[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rcon0:AAL03501.1

[Show Plain Result]


## Summary of Sequence Search
    1::94
    3::66      5e-12  42%   96 aa  PF04993 TfoX_N "TfoX N-terminal domain"
    1::94

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxELLEPYGSVVVRVMFGGYGIYKGGVMIGIIKSNELYFKSDLSTYEYFQSFGSESFVYQS
PF04993         -----------ELLAGLGDVTYRKMFGGYGLYVDGKMFALVSDDRLYLKADDAAREEFEAAGCEPYVYAK


                         .         .         *         .         .         .         .:140
query           KGKLVxxxxxxxxxxxxxxxxxxx
PF04993         RGRPV-------------------