[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rcon0:AAL03659.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pgvA.bssp"
#ERROR : Can't open dsspfile "1k5dC.bssp"

## Summary of PDB Search
:82
    2e-04  11%  1pgvA  [c.10.1.1] TROPOMODULIN TMD-1
    3e-04  26%  1k5dC  [c.10.1.2] RAN GTPASE ACTIVATING PROTEIN 1
:82

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxDLSNKNITDEQAKDLAAALKANRSLTSLYLPWNNIGEATFKIINEYLYR
1pgvA           ---------------------NVESNFLTPELLARLLRSTLVTQSIVEFKADNQRQGNQVEMDMMMAIEE
1k5dC           ---------------------SLKLDAITTEDEKSVFAVLLEDDSVKEIVLSGNTIGTEAARWLSENIAS


                         .         .         *         .         .         .         .:140
query           NKTITKxxxxxx
1pgvA           NESLLR------
1k5dC           KKDLE-------