[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rcon0:AAL03106.1

[Show Plain Result]


## Summary of Sequence Search
    1::169
  154::318     5e-25  28% 1014 aa  PF00873 ACR_tran "AcrB/AcrD/AcrF family"
    1::169

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNNIGLDQVSNIISSANVNLPTGALYGT
PF00873         ---YADWNLRDELERVPGVGEVDIFGGREREIRVELDPDKLAAYGLTLADVANALRAQNVNVPAGSIEGG


                         .         .         *         .         .         .         .:140
query           DIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLKNIGKTIDSVANNKIAAWYRDKPGVILAIQKQPDTTN
PF00873         GQEYLVRANGRLKSAEDLENIVVKNRDGRPVRLGDVATVEDGPEDRRGIARFNGKPAVGLAVAKRPG-AN


                         +         .         .         .         .         *         .:210
query           TIEIVDSIKEVLPLLRRQIPEGININIMF
PF00873         ALEVADAVKAKLEELQASLPAGVEITVTY