[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rcon0:AAL03749.1

[Show Plain Result]


## Summary of Sequence Search
    1::1181
    5::406     e-126  57%  428 aa  PF07733 DNA_pol3_alpha "Bacterial DNA polymerase III alpha subunit"
    3::149     2e-08  38%  177 aa  PF02811 PHP "PHP domain"
    1::1181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKGLQPIHGVILN
PF07733         ----------------------------------------------------------------------
PF02811         -------LHSHTSYSFLDGALTPEELVERAKELGLDAIAITDHDTVAGFPEAYKAAKKAGIKLIPGVELS


                         .         .         *         .         .         .         .:140
query           IKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVxxxx
PF07733         ----------------------------------------------------------------------
PF02811         VQKELDELEHLVLLALNEVGYKNLPKLVSKAHL---------IPKEALEKIREGLIAISAHPEGEV----


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxKFKSENIALENQEALKTEYFARLNYELDIICNMNFAGYFLIVSDFIKW
PF07733         ----------------------KLTYEGLKERYGEEIPEEYRERLEYELDVIIKMGFPGYFLIVWDFVKW
PF02811         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS
PF07733         AKDNGIPVGPGRGSAAGSLVAYALGITEVDPLKYDLLFERFLNPERVSMPDIDIDFCGERREEVIQYVKE
PF02811         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREVPELANAAKGN
PF07733         KYGRDRVAQIITFGTMAAKAAIRDVGRVLGLPYGEVDRLAKLIPNEP--GITLEKALEEEPEL------R
PF02811         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA
PF07733         ELYESDPR---VRELLDLARKLEGLPRHTGQHAGGVVISDDPLTDFVPLQRPADGGRPVTQFDKDDVEDL
PF02811         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLK
PF07733         GLLKFDFLGLRTLTVIRDALDLIKERGIDIDLDDIPLDDPKTYELLSRGDTLGVFQLESRGMRQMLKRLK
PF02811         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLQPILEETYGVVIYQEQVQRIAQVLAGYT
PF07733         PDSFEDLVALVALYRPGPMQGIPPYIRRKHGREEVEYPHPLLEPILEETYGVIVYQEQVMQIAQVLAGFS
PF02811         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LGAADLLRRAMGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07733         LGEADLLRRAMG----------------------------------------------------------
PF02811         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07733         -------------------------------------------------------------
PF02811         -------------------------------------------------------------