[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF07116.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dzdA.bssp"
#ERROR : Can't open dsspfile "1ny5B.bssp"
#ERROR : Can't open dsspfile "1ny5A.bssp"
#ERROR : Can't open dsspfile "1ojlD.bssp"
#ERROR : Can't open dsspfile "1ojlE.bssp"
#ERROR : Can't open dsspfile "1ojlA.bssp"
#ERROR : Can't open dsspfile "1ojlC.bssp"
#ERROR : Can't open dsspfile "1ojlB.bssp"
#ERROR : Can't open dsspfile "1ny6L.bssp"
#ERROR : Can't open dsspfile "1ny6H.bssp"
#ERROR : Can't open dsspfile "1ny6C.bssp"
#ERROR : Can't open dsspfile "1ny6B.bssp"
#ERROR : Can't open dsspfile "1ny6A.bssp"
#ERROR : Can't open dsspfile "1ojlF.bssp"
#ERROR : Can't open dsspfile "2c99A.bssp"
#ERROR : Can't open dsspfile "2viiA.bssp"
#ERROR : Can't open dsspfile "2c98A.bssp"
#ERROR : Can't open dsspfile "2c9cA.bssp"
#ERROR : Can't open dsspfile "2bjwA.bssp"
#ERROR : Can't open dsspfile "2bjvA.bssp"
#ERROR : Can't open dsspfile "2c96A.bssp"
#ERROR : Can't open dsspfile "1qkkA.bssp"
#ERROR : Can't open dsspfile "1l5zA.bssp"
#ERROR : Can't open dsspfile "1l5yB.bssp"
#ERROR : Can't open dsspfile "1l5yA.bssp"
#ERROR : Can't open dsspfile "1dbwB.bssp"
#ERROR : Can't open dsspfile "1dbwA.bssp"
#ERROR : Can't open dsspfile "1dcmA.bssp"
#ERROR : Can't open dsspfile "1d5wB.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "1yioA.bssp"
#ERROR : Can't open dsspfile "1dc7A.bssp"
#ERROR : Can't open dsspfile "3jteA.bssp"
#ERROR : Can't open dsspfile "1dc8A.bssp"
#ERROR : Can't open dsspfile "1zitA.bssp"
#ERROR : Can't open dsspfile "1zesC.bssp"
#ERROR : Can't open dsspfile "1zesA.bssp"
#ERROR : Can't open dsspfile "2iynB.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "1zesB.bssp"
#ERROR : Can't open dsspfile "2jbaA.bssp"
#ERROR : Can't open dsspfile "2jb9B.bssp"
#ERROR : Can't open dsspfile "2jb9A.bssp"
#ERROR : Can't open dsspfile "3cfyA.bssp"
#ERROR : Can't open dsspfile "2jbaB.bssp"
#ERROR : Can't open dsspfile "1zy2B.bssp"
#ERROR : Can't open dsspfile "1zy2A.bssp"
#ERROR : Can't open dsspfile "2iynA.bssp"
#ERROR : Can't open dsspfile "2oqrA.bssp"
#ERROR : Can't open dsspfile "1tmyA.bssp"
#ERROR : Can't open dsspfile "2pl1A.bssp"
#ERROR : Can't open dsspfile "2pkxB.bssp"
#ERROR : Can't open dsspfile "2pkxA.bssp"
#ERROR : Can't open dsspfile "2iynC.bssp"
#ERROR : Can't open dsspfile "1mvoA.bssp"
#ERROR : Can't open dsspfile "3ffxA.bssp"
#ERROR : Can't open dsspfile "3eulC.bssp"
#ERROR : Can't open dsspfile "3eulB.bssp"
#ERROR : Can't open dsspfile "3eulA.bssp"
#ERROR : Can't open dsspfile "3eodA.bssp"
#ERROR : Can't open dsspfile "3cu5B.bssp"
#ERROR : Can't open dsspfile "2qr3A.bssp"
#ERROR : Can't open dsspfile "3ffwA.bssp"
#ERROR : Can't open dsspfile "3fftA.bssp"
#ERROR : Can't open dsspfile "2qxyB.bssp"
#ERROR : Can't open dsspfile "2qxyA.bssp"
#ERROR : Can't open dsspfile "2j8eA.bssp"
#ERROR : Can't open dsspfile "2vuiB.bssp"
#ERROR : Can't open dsspfile "1nxpA.bssp"
#ERROR : Can't open dsspfile "2jk1A.bssp"
#ERROR : Can't open dsspfile "2a9oA.bssp"
#ERROR : Can't open dsspfile "1a2oA.bssp"
#ERROR : Can't open dsspfile "1xheB.bssp"
#ERROR : Can't open dsspfile "1xheA.bssp"
#ERROR : Can't open dsspfile "3f7nA.bssp"
#ERROR : Can't open dsspfile "3dgfC.bssp"
#ERROR : Can't open dsspfile "3dgeC.bssp"
#ERROR : Can't open dsspfile "1xhfA.bssp"
#ERROR : Can't open dsspfile "2vuhB.bssp"
#ERROR : Can't open dsspfile "1p6qA.bssp"
#ERROR : Can't open dsspfile "3gt7A.bssp"
#ERROR : Can't open dsspfile "2zayA.bssp"
#ERROR : Can't open dsspfile "1d4zA.bssp"
#ERROR : Can't open dsspfile "3cu5A.bssp"
#ERROR : Can't open dsspfile "1jbeA.bssp"
#ERROR : Can't open dsspfile "3hdvD.bssp"
#ERROR : Can't open dsspfile "3hdvC.bssp"
#ERROR : Can't open dsspfile "3hdvB.bssp"
#ERROR : Can't open dsspfile "3hdvA.bssp"
#ERROR : Can't open dsspfile "3cg0B.bssp"
#ERROR : Can't open dsspfile "3cg0A.bssp"
#ERROR : Can't open dsspfile "3b2nA.bssp"
#ERROR : Can't open dsspfile "1w25A.bssp"
#ERROR : Can't open dsspfile "2v0nA.bssp"
#ERROR : Can't open dsspfile "1udrB.bssp"
#ERROR : Can't open dsspfile "1udrA.bssp"
#ERROR : Can't open dsspfile "1sd5A.bssp"
#ERROR : Can't open dsspfile "1s8nA.bssp"
#ERROR : Can't open dsspfile "2ayzA.bssp"
#ERROR : Can't open dsspfile "2ayxA.bssp"
#ERROR : Can't open dsspfile "1ab5A.bssp"
#ERROR : Can't open dsspfile "1ys7B.bssp"
#ERROR : Can't open dsspfile "1ys7A.bssp"
#ERROR : Can't open dsspfile "1ys6B.bssp"
#ERROR : Can't open dsspfile "1mihA.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "2a9qA.bssp"
#ERROR : Can't open dsspfile "2zwmA.bssp"
#ERROR : Can't open dsspfile "2cheA.bssp"
#ERROR : Can't open dsspfile "1f4vC.bssp"
#ERROR : Can't open dsspfile "1djmA.bssp"
#ERROR : Can't open dsspfile "1cyeA.bssp"
#ERROR : Can't open dsspfile "3chyA.bssp"
#ERROR : Can't open dsspfile "1chnA.bssp"
#ERROR : Can't open dsspfile "3crnB.bssp"
#ERROR : Can't open dsspfile "3crnA.bssp"
#ERROR : Can't open dsspfile "2a9rA.bssp"
#ERROR : Can't open dsspfile "5chyA.bssp"
#ERROR : Can't open dsspfile "1e6kA.bssp"
#ERROR : Can't open dsspfile "1ymvA.bssp"
#ERROR : Can't open dsspfile "1ymuA.bssp"
#ERROR : Can't open dsspfile "1nxtA.bssp"
#ERROR : Can't open dsspfile "1zh4A.bssp"
#ERROR : Can't open dsspfile "1zh2B.bssp"
#ERROR : Can't open dsspfile "1zh2A.bssp"
#ERROR : Can't open dsspfile "3h5iA.bssp"
#ERROR : Can't open dsspfile "1ehcA.bssp"

## Summary of PDB Search
:444
    7e-71  41%  3dzdA  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    1e-67  42%  1ny5B  [c.23.1 - c.37.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    1e-67  42%  1ny5A  [c.23.1 - c.37.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    3e-64  46%  1ojlD  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN ZRAR
    6e-61  46%  1ojlE  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN ZRAR
    2e-60  46%  1ojlA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN ZRAR
    9e-60  50%  1ojlC  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN ZRAR
    9e-60  50%  1ojlB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN ZRAR
    3e-57  49%  1ny6L  [c.37.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    3e-57  49%  1ny6H  [c.37.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    3e-57  49%  1ny6C  [c.37.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    3e-57  49%  1ny6B  [c.37.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    3e-57  49%  1ny6A  [c.37.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    6e-57  50%  1ojlF  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN ZRAR
    1e-53  46%  2c99A  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    1e-53  46%  2viiA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    1e-53  46%  2c98A  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    5e-53  45%  2c9cA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    6e-53  46%  2bjwA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    9e-50  46%  2bjvA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    3e-49  44%  2c96A  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    2e-26  51%  1qkkA  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    2e-26  51%  1l5zA  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    2e-26  51%  1l5yB  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    2e-26  51%  1l5yA  [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    1e-19  47%  1dbwB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-19  47%  1dbwA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    2e-19  47%  1dcmA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-17  47%  1d5wB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-17  47%  1d5wA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    3e-17  38%  1yioA  [x.x.x] RESPONSE REGULATORY PROTEIN
    5e-16  35%  1dc7A  [c.23.1] NITROGEN REGULATION PROTEIN
    6e-14  33%  3jteA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    6e-14  34%  1dc8A  [c.23.1] NITROGEN REGULATION PROTEIN
    2e-13  32%  1zitA  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    5e-12  31%  1zesC  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    5e-12  31%  1zesA  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    5e-12  31%  2iynB  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    5e-12  31%  1b00A  [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    8e-11  32%  1zesB  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    8e-11  31%  2jbaA  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-10  29%  2jb9B  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-10  29%  2jb9A  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-10  30%  3cfyA  [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN
    2e-10  30%  2jbaB  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    4e-10  32%  1zy2B  [x.x.x] TRANSCRIPTIONAL REGULATOR NTRC1
    4e-10  32%  1zy2A  [x.x.x] TRANSCRIPTIONAL REGULATOR NTRC1
    9e-10  33%  2iynA  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    7e-09  32%  2oqrA  [x.x.x] SENSORY TRANSDUCTION PROTEIN REGX3
    1e-08  27%  1tmyA  [c.23.1 (1u0sY)] CHEY PROTEIN
    1e-08  27%  2pl1A  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
    1e-08  27%  2pkxB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
    1e-08  27%  2pkxA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
    2e-08  33%  2iynC  [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    2e-08  25%  1mvoA  [c.23.1] PHOP RESPONSE REGULATOR
    3e-08  32%  3ffxA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    3e-08  31%  3eulC  [x.x.x] POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL
    3e-08  31%  3eulB  [x.x.x] POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL
    3e-08  31%  3eulA  [x.x.x] POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL
    8e-08  29%  3eodA  [x.x.x] PROTEIN HNR
    1e-07  28%  3cu5B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    2e-07  36%  2qr3A  [x.x.x] TWO-COMPONENT SYSTEM RESPONSE REGULATOR
    7e-07  30%  3ffwA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    9e-07  30%  3fftA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    1e-06  26%  2qxyB  [x.x.x] RESPONSE REGULATOR
    1e-06  26%  2qxyA  [x.x.x] RESPONSE REGULATOR
    1e-06  30%  2j8eA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    2e-06  29%  2vuiB  [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-06  23%  1nxpA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    2e-06  29%  2jk1A  [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-06  23%  2a9oA  [x.x.x] RESPONSE REGULATOR
    2e-06  34%  1a2oA  [c.23.1 - c.40.1] CHEB METHYLESTERASE
    3e-06  28%  1xheB  [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
    3e-06  28%  1xheA  [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
    3e-06  30%  3f7nA  [x.x.x] CHEMOTAXIS PROTEIN CHEY
    3e-06  25%  3dgfC  [x.x.x] RESPONSE REGULATOR
    3e-06  25%  3dgeC  [x.x.x] RESPONSE REGULATOR
    4e-06  30%  1xhfA  [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
    4e-06  28%  2vuhB  [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN
    4e-06  27%  1p6qA  [c.23.1] CHEY2
    4e-06  29%  3gt7A  [x.x.x] SENSOR PROTEIN
    6e-06  24%  2zayA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    6e-06  30%  1d4zA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    6e-06  30%  3cu5A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    8e-06  29%  1jbeA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    8e-06  34%  3hdvD  [x.x.x] RESPONSE REGULATOR
    8e-06  34%  3hdvC  [x.x.x] RESPONSE REGULATOR
    8e-06  34%  3hdvB  [x.x.x] RESPONSE REGULATOR
    8e-06  34%  3hdvA  [x.x.x] RESPONSE REGULATOR
    8e-06  31%  3cg0B  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    8e-06  31%  3cg0A  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    8e-06  32%  3b2nA  [x.x.x] UNCHARACTERIZED PROTEIN Q99UF4
    1e-05  32%  1w25A  [c.23.1 - c.23.1 - d.58.29] STALKED-CELL DIFFERENTIATION
    1e-05  32%  2v0nA  [x.x.x] RESPONSE REGULATOR PLED
    1e-05  30%  1udrB  [c.23.1] CHEY PROTEIN
    1e-05  30%  1udrA  [c.23.1] CHEY PROTEIN
    1e-05  25%  1sd5A  [c.23.1] PUTATIVE ANTITERMINATOR
    1e-05  25%  1s8nA  [c.23.1] PUTATIVE ANTITERMINATOR
    1e-05  23%  2ayzA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    1e-05  23%  2ayxA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    2e-05  30%  1ab5A  [c.23.1] CHEY
    3e-05  24%  1ys7B  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    3e-05  24%  1ys7A  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    3e-05  24%  1ys6B  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
    4e-05  30%  1mihA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    6e-05  30%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    6e-05  27%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    8e-05  28%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    8e-05  23%  2a9qA  [x.x.x] RESPONSE REGULATOR
    1e-04  23%  2zwmA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN YYCF
    1e-04  29%  2cheA  [x.x.x] CHEY
    1e-04  29%  1f4vC  [c.23.1] CHEMOTAXIS CHEY PROTEIN
    1e-04  29%  1djmA  [c.23.1] CHEMOTAXIS PROTEIN Y
    1e-04  29%  1cyeA  [x.x.x] CHEY
    1e-04  29%  3chyA  [c.23.1 (1a0oA)] CHEY
    1e-04  29%  1chnA  [x.x.x] CHEY
    2e-04  27%  3crnB  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    2e-04  27%  3crnA  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    2e-04  22%  2a9rA  [x.x.x] DNA-BINDING RESPONSE REGULATOR
    2e-04  29%  5chyA  [x.x.x] CHEY
    3e-04  29%  1e6kA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-04  29%  1ymvA  [x.x.x] CHEY
    4e-04  29%  1ymuA  [c.23.1] CHEY
    5e-04  22%  1nxtA  [c.23.1] DNA-BINDING RESPONSE REGULATOR
    7e-04  24%  1zh4A  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    7e-04  24%  1zh2B  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    7e-04  24%  1zh2A  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    0.001  26%  3h5iA  [x.x.x] RESPONSE REGULATOR/SENSORY BOX PROTEIN/GGDEF
    0.001  28%  1ehcA  [x.x.x] CHEY
:444

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIAMQDGLRVLFVEDEPLVRQATAQSLELAGFSVLALPSAEAAMPHLGADFPGVLVTDVRLSGASGLDLL
3dzdA           --------RVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKELFFPVIVLDVWPDG-DGVNFI
1ny5B           -------MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNXXXXXXXXXXXNGLEIL
1ny5A           -------MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNXXXXXXXXXXXNGLEIL
1ojlD           ----------------------------------------------------------------------
1ojlE           ----------------------------------------------------------------------
1ojlA           ----------------------------------------------------------------------
1ojlC           ----------------------------------------------------------------------
1ojlB           ----------------------------------------------------------------------
1ny6L           ----------------------------------------------------------------------
1ny6H           ----------------------------------------------------------------------
1ny6C           ----------------------------------------------------------------------
1ny6B           ----------------------------------------------------------------------
1ny6A           ----------------------------------------------------------------------
1ojlF           ----------------------------------------------------------------------
2c99A           ----------------------------------------------------------------------
2viiA           ----------------------------------------------------------------------
2c98A           ----------------------------------------------------------------------
2c9cA           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
2c96A           ----------------------------------------------------------------------
1qkkA           ---------VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALF
1l5zA           ---------VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALF
1l5yB           ---------VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALF
1l5yA           ---------VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALF
1dbwB           ---MQD-YTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELL
1dbwA           ---MQD-YTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELL
1dcmA           ---------VHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELL
1d5wB           ---MQD-YTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVT-LRMPDMSGVELL
1d5wA           ---MQD-YTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVT-LRMPDMSGVELL
1yioA           ---------VFVVDDDMSVREGLRNLLRSAGFEVETFDCASTFLEHRRPEQHGCLVLDMRMPGMSGIELQ
1dc7A           ---MQRGI-VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALL
3jteA           --------KILVIDDESTILQNIKFLLEIDGNEVLTASSSTEGLRIFNCNSIDVVITDMKMPKLSGMDIL
1dc8A           ---MQRGI-VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLS-IRMPGMDGLALL
1zitA           --------RVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKELFFPVIVLDVWMPDGDGVNFI
1zesC           --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
1zesA           --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
2iynB           --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
1b00A           --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
1zesB           --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL--NWPDLILLDWMLPGGSGIQFI
2jbaA           --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFI
2jb9B           --------RILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLEWMLPGGSGIQFI
2jb9A           --------RILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLEWMLPGGSGIQFI
3cfyA           --------RVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKPQLIILDLKLPDMSGEDVL
2jbaB           --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFI
1zy2B           -------MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNXXXXXXX-PDVNGLEIL
1zy2A           -------MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNXXXXXXX-PDVNGLEIL
2iynA           --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
2oqrA           ---------VLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTDVC
1tmyA           ------GKRVLIVDDAAFMRMMLKDIITKAGYEVAGATNGREAVEKYKELKPDIVTMDITMPEMNGIDAI
2pl1A           --------RVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHIPDIAIVDLGLPDEDGLSLI
2pkxB           --------RVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHIPDIAIVDLGLPDEDGLSLI
2pkxA           --------RVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHIPDIAIVDLGLPDEDGLSLI
2iynC           --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
1mvoA           --------KILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLDGIEVC
3ffxA           -------LKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWRMPNMDGLELL
3eulC           -------VRVVVGDDHPLFREGVVRALSLSG-SVNVVGEADAALELIKAHLPDVALLDYRMPGMDGAQVA
3eulB           -------VRVVVGDDHPLFREGVVRALSLSG-SVNVVGEADAALELIKAHLPDVALLDYRMPGMDGAQVA
3eulA           -------VRVVVGDDHPLFREGVVRALSLSG-SVNVVGEADAALELIKAHLPDVALLDYRMPGMDGAQVA
3eodA           ------GKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDI-----AGLKLL
3cu5B           -------LRILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQIALPNVLLTDVRMPRMDGIELV
2qr3A           ---------------------------------------------------PEVVLLDMNFTSNEGLFWL
3ffwA           -------LKFLVVDDQSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELL
3fftA           -------LKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
2qxyB           ------------VDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREKIDLVFVDV-FEGEESLNLI
2qxyA           ------------VDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREKIDLVFVDV-FEGEESLNLI
2j8eA           -------LKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWMMPNMDGLELL
2vuiB           ---------ILLVDDEPHSLAAMKLALE-DDFDVLTAQGXXXXXXXXXXXWVQVIICDQRMPGRTGVDFL
1nxpA           --------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVA
2jk1A           ---------ILLVDDEPHSLAAMKLALE-DDFDVLTAQGXXXXXXXXXXXWVQVIICDQRMPGRTGVDFL
2a9oA           --------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVA
1a2oA           -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
1xheB           ---------ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLA
1xheA           ---------ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLA
3f7nA           -------LKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWMMPNMDGLELL
3dgfC           --------KVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVL
3dgeC           --------KVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVL
1xhfA           ---------ILIVEDELVTRNTLKSIFEAEGYDVFE--ATDGAEHQILSEYDINLVIDINLPGKNGLLLA
2vuhB           ---------ILLVDDEPHSLAAMKLALE-DDFDVLTAQGXXXXXXXXXXXWVQVIICEQRMPGRTGVDFL
1p6qA           -MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLL
3gt7A           ---------ILIVEDSPTQAEHLKHILEETGYQTEHVRNGREAVRFLSLTRPDLIISDVLMPEMDGYALC
2zayA           --------RIMLVDTQXXXXXXXXXXXXQEGFDIIQCGNAIEAVPVAVKTHPHLIITEANMPKISGMDLF
1d4zA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
3cu5A           -------LRILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQIALPNVLLTDVRMPRMDGIELV
1jbeA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
3hdvD           ---------VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLITDLR-QPESGLDLI
3hdvC           ---------VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLITDLR-QPESGLDLI
3hdvB           ---------VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLITDLR-QPESGLDLI
3hdvA           ---------VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLITDLR-QPESGLDLI
3cg0B           ---------VLIVEDGRLAAATLRIQLESLGYDVLGVDNGEEAVRCAPDLRPDIALVDIMLCGA--LDGV
3cg0A           ---------VLIVEDGRLAAATLRIQLESLGYDVLGVDNGEEAVRCAPDLRPDIALVDIMLCGA--LDGV
3b2nA           ---------LIIAEDQNMLRQAMVQLIKLHGFEILATDNGLDAMKLIEEYNPNVVILDIEMPGMTGLEVL
1w25A           --------RILVVDDEANVRLLEAK-LTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMDGFTVC
2v0nA           --------RILVVDDEANVRLLEAK-LTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMDGFTVC
1udrB           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1udrA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1sd5A           --------RVLIAEDEALIRMDLAEMLREEGYEIVGAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAA
1s8nA           --------RVLIAEDEALIRMDLAEMLREEGYEIVGAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAA
2ayzA           -VSDNDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLT
2ayxA           -VSDNDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLT
1ab5A           -------LKFLVVDDNSTMRRITRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1ys7B           ------------------------RGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVV
1ys7A           ------------------------RGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVV
1ys6B           ------------------------RGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVV
1mihA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWRMPNMDGLELL
3cwoX           ------GKRVLIVDDATNGREAVEKYKELK---------------------PDIVTMDITMPEMNGIDAI
3breB           ---LDGAVMVLLVDDQAMIGEAVRRSLASAGIDFHFCSDPQQAVAVANQIKPTVILQDLVMPGVDGLTLL
3breA           ---------VLLVDDQAMIGEAVRRSLASAGIDFHFCSDPQQAVAVANQIKPTVILQDLVMPGVDGLTLL
2a9qA           --------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDL-----DGLEVA
2zwmA           --------KILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVC
2cheA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELL
1f4vC           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1djmA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1cyeA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
3chyA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1chnA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
3crnB           --------RILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFN-LALFIKLPD-EGTELL
3crnA           --------RILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFN-LALFIKLPD-EGTELL
2a9rA           --------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIIL-LMLPEIDGLEVA
5chyA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1e6kA           -------LKFLVVADFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1ymvA           -------LKFLVVDDGGTGRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1ymuA           -------LKFLVVDDFSTGRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1nxtA           --------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIIL---LMLPDGLEVA
1zh4A           ---------VLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKXXXXXXXXXXXXXXXXEFI
1zh2B           ---------VLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKXXXXXXXXXXXXXXXXEFI
1zh2A           ---------VLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKXXXXXXXXXXXXXXXXEFI
3h5iA           --------KILIVEDSKFQAKTIANILNKYGYTVEIALTGEAAVEKVGGWYPDLILMDIEL--GEGMDGV
1ehcA           -------LKFLVVDKFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL


                         .         .         *         .         .         .         .:140
query           QHCRNAAPGVPVILVTGHGDITMAVQAMREGAYDFIEKPFGADXXXXXXXXXXXXXXXXXXXXXXXXXXX
3dzdA           DFIKENSPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVERFLLTIKHAFEEYSKKAP---------
1ny5B           KWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIXXXXXXXXXXXXXXXXX
1ny5A           KWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIXXXXXXXXXXXXXXXXX
1ojlD           ----------------------------------------------------------------------
1ojlE           ----------------------------------------------------------------------
1ojlA           ----------------------------------------------------------------------
1ojlC           ----------------------------------------------------------------------
1ojlB           ----------------------------------------------------------------------
1ny6L           ----------------------------------------------------------------------
1ny6H           ----------------------------------------------------------------------
1ny6C           ----------------------------------------------------------------------
1ny6B           ----------------------------------------------------------------------
1ny6A           ----------------------------------------------------------------------
1ojlF           ----------------------------------------------------------------------
2c99A           ----------------------------------------------------------------------
2viiA           ----------------------------------------------------------------------
2c98A           ----------------------------------------------------------------------
2c9cA           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
2c96A           ----------------------------------------------------------------------
1qkkA           RKILALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAAD---------------------------
1l5zA           RKILALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAAD---------------------------
1l5yB           RKILALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAAD---------------------------
1l5yA           RKILALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAAD---------------------------
1dbwB           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPF------------------------------
1dbwA           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPF------------------------------
1dcmA           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPF------------------------------
1d5wB           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPF------------------------------
1d5wA           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPF------------------------------
1yioA           EQLTAISDGIPIVFITAHGDIPMTVRAMKAGAIEFLPKPF------------------------------
1dc7A           KQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDID---------------------------
3jteA           REIKKITPHMAVIILTGHGDLDNAILAMKEGAFEYLRKPVTA----------------------------
1dc8A           KQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDID---------------------------
1zitA           DFIKENSPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVE---------------------------
1zesC           KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
1zesA           KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
2iynB           KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
1b00A           KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
1zesB           KHLKRESMDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
2jbaA           KHLRSMTRDIPVVMLTARGEEEDRVRGLETGADDCITKPF------------------------------
2jb9B           KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
2jb9A           KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
3cfyA           DWINQNDIPTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINAD---------------------------
2jbaB           KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDCITKPF------------------------------
1zy2B           KWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKP-------------------------------
1zy2A           KWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKP-------------------------------
2iynA           KHLKSMTRDIPVVMLTARGE---------TGADDYITKPF------------------------------
2oqrA           KQLR-ARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSA----------------------------
1tmyA           KEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPF------------------------------
2pl1A           RRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPF------------------------------
2pkxB           RRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPF------------------------------
2pkxA           RRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPF------------------------------
2iynC           KHLKSMTRDIPVVMLTA------------TGADDYITKPF------------------------------
1mvoA           KQLRQQKLMFPILMLTAKDEEFDKVLGLELGADDYMTKPF------------------------------
3ffxA           KTIRGAMSALPVLMVTAHAKKENIIAAAQAGASGYVVKPFTA----------------------------
3eulC           AAVRSYELPTRVLLISAHDEPAIVYQALQQGAAGFLLK--------------------------------
3eulB           AAVRSYELPTRVLLISAHDEPAIVYQALQQGAAGFLLK--------------------------------
3eulA           AAVRSYELPTRVLLISAHDEPAIVYQALQQGAAGFLLK--------------------------------
3eodA           EHIRNRGDQTPVLVISATENMADIAKALRLGVEDVLLKP-------------------------------
3cu5B           DNILKLYPDCSVIFMSGYSDKEYLKAAIKFRAIRYVEKP-------------------------------
2qr3A           HEIKRQYRDLPVVLFTAYADIDLAVRGIKEGASDFVVKPW------------------------------
3ffwA           KTIRGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTA----------------------------
3fftA           KTIRGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTA----------------------------
2qxyB           RRIREEFPDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLD---------------------------
2qxyA           RRIREEFPDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLD---------------------------
2j8eA           KTIRGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTA----------------------------
2vuiB           TEVRERWPETVRIIITGYTDSASMMAAINDGIHQFLTKPW------------------------------
1nxpA           KTIRKTS-SVPILMLSAKDSEFDKVIGLELGADDYVTKPF------------------------------
2jk1A           TEVRERWPETVRIIITGYTDSASMMAAINDGIHQFLTKPW------------------------------
2a9oA           KTIRKTS-SVPILMLSAKDSEFDKVIGLELGADDYVTKPF------------------------------
1a2oA           EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
1xheB           RELREQA-NVALMFLTGRDNEVDKILGLEIGADDYITKPF------------------------------
1xheA           RELREQA-NVALMFLTGRDNEVDKILGLEIGADDYITKPF------------------------------
3f7nA           KTIRGAMSALPVLMVTALAKKENIIAAAQAGASGYVVKPFTA----------------------------
3dgfC           KKLQEKEEWIPVIVLTAKGGEEDESLALSLGARKVMRKPF------------------------------
3dgeC           KKLQEKEEWIPVIVLTAKGGEEDESLALSLGARKVMRKPF------------------------------
1xhfA           RELREQAN--VALFLTGRDNEVDKILGLEIGADDYITKPF------------------------------
2vuhB           TEVRERWPETVRIIITGYTDSASMMAAINDGIHQFLTKPW------------------------------
1p6qA           QAVRAATKKAAFIILTAQGDRALVQKAAALGANNVLAKPF------------------------------
3gt7A           RWLKGQPDTIPVILLTILSDPRDVVRSLECGADDFITKP-------------------------------
2zayA           NSLKKQTASIPVIALSGRATAKEEAQLLDMGFIDFIAKPVNA----------------------------
1d4zA           KTIRGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTA----------------------------
3cu5A           DNILKLYPDCSVIFMSGYSD-KEYLRAIR-----YVEKP-------------------------------
1jbeA           KTIRAAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
3hdvD           RTIRSERAALSIIVVSGDTDVEEAVD-VHLGVVDFLLKP-------------------------------
3hdvC           RTIRSERAALSIIVVSGDTDVEEAVD-VHLGVVDFLLKP-------------------------------
3hdvB           RTIRSERAALSIIVVSGDTDVEEAVD-VHLGVVDFLLKP-------------------------------
3hdvA           RTIRSERAALSIIVVSGDTDVEEAVD-VHLGVVDFLLKP-------------------------------
3cg0B           ETAARLAAGLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAAD---------------------------
3cg0A           ETAARLAAGLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAAD---------------------------
3b2nA           AEIRKKHLNIKVIIVT------------------------------------------------------
1w25A           RKLKDTTRHIPVVLITGRGD---RIQGLESGASDFLTKP-------------------------------
2v0nA           RKLKDTTRHIPVVLITGRGD---RIQGLESGASDFLTKP-------------------------------
1udrB           KTIRGAMSALPVLMVTAEADAENIKALAQAGASGYVVKPFTA----------------------------
1udrA           KTIRGAMSALPVLMVTAEADAENIKALAQAGASGYVVKPFTA----------------------------
1sd5A           SEIASKRI-APIVVLTAFSQRDLVERARDAGAMAYLVKPF------------------------------
1s8nA           SEIASKRI-APIVVLTAFSQRDLVERARDAGAMAYLVKPF------------------------------
2ayzA           QRIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLD---------------------------
2ayxA           QRIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLD---------------------------
1ab5A           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
1ys7B           TALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPF------------------------------
1ys7A           TALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPF------------------------------
1ys6B           TALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPF------------------------------
1mihA           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
3cwoX           KEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFI----------------------------------
3breB           AAYRGATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVK--------------------------------
3breA           AAYRGATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVK--------------------------------
2a9qA           KTIRKTS-SVPILMLSAKDSEFDKVIGLELGADDYVTKPF------------------------------
2zwmA           REVRKKYD-MPIIMLTAKDSEIDKVIGLEIGADDYVTKPF------------------------------
2cheA           KTIRSAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
1f4vC           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
1djmA           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
1cyeA           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
3chyA           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
1chnA           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
3crnB           EKAHKLRPGKKI--VTGYASLENSVFSLNAGADAYIK---------------------------------
3crnA           EKAHKLRPGKKI--VTGYASLENSVFSLNAGADAYIK---------------------------------
2a9rA           KTIRKTS-SVPILMLSAKDSEFDKVIGLELGADDYVTKPF------------------------------
5chyA           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGWVVKPFTA----------------------------
1e6kA           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
1ymvA           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
1ymuA           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
1nxtA           KTIRKTS-SVPILMLSAKDSEFDKVIGLELGADDYVTKPF------------------------------
1zh4A           RDLRQWS-AVPVIVLSARSEESDKIAALDAGADDYLSKPFG-----------------------------
1zh2B           RDLRQWS-AVPVIVLSARSEESDKIAALDAGADDYLSKPFG-----------------------------
1zh2A           RDLRQWS-AVPVIVLSARSEESDKIAALDAGADDYLSKPFG-----------------------------
3h5iA           QTALQQISELPVVFLTAHTEPAVVEKIRSVTAYGYVMK--------------------------------
1ehcA           KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------


                         +         .         .         .         .         *         .:210
query           GPAAGTRIIGRSPAIAQVRDLIANVAATDVPVMINGETGTGKELVARSLHALSTRRDQPFIALNCGAVPE
3dzdA           -PQEEIEFVGEHPKILEIKRLIPKIAKSKAPVLITGESGTGKEIVARLIHRYSGRKGA-FVDLNCASIPQ
1ny5B           XXXXX--YVFESPXXXXXXXXXXXXSCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPR
1ny5A           XXXXX--YVFESPXXXXXXXXXXXXSCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPR
1ojlD           -------MIGSSPAMQHLLNEIAMVAPSDATVLIHGDSGTGKELVARALHACSARSDRPLVTLNCAALNX
1ojlE           -------MIGSSPAMQHLLNEIAMVAPSDATVLIHGDSGTGKELVARALHACSARSDRPLVTLNCAALNX
1ojlA           -------MIGSSPAMQHLLNEIAMVAPSDATVLIHGDSGTGKELVARALHACSARSDRPLVTLNCAALNX
1ojlC           -----SHMIGSSPAMQHLLNEIAMVAPSDATVLIHGDSGTGKELVARALHACSARSDRPLVTLNCAALNX
1ojlB           -----SHMIGSSPAMQHLLNEIAMVAPSDATVLIHGDSGTGKELVARALHACSARSDRPLVTLNCAALNX
1ny6L           -------------------------SCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPR
1ny6H           -------------------------SCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPR
1ny6C           -------------------------SCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPR
1ny6B           -------------------------SCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPR
1ny6A           -------------------------SCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPR
1ojlF           -------MIGSSPAMQHLLNEIAMVAPSDATVLIHGDSGTGKELVARALHACSARSDRPLVTLNCAALNX
2c99A           -------LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2viiA           -------LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2c98A           -------LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2c9cA           -------LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2bjwA           --------LGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2bjvA           ---------GEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2c96A           -------LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1yioA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1zy2B           ----------------------------------------------------------------------
1zy2A           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
3eulC           ----------------------------------------------------------------------
3eulB           ----------------------------------------------------------------------
3eulA           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SIFESEMFGHEAGAFTGAGKRRVGKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGTLERLGSNTSIPI
3dzdA           ELAESELFGHEKGAFTGALTRKKGKLELADQGTLFLDEVGELDQRVQAKLLRVLETGSFTRLGGNQKIEV
1ny5B           DIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEV
1ny5A           DIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEV
1ojlD           XXXXXXXFGHEKGAFTGADKRREGRFVEADGGTLFLDEIGDISPLMQVRLLRAIQEREVQRVGSNQTISV
1ojlE           XXXXXXXFGHEKGAFT---KRREGRFVEADGGTLFLDEIGDISPLMQVRLLRAIQEREVQRVGSNQTISV
1ojlA           XXXXXXXFGHEKGAFT---KRREGRFVEADGGTLFLDEIGDISPLMQVRLLRAIQEREVQRVGSNQTISV
1ojlC           XXXXXXXFGHEKGAFTGADKRREGRFVEADGGTLFLDEIGDISPLMQVRLLRAIQEREVQRVGSNQTISV
1ojlB           XXXXXXXFGHEKGAFTGADKRREGRFVEADGGTLFLDEIGDISPLMQVRLLRAIQEREVQRVGSNQTISV
1ny6L           DIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEV
1ny6H           DIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEV
1ny6C           DIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEV
1ny6B           DIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEV
1ny6A           DIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEV
1ojlF           XXXXXXXFGHEKGAFT---KRREGRFVEADGGTLFLDEIGDISPLMQVRLLRAIQEREVQRVGSNQTISV
2c99A           NLLDSELFGHEA-------KRHPGRFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
2viiA           NLLDSELFGHEAQ------KRHPGRFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
2c98A           NLLDSELFGHEAQ------KRHPGRFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
2c9cA           NLLDSELFGHEA-------KRHPGRFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
2bjwA           NLLDSELFGHE--------KRHPGRFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
2bjvA           NLLDSELFGHE---------RHPGRFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGG--PLQV
2c96A           NLLDSELF-------------HPGRFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1yioA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1zy2B           ----------------------------------------------------------------------
1zy2A           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
3eulC           ----------------------------------------------------------------------
3eulB           ----------------------------------------------------------------------
3eulA           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DVRIIAASKGDMEALVAQGTFRQDLLYRLNVVTIPLPPLRERREDIVPLFEHFMLVAAVRYQRPAPILSE
3dzdA           DIRVISATNKNLEEEIKKGNFREDLYYRLSVFQIYLPPLRERGKDVILLAEYFLKKFAKEYKKNCFELSE
1ny5B           NVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTK
1ny5A           NVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTK
1ojlD           DVRLIAATHRDLAEEVSAGRFRQDLYYRLNVVAIEMPSLRQRREDIPLLADHFLRRFAERNRKVVKGFTP
1ojlE           DVRLIAATHRDLAEEVSAGRFRQDLYYRLNVVAIEMPSLRQRREDIPLLADHFLRRFAERNRKVVKGFTP
1ojlA           DVRLIAATHRDLAEEVSAGRFRQDLYYRLNVVAIEMPSLRQRREDIPLLADHFLRRFAERNRKVVKGFTP
1ojlC           DVRLIAATHRDLAEEVSAGRFRQDLYYRLNVVAIEMPSLRQRREDIPLLADHFLRRFAERNRKVVKGFTP
1ojlB           DVRLIAATHRDLAEEVSAGRFRQDLYYRLNVVAIEMPSLRQRREDIPLLADHFLRRFAERNRKVVKGFTP
1ny6L           NVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTK
1ny6H           NVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTK
1ny6C           NVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTK
1ny6B           NVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTK
1ny6A           NVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTK
1ojlF           DVRLIAATHRDLAEEVSAGRFRQDLYYRLNVVAIEMPSLRQRREDIPLLADHFLRRFAERNRKVVKGFTP
2c99A           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLPGFTE
2viiA           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLPGFTE
2c98A           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLPGFTE
2c9cA           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLPGFTE
2bjwA           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLPGFTE
2bjvA           NVRLVCATNADLPAMVNEGTFRADLLDALAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLPGFTE
2c96A           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLPGFTE
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1yioA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1zy2B           ----------------------------------------------------------------------
1zy2A           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
3eulC           ----------------------------------------------------------------------
3eulB           ----------------------------------------------------------------------
3eulA           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           MQRQQLMQRPWPGNVRELRNAADRLVLGVPEGGHAGGKADPVDESTPLRERMERYERAVIADTLARTGGA
3dzdA           ETKEYLKQE-WKGNVRELKNLIERAVI-------------------------------------------
1ny5B           SAQELLLSYPWYGNVRELKNVIERAVL-------------------------------------------
1ny5A           SAQELLLSYPWYGNVRELKNVIERAVL-------------------------------------------
1ojlD           QAMDLLIHYDWPGNIRELENAIERAVV-LLTGEYISERELPLAAATPIKEPLVDVEKEVILAALEKTGGN
1ojlE           QAMDLLIHYDWPGNIRELENAIERAVV-LLTGEYIS------ERELPLAIPLVDVEKEVILAALEKTGGN
1ojlA           QAMDLLIHYDWPGNIRELENAIERAVV-LLTGEYISERELPLGEIQPLVD----VEKEVILAALEKTGGN
1ojlC           QAMDLLIHYDWPGNIRELENAIERAVV-------------------------------------------
1ojlB           QAMDLLIHYDWPGNIRELENAIERAVV-------------------------------------------
1ny6L           SAQELLLSYPWYGNVRELKNVIERAVL-------------------------------------------
1ny6H           SAQELLLSYPWYGNVRELKNVIERAVL-------------------------------------------
1ny6C           SAQELLLSYPWYGNVRELKNVIERAVL-------------------------------------------
1ny6B           SAQELLLSYPWYGNVRELKNVIERAVL-------------------------------------------
1ny6A           SAQELLLSYPWYGNVRELKNVIERAVL-------------------------------------------
1ojlF           QAMDLLIHYDWPGNIRELENAIERAVV-------------------------------------------
2c99A           RARETLLNYRWPGNIRELKNVVERSV--------------------------------------------
2viiA           RARETLLNYRWPGNIRELKNVVERSV--------------------------------------------
2c98A           RARETLLNYRWPGNIRELKNVVERSV--------------------------------------------
2c9cA           RARETLLNYRWPGNIAELKNVVERSV--------------------------------------------
2bjwA           RARETLLNYRWPGNIRELKNVVERSV--------------------------------------------
2bjvA           RARETLLNYRWPGNIRELKNVVERSV--------------------------------------------
2c96A           RARETLLNYRWPGNIRELKNVVERSV--------------------------------------------
1qkkA           ----------------------------------------------------------------------
1l5zA           ----------------------------------------------------------------------
1l5yB           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1yioA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
3jteA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1zitA           ----------------------------------------------------------------------
1zesC           ----------------------------------------------------------------------
1zesA           ----------------------------------------------------------------------
2iynB           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1zesB           ----------------------------------------------------------------------
2jbaA           ----------------------------------------------------------------------
2jb9B           ----------------------------------------------------------------------
2jb9A           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
2jbaB           ----------------------------------------------------------------------
1zy2B           ----------------------------------------------------------------------
1zy2A           ----------------------------------------------------------------------
2iynA           ----------------------------------------------------------------------
2oqrA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
2pl1A           ----------------------------------------------------------------------
2pkxB           ----------------------------------------------------------------------
2pkxA           ----------------------------------------------------------------------
2iynC           ----------------------------------------------------------------------
1mvoA           ----------------------------------------------------------------------
3ffxA           ----------------------------------------------------------------------
3eulC           ----------------------------------------------------------------------
3eulB           ----------------------------------------------------------------------
3eulA           ----------------------------------------------------------------------
3eodA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
2qr3A           ----------------------------------------------------------------------
3ffwA           ----------------------------------------------------------------------
3fftA           ----------------------------------------------------------------------
2qxyB           ----------------------------------------------------------------------
2qxyA           ----------------------------------------------------------------------
2j8eA           ----------------------------------------------------------------------
2vuiB           ----------------------------------------------------------------------
1nxpA           ----------------------------------------------------------------------
2jk1A           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
1xheB           ----------------------------------------------------------------------
1xheA           ----------------------------------------------------------------------
3f7nA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1xhfA           ----------------------------------------------------------------------
2vuhB           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
3gt7A           ----------------------------------------------------------------------
2zayA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1jbeA           ----------------------------------------------------------------------
3hdvD           ----------------------------------------------------------------------
3hdvC           ----------------------------------------------------------------------
3hdvB           ----------------------------------------------------------------------
3hdvA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
1sd5A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1ys7B           ----------------------------------------------------------------------
1ys7A           ----------------------------------------------------------------------
1ys6B           ----------------------------------------------------------------------
1mihA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
2zwmA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1f4vC           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ymvA           ----------------------------------------------------------------------
1ymuA           ----------------------------------------------------------------------
1nxtA           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
3h5iA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VSQAADLLQVGKATLYDKIKRxxx
3dzdA           ------------------------
1ny5B           ------------------------
1ny5A           ------------------------
1ojlD           KTEAARQLGITRKTLLAKLSR---
1ojlE           KTEAARQLGITRKTLLAKLSR---
1ojlA           KTEAARQLGITRKTLLAKLSR---
1ojlC           ------------------------
1ojlB           ------------------------
1ny6L           ------------------------
1ny6H           ------------------------
1ny6C           ------------------------
1ny6B           ------------------------
1ny6A           ------------------------
1ojlF           ------------------------
2c99A           ------------------------
2viiA           ------------------------
2c98A           ------------------------
2c9cA           ------------------------
2bjwA           ------------------------
2bjvA           ------------------------
2c96A           ------------------------
1qkkA           ------------------------
1l5zA           ------------------------
1l5yB           ------------------------
1l5yA           ------------------------
1dbwB           ------------------------
1dbwA           ------------------------
1dcmA           ------------------------
1d5wB           ------------------------
1d5wA           ------------------------
1yioA           ------------------------
1dc7A           ------------------------
3jteA           ------------------------
1dc8A           ------------------------
1zitA           ------------------------
1zesC           ------------------------
1zesA           ------------------------
2iynB           ------------------------
1b00A           ------------------------
1zesB           ------------------------
2jbaA           ------------------------
2jb9B           ------------------------
2jb9A           ------------------------
3cfyA           ------------------------
2jbaB           ------------------------
1zy2B           ------------------------
1zy2A           ------------------------
2iynA           ------------------------
2oqrA           ------------------------
1tmyA           ------------------------
2pl1A           ------------------------
2pkxB           ------------------------
2pkxA           ------------------------
2iynC           ------------------------
1mvoA           ------------------------
3ffxA           ------------------------
3eulC           ------------------------
3eulB           ------------------------
3eulA           ------------------------
3eodA           ------------------------
3cu5B           ------------------------
2qr3A           ------------------------
3ffwA           ------------------------
3fftA           ------------------------
2qxyB           ------------------------
2qxyA           ------------------------
2j8eA           ------------------------
2vuiB           ------------------------
1nxpA           ------------------------
2jk1A           ------------------------
2a9oA           ------------------------
1a2oA           ------------------------
1xheB           ------------------------
1xheA           ------------------------
3f7nA           ------------------------
3dgfC           ------------------------
3dgeC           ------------------------
1xhfA           ------------------------
2vuhB           ------------------------
1p6qA           ------------------------
3gt7A           ------------------------
2zayA           ------------------------
1d4zA           ------------------------
3cu5A           ------------------------
1jbeA           ------------------------
3hdvD           ------------------------
3hdvC           ------------------------
3hdvB           ------------------------
3hdvA           ------------------------
3cg0B           ------------------------
3cg0A           ------------------------
3b2nA           ------------------------
1w25A           ------------------------
2v0nA           ------------------------
1udrB           ------------------------
1udrA           ------------------------
1sd5A           ------------------------
1s8nA           ------------------------
2ayzA           ------------------------
2ayxA           ------------------------
1ab5A           ------------------------
1ys7B           ------------------------
1ys7A           ------------------------
1ys6B           ------------------------
1mihA           ------------------------
3cwoX           ------------------------
3breB           ------------------------
3breA           ------------------------
2a9qA           ------------------------
2zwmA           ------------------------
2cheA           ------------------------
1f4vC           ------------------------
1djmA           ------------------------
1cyeA           ------------------------
3chyA           ------------------------
1chnA           ------------------------
3crnB           ------------------------
3crnA           ------------------------
2a9rA           ------------------------
5chyA           ------------------------
1e6kA           ------------------------
1ymvA           ------------------------
1ymuA           ------------------------
1nxtA           ------------------------
1zh4A           ------------------------
1zh2B           ------------------------
1zh2A           ------------------------
3h5iA           ------------------------
1ehcA           ------------------------