[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rcon0:AAL03749.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1r8nA.bssp"
#ERROR : Can't open dsspfile "1kitA2.bssp"
#ERROR : Can't open dsspfile "1t6kA2.bssp"
#ERROR : Can't open dsspfile "1fc3A.bssp"
#ERROR : Can't open dsspfile "2i5hA1.bssp"
#ERROR : Can't open dsspfile "1asyA1.bssp"
#ERROR : Can't open dsspfile "1q16B.bssp"
#ERROR : Can't open dsspfile "1krsA.bssp"
#ERROR : Can't open dsspfile "1wjjA.bssp"
#ERROR : Can't open dsspfile "2eduA1.bssp"

## Summary of PDB Search
:1181
    1e-30  16%  1r8nA  [b.42.4.1] KUNITZ TRYPSIN INHIBITOR
    6e-29  13%  1kitA2 [b.29.1.8] SIALIDASE A:347 -- 543
    7e-26  16%  1t6kA2 [d.21.1.2] PHENAZINE BIOSYNTHESIS PROTEIN PHZF A:129 -- 278
    7e-21  12%  1fc3A  [a.4.6.3] SPO0A
    3e-18  13%  2i5hA1 [e.71.1.1] HYPOTHETICAL PROTEIN AF1531 A:16 -- 195
    9e-13  14%  1asyA1 [b.40.4.1] ASPARTYL-TRNA SYNTHETASE A:68 -- 204
    4e-10  11%  1q16B  [d.58.1.5] RESPIRATORY NITRATE REDUCTASE 1 BETA CHAIN
    7e-10  15%  1krsA  [b.40.4.1] LYSYL-TRNA SYNTHETASE (PRODUCT OF LYSS GENE)
    9e-07  15%  1wjjA  [b.40.4.3] HYPOTHETICAL PROTEIN F20O9.120
    2e-05  20%  2eduA1 [a.60.2.7] KINESIN-LIKE PROTEIN KIF22 A:8 -- 98
:1181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEFALCAVKKGLQPIHGVILN
1r8nA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           --------------------------------------------------KPVLRALKRMLAMRHYKRAE
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVGKCL
1r8nA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           TVDGKVDTRALEEVGLTEAQAQEMYRYLAIANYEDRFVVPELAREAFPEKNGCGFTFGCH--GSDTKFNL
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LARNEEQAMLFARKLQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r8nA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           FNSRRIDAIDVTSKTE------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPPMLPNFATE
1r8nA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ------------------------------------------------------------DAELL--KAL
1fc3A           ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NISETDLIKKDAKEGLLARLATKFKSENIALENQEALKTEYFARLNYELDIICNMNFAGYFLIVSDFIKW
1r8nA           --------QSDLQMGLPVRFSSPEEKQ-----------GKIYTDTELEIEFVEKPDCAES--SKWVIVKD
1kitA2          ----------------------------------------------------------------------
1t6kA2          GISDSTFPIEIYHNGPRHVF--------VGLPSIDALS-----ALHPDHRNFHDMAINCFAGAGRRWRSF
1fc3A           ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS
1r8nA           SGEARVAIGGSEDHPQGELVRGFFKIEKLGSLAYKLVF--CPKSDSGSCSDIGINYEGRRSLVLKSSDDV
1kitA2          ----------------------------------------------------------------------
1t6kA2          SPAYGVVEDAATGSAAGPLAIH-LARHGQIEFGQPVEILQGVEIGRPSLMFAKAEGRAEQLTRVE-----
1fc3A           ------------------------------------------------PKNLDASITSIIHEIGVPAHIK
2i5hA1          ----------------------------------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREVPELANAAKGN
1r8nA           PF--------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           GYLYLREAIAMVYHDIELKVLYPDIAKKYNTTASRVERAIRHAIEVAWSRGNLESISSLFGYTVSVSKAK
2i5hA1          ----------------------------------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r8nA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r8nA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQEQVQRIAQVLAGYT
1r8nA           ----------------------------------------------------------------------
1kitA2          -------------------------------------------------------TDQVKERSFQIAGWG
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LGAADLLRRAMGXXXXXXXXXXXXXXXXGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQT
1r8nA           ----------------------------------------------------------------------
1kitA2          GSELYRRNTSLNSQQDWQSNAKIRIVDGAANQIQVVTLSIDESGGLVANLNGVSLQSEHAKVHSFHDYEL
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          ------------------------------------------PDDKRPIHRREPLAQVVGERNFTLLEVS
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           AYLKANYPAAFLVACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKFSDTVIPHSVKPVIP
1r8nA           ----------------------------------------------------------------------
1kitA2          QYSALNHTTTLFVDGQQGEVSQENNIQFGNADAQ------IDGRLHVQKIVLTQQ---------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          IRKGKQPLVMDRVYIGKGEKIKRRLRYEDLTPAAKTELPYVIEHIIKQDEKKYVDFFNDSITTRMHQL--
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           RLDRGIQKISKDTVVKPRCDXXXXXXXXXXXXXXVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINS
1r8nA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          ---ELLPGVGKKMMWA--------------------------IIEERK-KRPFESFEDIAQRVKGIQRPE
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          ----------------------------------IGPKKAQLIVGWRELHGPFSQVEDLERV---EGITG


                         .         .         .         +         .         .         .:980
query           KLLENLIKSGCFDELHDNRLQLLSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r8nA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          KLIVSRIIYEIKNPQ--TKYKLFTA---------------------------------------------
1asyA1          ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
1krsA           ----------------------------------------------------------------------
1wjjA           ----------------------------------------------------------------------
2eduA1          KQMESFLKANILGLAAG-----------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxEFEAMGLFISNHPLTEYQEIFSRLNILNTADLHNNLPDGTNRVNLAGVIQKKDSRMSARGRFVTLVLS
1r8nA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1asyA1          --EDTAKDNYGKLPLIQSRDSDRTGQKRVKFVDLDEAKDSDK-EVLFRARVHNT-RQQGATLAFLT--LR
1q16B           ----------------------------------------------------------------------
1krsA           ---------FRRDHTSDQLHAEFDGKENEELEA------LNI-EVAVAGRMMTRRI----MGKASFVTLQ
1wjjA           -------------SSGSSGSTVKRKPVFVKVEQLKPGTTGHTLTVKVKTRPASSLSRPSQPSRIVECLIG
2eduA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           DPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIVKDEGGIKLTAKSFSSIEDAxxxxxxxxxxxxxxx
1r8nA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
1t6kA2          ----------------------------------------------------------------------
1fc3A           ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1asyA1          QQASLIQGLVKANKEGTISKNMVNLESIVLVRGIVKKVDEPIKSATV-----------------------
1q16B           ----------------------------------------------------------------------
1krsA           DVGGRIQLYVAPEGVYNEQFKKWDLGDILGAKGKLFKKTGELSIHCTELRLLTKA---------------
1wjjA           DETGCILFTARNDQVDL----MKPGATVILRNSRIDMFKGTMRLGVDKWGRIE-----------------
2eduA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r8nA           -------------------------------------------------------------
1kitA2          -------------------------------------------------------------
1t6kA2          -------------------------------------------------------------
1fc3A           -------------------------------------------------------------
2i5hA1          -------------------------------------------------------------
1asyA1          -------------------------------------------------------------
1q16B           -------------------------------------------------------------
1krsA           -------------------------------------------------------------
1wjjA           -------------------------------------------------------------
2eduA1          -------------------------------------------------------------