[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rcon0:AAL03816.1

[Show Plain Result]


## Summary of Sequence Search
    1::122
   10::107     5e-23  46%  123 aa  PF04002 DUF2466 "Protein of unknown function (DUF2466)"
    1::122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxDYLKVNMGNMRLEQFRILFLNKKNILIADEVLSQGTIDQAAVYPREIIKRAL
PF04002         ------------------DYLRLELAGLEREVFRVLFLDTKNRLIADETLFIGTLNSSIVHPREVFKRAL


                         .         .         *         .         .         .         .:140
query           FNEASSLILVHHHPSGSPEPSKANIHMTNKIVEKCQTINIIVLNLIxxxxxx
PF04002         KLNAAAIILAHNHPSGDPTPSQADIEITKRLKEAGKLLGIRLLDHI------