxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e0dA           D---------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1d2tA           ----------------------------------------------------------------------
2anuE           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3dcpB           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2anuA           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2anuC           ----------------------------------------------------------------------
3dcpC           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------
41biA           ----------------------------------------------------------------------
3dcpA           ----------------------------------------------------------------------
3e0fA           ----------------------------------------------------------------------
2c57B           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e0dA           -------------------------------------------------------------
3c94A           -------------------------------------------------------------
1d2tA           -------------------------------------------------------------
2anuE           -------------------------------------------------------------
2anuD           -------------------------------------------------------------
3dcpB           -------------------------------------------------------------
2anuF           -------------------------------------------------------------
2anuA           -------------------------------------------------------------
2anuB           -------------------------------------------------------------
2anuC           -------------------------------------------------------------
3dcpC           -------------------------------------------------------------
2a8lA           -------------------------------------------------------------
41biA           -------------------------------------------------------------
3dcpA           -------------------------------------------------------------
3e0fA           -------------------------------------------------------------
2c57B           -------------------------------------------------------------
2eduA           -------------------------------------------------------------