[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rcon0:AAL03713.1

[Show Plain Result]


## Summary of Sequence Search
    1::445
    1::117     1e-27  55%  117 aa  PF10396 TrmE_N "GTP-binding protein TrmE N-terminus"
    1::92      2e-05  32%  188 aa  PF02421 FeoB_N "Ferrous iron transport protein B"
    1::105     4e-04  35%  105 aa  PF01926 MMR_HSR1 "GTPase of unknown function"
    1::82      8e-04  36%  165 aa  PF00350 Dynamin_N "Dynamin family"
    1::445

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxTIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDNVMVVYFKSPG
PF10396         --TIYALSTGPGRSAIAVIRVSGPLALAVAQLLFASKSLEPRTAHYGQI-YDKGGELIDEVLVLYFKAPK
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNKxxxxxxxxxxxxxxxxxxxxx
PF10396         SFTGEDVVEIHCHGGPAVVSALLRALLGV-GLRPAEPGEFTRRAFLNGK---------------------
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10396         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDI
PF10396         ----------------------------------------------------------------------
PF02421         -----LTIALVGNPNVGKTTLFNALTGAR-QHVGNWPGVTVEKKEGKFKLGGKQVTLVDLPGTYSLSPYS
PF01926         ----------------GKSTLFNALTGRARAKVANYPGTTRDPNVGVVEVDGTQIELVDTPGLIKGASK-
PF00350         -------IAVVGDQSAGKSSLLNALLGRDILPRGSGPCTRREAERGKVEYGDFEKEFEDLSELREEETDR


                         .         *         .         .         .         .         +:350
query           IEQEGIKRAINSAKTADIKIIMFDAEKLDSSXXXXXXXXXXXXXXXXXXKIDLIEASKIFSIENKxxxxx
PF10396         ----------------------------------------------------------------------
PF02421         LDEQ-VARDYLLEEKPDVIINVVDATNLE-----------------------------------------
PF01926         GEGELGNKFLRHIREADAILHVVDAFEPDNENDLEI--------------IDLLRLKKVIVVLNK-----
PF00350         IANKGI----------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10396         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxx
PF10396         -------------------------
PF02421         -------------------------
PF01926         -------------------------
PF00350         -------------------------