[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rcon0:AAL02981.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fqlA1.bssp"
#ERROR : Can't open dsspfile "1ew4A.bssp"
#ERROR : Can't open dsspfile "1ekgA.bssp"

## Summary of PDB Search
:103
    2e-25  35%  2fqlA1 [d.82.2.1] FRATAXIN HOMOLOG, MITOCHONDRIAL A:61 -- 172
    3e-25  27%  1ew4A  [d.82.2.1] CYAY PROTEIN
    2e-23  34%  1ekgA  [d.82.2.1] FRATAXIN
:103

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
2fqlA1          LPLEKAHEEADDYLDHLLDSLEELSEDCIPDVELSHGVMTLEIPFGTYVINKQPPNKQIWLASPLSGPNR
1ew4A           MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFNGSKIIINRQEPLHQVWLATK-QGGYH
1ekgA           LDETTYERLAEETLDSLAEFFEDLADKEDYDVSFGSGVLTVGGDLGTYVINKQTPNKQIWLSSPSSGPKR


                         .         .         *         .         .         .         .:140
query           FFYEQGEWTNRAGLELMAILTEELNIKFDTRxx
2fqlA1          FDLLNGEWVLRNGTKLTDILTEEVEKAIS----
1ew4A           FDLKGDEWIDRSGETFWDLLEQAATQQAGE---
1ekgA           YDWTGKNWVSHDGVSLHELLAAELTKALKTK--