[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rcon0:AAL03110.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wp1A.bssp"
#ERROR : Can't open dsspfile "1ek9A.bssp"
#ERROR : Can't open dsspfile "2pggA1.bssp"

## Summary of PDB Search
:125
    9e-19  31%  1wp1A  [f.5.1.1] OUTER MEMBRANE PROTEIN OPRM
    2e-17  14%  1ek9A  [f.5.1.1] OUTER MEMBRANE PROTEIN TOLC
    1e-07  20%  2pggA1 [e.8.1.4] RNA-DIRECTED RNA POLYMERASE A:31 -- 804
:125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPPLKQQRHEQETTLKILVGRIPENIVNGLIYRNKPIDYFPALPVLPKILPSELLEQRPDIKAAEQNLLA
1wp1A           LAQYTRLVAQDQNALVLLLGSGIPANL-----PQGLGLDQTLLTEVPAGLPSDLLQRRPDILEAEHQLMA
1ek9A           ELTARNNLDNAVEQLRQITGNYYPELA-----ALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDL
2pggA1          -GTYMGQATRLVAMKEVATGRNPNKDPLKLGYTFSIAQLLD--ITLPVGPPGEDDKPWVPLTRVPSRMLV


                         .         .         *         .         .         .         .:140
query           ADVNLKTIKATYFPQISLTGLLGFGSNKLNTLFTNSAETWQVDGNIAGPIFDFGK
1wp1A           ANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGS
1ek9A           AREQIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAQNKVGLSFSLPIYQGG-
2pggA1          GDVDGDFEVEDYLPKINLKSSSG--------------------------------