[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rcon0:AAL03106.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1zruA3.bssp"
#ERROR : Can't open dsspfile "1iwgA5.bssp"
#ERROR : Can't open dsspfile "1iwgA2.bssp"
#ERROR : Can't open dsspfile "1zd0A1.bssp"
#ERROR : Can't open dsspfile "1mwkA2.bssp"
#ERROR : Can't open dsspfile "1iwgA8.bssp"
#ERROR : Can't open dsspfile "1e6vB2.bssp"

## Summary of PDB Search
:169
    5e-15  11%  1zruA3 [b.163.1.2] LACTOPHAGE P2 RECEPTOR BINDING PROTEIN A:2 --
    3e-13  23%  1iwgA5 [d.225.1.1] ACRB A:182 -- 273
    2e-11  14%  1iwgA2 [d.58.44.1] ACRB A:135 -- 181 A:274 -- 330
    1e-10  12%  1zd0A1 [d.329.1.1] HYPOTHETICAL PROTEIN PF0523 A:9 -- 144
    6e-10  10%  1mwkA2 [c.55.1.1] PARM A:158 -- 320
    7e-07  10%  1iwgA8 [f.35.1.1] ACRB A:513 -- 566 A:869 -- 1036
    2e-04   2%  1e6vB2 [d.58.31.2] METHYL-COENZYME M REDUCTASE I BETA SUBUNIT B:7
:169

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDYYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNNIGLDQVSNIISSANVNLPTGALYGT
1zruA3          ---WSSPL-NTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLT----QTANPVSLSAETA
1iwgA5          -----------------------------YAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGQ
1iwgA2          ----------------------------------------------------------------------
1zd0A1          ------------IRTKVGEICISKVWLTDEQINKLFDRFKGDYQVVNAECADKVIFATIKAVKEGRSIAK
1mwkA2          ---KLEQRVLNTLNEFSGYTHVMVIGGGAELICVKKHTQIRDERFFKTNNSQYDLVNGMYL---------
1iwgA8          ----------------------------------------------------------------------
1e6vB2          MADPYSGTLQAGMAVVHAIIDVCEVDMWDANMVKAAVFGRYPQTIDYFGGNVASMLDVPMKQE-------


                         .         .         *         .         .         .         .:140
query           DIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLKNIGKTIDSVANNKIAAWYRDKPGVILAIQKQPDTTN
1zruA3          NNSNGVDINNGSGVLKVCFDIVTTSGTG------------------------------------------
1iwgA5          QLNASIIAQTRLTSTEEFGKILLKVQDGSRVLLRDVAKIELG----------------------------
1iwgA2          ----GVINTDGTMTQEDISDYVAANMKDAISRTSGVGDQLFGSQNYDIIAEFNGQPASGLGIKLATG-AN
1zd0A1          TVPGEVRLSGNRQIKEAIKKVGAEGENYIVTFGENASALL------------------------------
1mwkA2          ----------------------------------------------------------------------
1iwgA8          -----------------------------------------------------------FEKSTHHYT-D
1e6vB2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TIEIVDSIKEVLPLLRRQIPEGININIMF
1zruA3          -----------------------------
1iwgA5          -----------------------------
1iwgA2          ALDTAAAIRAELAKMEPFFPSGLKIVYPY
1zd0A1          -----------------------------
1mwkA2          -----------------------------
1iwgA8          SVGGILRSTGRYLVLYLIIVVGMAYLFVR
1e6vB2          -----------------------------