[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rcon0:AAL03216.1

[Show Plain Result]


## Summary of Sequence Search
    1::231
    3::180     2e-21  36%  181 aa  PF00596 Aldolase_II "Class II Aldolase and Adducin N-terminal
    1::231

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLDGQILEGEEYQ
PF00596         ------LAEASRLLGDRGLVEGTGGNISVRLDPGHFL-ITPSGVDFGELTAEDLVVVDLDGEVLEGEGGL


                         .         .         *         .         .         .         .:140
query           YNKTGYFIHGSIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHFYDRISYHNYNSLVLDADKQS
PF00596         KPSSETPLHAAIYRARPDVGAVVHTHSPAATALSALGRPLPPIGQEAAREYLGGEIPVVPYMRPGTEELG


                         +         .         .         .         .         *         .:210
query           SRLVTDLKQNYVMLLRNHGAITCGKTIHEAMFYTYHLEQACKTQxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00596         EAIAEALGPDHAVLLRNHGLFVWGKTLEEAFELAETLEEAAEIQ--------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxx
PF00596         ---------------------