[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rcon0:AAL03110.1

[Show Plain Result]


## Summary of Sequence Search
    1::125
    8::81      7e-06  31%  189 aa  PF02321 OEP "Outer membrane efflux protein"
    1::125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEQRPDIKAAEQNLLA
PF02321         ------------------------------------------------------LANNPDLRAARARLEA


                         .         .         *         .         .         .         .:140
query           ADVNLKTIKATYFPQISLTGLLGFGSNKLNTLFTNSAETWQVDGNIAGPIFDFGK
PF02321         ARAQLKAARAAFLPTLSLSASYGRSSNSGSSSGSSGSSGYSVGLGLSQPLFDGGR