[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rcon0:AAL03216.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dzuP.bssp"
#ERROR : Can't open dsspfile "1jdiA.bssp"
#ERROR : Can't open dsspfile "1pvtA.bssp"
#ERROR : Can't open dsspfile "1gt7A.bssp"
#ERROR : Can't open dsspfile "2b3xA2.bssp"

## Summary of PDB Search
:231
    1e-41  21%  1dzuP  [c.74.1.1] L-FUCULOSE-1-PHOSPHATE ALDOLASE
    1e-41  18%  1jdiA  [c.74.1.1] L-RIBULOSE 5 PHOSPHATE 4-EPIMERASE
    6e-35  20%  1pvtA  [c.74.1.1] SUGAR-PHOSPHATE ALDOLASE
    2e-33  18%  1gt7A  [c.74.1.1] RHAMNULOSE-1-PHOSPHATE ALDOLASE
    8e-04  14%  2b3xA2 [c.83.1.1] IRON-RESPONSIVE ELEMENT BINDING PROTEIN 1 A:2 --
:231

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLDGQILEGEEYQ
1dzuP           ------IIDTCLEMTRLGLNQGAAGNVSVRYQDG--MLITPTGIPYEKLTESHIVFIDGNGKHEEGKL--
1jdiA           -DLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSGVDYSIMTADDMVVVSIETGEVVEGAKK
1pvtA           ------IQKVAYWLAIKGLSEANAGNISVRLDERPEGYITATGSRXREVYEDDSKICLLHVLPGNGKPTS
1gt7A           ------MIKATTDAWLKGWDERNGGNLTLRLLANTPFIVTGSGKFFRNVANLGIVKVDSDGAGYHILWGL
2b3xA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YNKTGYFIHGSIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHFYDRISYHNYNSLVLDADKQS
1dzuP           -PSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGGNSIPCAPYATFGTRE-LS
1jdiA           -PSSDTPTHRLLYQAFPSIGGIVHTHSRHATIWAQAGQSIPATGTHADYFYGTIGEYEWETGNVIVE-TF
1pvtA           EFPTHLXIHAKFKEXNPEKKAIVHTHPLNLLTLXNLEKXXKIHPEVLIFFPQGISVVEFEKPGSVELGL-
1gt7A           TNESELPAHFLSHCERGKDRVIMHCHATNLIALTYVLENDTAVFTRQLVFPDGVGILPWM--VPGTDEIG
2b3xA2          ---------------------------------------------------VQPGKK-FFNLNKLEDSRY


                         +         .         .         .         .         *         .:210
query           SRLVTDLKQNYVMLLRNHGAITCGKTIHEAMFYTYHLEQACKTQCLLNSTKEQELIIPSVEICKQTVKxx
1dzuP           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEI--------
1jdiA           EKQGIDAAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQTLLNK------
1pvtA           -KTVEKSEGKDAVLWDKHGVVAFGKDVAEAYDRVEILEKAAEILLRVLSLGR------------------
1gt7A           QATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVKVYSM-GGMKQTISREELIALGK--
2b3xA2          GRLPFSIRVLLEAAIRNCDEFLVKKQDIENILH-WNVTQHKNIEVPFK----------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxx
1dzuP           ---------------------
1jdiA           ---------------------
1pvtA           ---------------------
1gt7A           ---------------------
2b3xA2          ---------------------