[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rcon0:AAL03713.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xzpA3.bssp"
#ERROR : Can't open dsspfile "1ahjB.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"
#ERROR : Can't open dsspfile "1h65A.bssp"
#ERROR : Can't open dsspfile "2iolA1.bssp"
#ERROR : Can't open dsspfile "1nrjB.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1zd9A1.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1egaA1.bssp"
#ERROR : Can't open dsspfile "2fh5B1.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1xzpA2.bssp"
#ERROR : Can't open dsspfile "1wdtA2.bssp"
#ERROR : Can't open dsspfile "1pujA.bssp"
#ERROR : Can't open dsspfile "1e0sA.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1f6bA.bssp"
#ERROR : Can't open dsspfile "1pj5A4.bssp"
#ERROR : Can't open dsspfile "1f60A3.bssp"
#ERROR : Can't open dsspfile "2bmjA1.bssp"
#ERROR : Can't open dsspfile "2p67A1.bssp"
#ERROR : Can't open dsspfile "1wxqA1.bssp"
#ERROR : Can't open dsspfile "1qvrA2.bssp"

## Summary of PDB Search
:445
    5e-38  42%  1xzpA3 [d.250.1.2] PROBABLE TRNA MODIFICATION GTPASE TRME A:1 --
    6e-23  10%  1ahjB  [b.34.4.4] NITRILE HYDRATASE (SUBUNIT BETA)
    1e-21  25%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --
    5e-16  18%  1h65A  [c.37.1.8] CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34
    1e-14   9%  2iolA1 [a.118.1.14] PROGRAMMED CELL DEATH 4, PDCD4 A:322 -- 448
    1e-08  17%  1nrjB  [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA
    3e-08  26%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    8e-08  10%  1zd9A1 [c.37.1.8] ADP-RIBOSYLATION FACTOR-LIKE 10B A:18 -- 181
    1e-07  22%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342
    6e-07  35%  1egaA1 [c.37.1.8] PROTEIN (GTP-BINDING PROTEIN ERA) A:4 -- 182
    1e-06  10%  2fh5B1 [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA B:63 --
    2e-06  17%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    8e-06   8%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    1e-05  44%  1xzpA2 [c.37.1.8] PROBABLE TRNA MODIFICATION GTPASE TRME A:212 --
    1e-05  16%  1wdtA2 [c.37.1.8] ELONGATION FACTOR G HOMOLOG A:8 -- 274
    3e-05  35%  1pujA  [c.37.1.8] CONSERVED HYPOTHETICAL PROTEIN YLQF
    3e-05  25%  1e0sA  [c.37.1.8] ADP-RIBOSYLATION FACTOR 6
    3e-05  40%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    7e-05  19%  1f6bA  [c.37.1.8] SAR1
    1e-04  18%  1pj5A4 [d.250.1.1] N,N-DIMETHYLGLYCINE OXIDASE A:428 -- 742
    1e-04  15%  1f60A3 [c.37.1.8] ELONGATION FACTOR EEF1A A:2 -- 240
    1e-04  12%  2bmjA1 [c.37.1.8] CENTAURIN GAMMA 1 A:66 -- 240
    3e-04  23%  2p67A1 [c.37.1.10] LAO/AO TRANSPORT SYSTEM KINASE A:1 -- 327
    4e-04  26%  1wxqA1 [c.37.1.8] GTP-BINDING PROTEIN A:1 -- 319
    6e-04  31%  1qvrA2 [c.37.1.20] CLPB PROTEIN A:149 -- 535[MASQUE : MEMB(X) 0 /
:445

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDNVMVVYFKSPG
1xzpA3          MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKHLRTRSIVPRKAIHGWIHENG--EDVDEVVVVFYKSPK
1ahjB           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
2iolA1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1pj5A4          ----------------CCIGLWGPLARDLVSKVSDD-DFTNDGLKYFRAKNVVIG------GIPVTAMRL
1f60A3          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1wxqA1          ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNKFDLTAAEGIADLINAETIMQH
1xzpA3          SYTGEDMVEVMCHGGPLVVKKLLDLFLK-SGARMAEPGEFTKRAFLNGK---------------------
1ahjB           ------------------------------------------------KVPHTVDADIGPTFHAEWEHLP
1xzpA1          --------------------------------------------------DLTSAEAVRDLIEAKSETSL
1h65A           ----------------------------------------------------------------------
2iolA1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1pj5A4          SYVGELGWELYTSADNGQR--LWDALW-------------------------------------------
1f60A3          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1wxqA1          ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KQAIRQASGKLEALYNNWRSQLLKMLSLLEAYIDFPDEDIPDTVLNEVTNTHTILVNTISEYLNDNRKGE
1xzpA3          ----------------------------------------------------------------------
1ahjB           YSLMFAGVAELGAFVDEVRYVVERMEPRHYMMTPYYERYVIGTLMVEKGILTQDELESLAGGPFPLSRPS
1xzpA1          KLSLRNLKGGLRDFVDSLRRELIEVLAEIRVELDYPDEIE------TNTGEVVTRLERIKEKLTEELK-K
1h65A           ------------------------------------------------------------------NLKQ
2iolA1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1ni3A1          -------------------------------------------------------------------KVQ
1zd9A1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1e0sA           --------------------------------------------------------------------GK
2cxxA1          ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1pj5A4          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1wxqA1          ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDI
1xzpA3          ----------------------------------------------------------------------
1ahjB           ESEGRPAPVETTTFEVGQRVRVRDEYVPG---HIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAEP
1xzpA1          ADAGILLNRGQEIFERGSDSLITNLRQK--QLLENVKGHLEDAIKSLKE--GMPVDMASIDLER-ALNLL
1h65A           EDVNSLTILVXGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVXVSRSRAGFTLNIIDTPGLIEGGYIN
2iolA1          ----------------------------------------------------------------------
1nrjB           ------SIIIAGPQNSGKTSLLTLLTTDSVRP-----TVVSQEPLSAADYDGSGVTLVDFPGHVKLRYKL
1ni3A1          WGRNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEAKVAVPDERFDWL------------
1zd9A1          -----MELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRS-----
1lnzA2          -----ADVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLGXVETDDGRSFV--------------
1egaA1          -----GFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIYVDTPGLH-MEEKR
2fh5B1          ------AVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHESLRFQLL
1mkyA1          ------TVLIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKLVDTCGVFDNPQDIISQKXKEVTLNXIR
1ckvA           -VHESDTVVLVLKKSDEINTFIE-EILLTDYKKNVNPTVNVEDRAGYWWIKANGKIEVDCDEIS------
1xzpA2          -----LRMVIVGKPNVGKSTLLNRLLNEDRAIVTDIPGTTRDVISEEIVIRGILFRIVDTAGVRSETNDL
1wdtA2          --------ALVGHAGSGKTTLTEALLYKTGAKEAKLHRTTVRTGVAPLLFRGHRVFLLDAPGYGDFVGEI
1pujA           ----------IGIPNVGKSTLINRLAKKNIAQWVKV---------------GKELELLDTPGILWPKFE-
1e0sA           VLSKIFRILMLGLDAAGKTTILYKLK--------------------------------------------
2cxxA1          ------TIIFAGRSNVGKSTLIYRLT--------------------------------------------
1f6bA           -----GKLVFLGLDNAGKTTLLHMLKDDPTLHPTSEELTIAGMTFTTFDLGGRRVWKNYLPAINGIVFLV
1pj5A4          ----------------------------------------------------------------------
1f60A3          -----INVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGIT
2bmjA1          -----LRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGW
2p67A1          --GNTLRLGVTGTPGAGKSTFLEAFEGLKVAVIAVASQRARELML-LCEAAGYDVVIVETVGVGQSETEV
1wxqA1          ------EIGVVGKPNVGKSTFFSAATLANVGVTYAIT---------------------------------
1qvrA2          ---------LIGEPGVGKTAIVEGLAQRIVK-------------------GDVPEGLKGK---RIVSLQM


                         .         *         .         .         .         .         +:350
query           IEQEGIKRAINSAKTADIKIIMFDAEKLDSSXXXXXXXXXXXXXXXXXXKIDLIEASKIFSIENKYKCLR
1xzpA3          ----------------------------------------------------------------------
1ahjB           TYHVKFAAEELFGSDTDGGSVVVDLFE-------------------------------------------
1xzpA1          DEVTGRSFREDLLDTIFS----------------------------------------------------
1h65A           DXALNIIKSFLLDKTIDVLLYVDRLDA-------------------------------------------
2iolA1          -------------------------------------------------SGDISEAEHCLKELEVPHFHH
1nrjB           SDYLKTRAKFVKGLIFMVDSTVDPKKLTTT----------------------------------------
1ni3A1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1egaA1          AINRLMNKAASSSIGDVELVIFVVE---------------------------------------------
2fh5B1          --DRFKSSARAVVFVVDSAAFQREVK--------------------------------------------
1mkyA1          EADLVLFVVDGKRGITKEDESLADFLRKS-----------TVDTILVANKAENREVKPELYSLGFGEPIP
1ckvA           ----------------------------------------------------------------------
1xzpA2          VERLGIERTLQEIEKADIVLFVLDASSPLD----------------------------------------
1wdtA2          R------GALEAADAALVAVSAEAGVQVGTERAWTVAERLGLPRMVVVTKLDKGGDYSTLGPILPIDLPL
1pujA           DELVGLRLAVTGAIKDSIINLQDVAVFG------------------------------------------
1e0sA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1f6bA           DC-ADHERLLESKEELDSLMTDETI---------------------------------------------
1pj5A4          ----------------------------------------------------------------------
1f60A3          I---------------------------------------------------------------------
2bmjA1          ADAVIFVFSLEDENSFQ-----------------------------------------------------
2p67A1          ARMQGIKKGL--MEVADLIVI-------------------------------------------------
1wxqA1          ----------------------------------------------------------------------
1qvrA2          EFEERLKAVIQEVVQSQGEVILF-----------------------------------------------


                         .         .         .         .         *         .         .:420
query           VSVKNNIALSSILKNIENIAENMAGFTETPYITNQRHRNYLQQALSHLTAFSLDNDLVLATEDIRMTARC
1xzpA3          ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
2iolA1          ELVYEAI-VXVLESTGESAFKXILDLL---KSLWKSSTITIDQXKRGYERIYNEIPDI--NLDVPHSYSV
1nrjB           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1mkyA1          VSAEHNINLDTXLETIKKLEEKG-----------------------------------------------
1ckvA           ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1wdtA2          YEGGKWVGLIDVFHGKAYRYENEEREAEVPPEERERVQRFRQEVLEAI----------------------
1pujA           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1pj5A4          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1wxqA1          ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IGAITGVINVEEILGEIFKNFCxxx
1xzpA3          -------------------------
1ahjB           -------------------------
1xzpA1          -------------------------
1h65A           -------------------------
2iolA1          LERFVEECFQAGIISKQLRDLC---
1nrjB           -------------------------
1ni3A1          -------------------------
1zd9A1          -------------------------
1lnzA2          -------------------------
1egaA1          -------------------------
2fh5B1          -------------------------
1mkyA1          -------------------------
1ckvA           -------------------------
1xzpA2          -------------------------
1wdtA2          -------------------------
1pujA           -------------------------
1e0sA           -------------------------
2cxxA1          -------------------------
1f6bA           -------------------------
1pj5A4          -------------------------
1f60A3          -------------------------
2bmjA1          -------------------------
2p67A1          -------------------------
1wxqA1          -------------------------
1qvrA2          -------------------------