[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rcon0:AAL03501.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2od0A1.bssp"

## Summary of PDB Search
:94
    4e-18  26%  2od0A1 [d.198.5.2] HYPOTHETICAL PROTEIN VP1028 A:3 -- 105
:94

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxFTEYVKELLEPYGSVVVRVMFGGYGIYKGGVMIGIIKSNELYFKSDLSTYEYFQSFGSESFVYQS
2od0A1          -----ILKDSXKLFEALGTIKSRSXFGGFGLFADETXFALVVNNQLHIRADQQTSSDFETQGLKPYVYKK


                         .         .         *         .         .         .         .:140
query           KGKLVTLKxxxxxxxxxxxxxxxx
2od0A1          RGFPVVTK----------------