[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rcon0:AAL02981.1

[Show Plain Result]


## Summary of Sequence Search
    1::103
    2::98      3e-15  51%  107 aa  PF01491 Frataxin_Cyay "Frataxin-like domain"
    1::103

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
PF01491         --DSEFHKLADETLDSIEEKLEEEEGDADIDVEYSGGVLTLTFENGTYVINKQPPNKQIWLSSPISGPKR


                         .         .         *         .         .         .         .:140
query           FFYEQGEWTNRAGLELMAILTEELNxxxxxxxx
PF01491         FDYDDGKWITRSGEELFELLEEELS--------