[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF07169.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3gwbB.bssp"
#ERROR : Can't open dsspfile "3gwbA.bssp"
#ERROR : Can't open dsspfile "1bccA.bssp"
#ERROR : Can't open dsspfile "1hr8D.bssp"
#ERROR : Can't open dsspfile "1hr7F.bssp"
#ERROR : Can't open dsspfile "1hr7D.bssp"
#ERROR : Can't open dsspfile "1hr7B.bssp"
#ERROR : Can't open dsspfile "1hr6H.bssp"
#ERROR : Can't open dsspfile "1hr6D.bssp"
#ERROR : Can't open dsspfile "1hr6B.bssp"

## Summary of PDB Search
:454
    1e-36  34%  3gwbB  [x.x.x] PEPTIDASE M16 INACTIVE DOMAIN FAMILY PROTEIN
    1e-36  34%  3gwbA  [x.x.x] PEPTIDASE M16 INACTIVE DOMAIN FAMILY PROTEIN
    7e-07  21%  1bccA  [d.185.1 - d.185.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    9e-07  22%  1hr8D  [d.185.1 - d.185.1] MITOCHONDRIAL PROCESSING PEPTIDASE BETA
    9e-07  22%  1hr7F  [d.185.1 - d.185.1] MITOCHONDRIAL PROCESSING PEPTIDASE BETA
    9e-07  22%  1hr7D  [d.185.1 - d.185.1] MITOCHONDRIAL PROCESSING PEPTIDASE BETA
    9e-07  22%  1hr7B  [d.185.1 - d.185.1] MITOCHONDRIAL PROCESSING PEPTIDASE BETA
    9e-07  22%  1hr6H  [d.185.1 - d.185.1] MITOCHONDRIAL PROCESSING PEPTIDASE BETA
    9e-07  22%  1hr6D  [d.185.1 - d.185.1] MITOCHONDRIAL PROCESSING PEPTIDASE BETA
    9e-07  22%  1hr6B  [d.185.1 - d.185.1] MITOCHONDRIAL PROCESSING PEPTIDASE BETA
:454

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIESWTASTGAKVFFVPSPSIPMLDVNIDFDAG
3gwbB           --------------------------------------VQTWSTAEGAKVLFVEARELPF-DLRLIFAAG
3gwbA           --------------------------------------VQTWSTAEGAKVLFVEARELPF-DLRLIFAAG
1bccA           ----------------------------------------------------------------------
1hr8D           ----------------------------------------------------------------------
1hr7F           ----------------------------------------------------------------------
1hr7D           ----------------------------------------------------------------------
1hr7B           ----------------------------------------------------------------------
1hr6H           ----------------------------------------------------------------------
1hr6D           ----------------------------------------------------------------------
1hr6B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SRYDPPXXXXXXXXXXXXXXXXXSAQDGQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPER
3gwbB           SSQD---------GNAPGVALLTNALNEGVAGKDVGAIAQGFEGLGADFGNGAYKDAVASLRSLSAVDKR
3gwbA           SSQD---------GNAPGVALLTNALNEGVAGKDVGAIAQGFEGLGADFGNGAYKDAVASLRSLSAVDKR
1bccA           ------------------------------------------------------------------SKDV
1hr8D           ----------------------------------------------------------------------
1hr7F           ----------------------------------------------------------------------
1hr7D           ----------------------------------------------------------------------
1hr7B           ----------------------------------------------------------------------
1hr6H           ----------------------------------------------------------------------
1hr6D           ----------------------------------------------------------------------
1hr6B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EQSLRLAAQLIKSPTYPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSIT
3gwbB           EPALKLFAEVVGKPTFPADSLARIKNQL-AGFEYQKQNPGKLASLEL-KRLYGTHPYAHASDAKSIPPIT
3gwbA           EPALKLFAEVVGKPTFPADSLARIKNQL-AGFEYQKQNPGKLASLEL-KRLYGTHPYAHASDAKSIPPIT
1bccA           PKAVELLADIVQNCSLEDSQIEKERDVIVRELQENDTSMREVVFNYLHATAFQGTAQSVEGPSENIRKLS
1hr8D           -KAVDILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGILGPIKNIKSIT
1hr7F           -KAVDILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGILGPIKNIKSIT
1hr7D           -KAVDILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGILGPIKNIKSIT
1hr7B           -KAVDILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGILGPIKNIKSIT
1hr6H           -KAVDILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGILGPIKNIKSIT
1hr6D           -KAVDILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGILGPIKNIKSIT
1hr6B           -KAVDILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGILGPIKNIKSIT


                         .         .         .         +         .         .         .:280
query           HDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPHPAQQ
3gwbB           LAQLKAFHAKAYAAGNVVIALVGDLSRSDAEAIAAQVSAALPKG---PALAKIEQPAKASIGHIEFPSSQ
3gwbA           LAQLKAFHAKAYAAGNVVIALVGDLSRSDAEAIAAQVSAALPKG---PALAKIEQPAKASIGHIEFPSSQ
1bccA           RADLTEYLSTHYTAPRMVLAAAGGVEHQQLLELAQKHFGGVPDDDAVPTLSKCRFTGSQIRHREDGPLAH
1hr8D           RTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHVPKSESPVPLGSPRGPLPVKENTLP----T
1hr7F           RTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHVPKSESPVPLGSPRGPLPVKENTLP----T
1hr7D           RTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHVPKSESPVPLGSPRGPLPVKENTLP----T
1hr7B           RTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHVPKSESPVPLGSPRGPLPVKENTLP----T
1hr6H           RTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHVPKSESPVPLGSPRGPLPVKENTLP----T
1hr6D           RTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHVPKSESPVPLGSPRGPLPVKENTLP----T
1hr6B           RTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHVPKSESPVPLGSPRGPLPVKENTLP----T


                         .         *         .         .         .         .         +:350
query           ASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTK
3gwbB           TSL-LAQLGIDRDDPDYAAVSLGNQILXXXXXXTRLS-EVREKRGLTYGVYSGFTPQAR-GPF-INLQTR
3gwbA           TSL-LAQLGIDRDDPDYAAVSLGNQILXXXXXXTRLS-EVREKRGLTYGVYSGFTPQAR-GPF-INLQTR
1bccA           VAIAVEGPGWAHPD--------------------------------------------------------
1hr8D           THIAIALEGVSWSAPDYF----------------------------------------------------
1hr7F           THIAIALEGVSWSAPDYF----------------------------------------------------
1hr7D           THIAIALEGVSWSAPDYF----------------------------------------------------
1hr7B           THIAIALEGVSWSAPDYF----------------------------------------------------
1hr6H           THIAIALEGVSWSAPDYF----------------------------------------------------
1hr6D           THIAIALEGVSWSAPDYF----------------------------------------------------
1hr6B           THIAIALEGVSWSAPDYF----------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWT
3gwbB           AESEG-TLKLVQDVFAEYLKNGPTQKELDDAKRELAGS-----ASNADIVGQL-GAGFYNLPLSYLEDF-
3gwbA           AESEG-TLKLVQDVFAEYLKNGPTQKELDDAKRELAGS---STASNADIVGQL-GAGFYNLPLSYLEDF-
1bccA           ----------------------------------------------------------------------
1hr8D           ----------------------------------------------------------------------
1hr7F           ----------------------------------------------------------------------
1hr7D           ----------------------------------------------------------------------
1hr7B           ----------------------------------------------------------------------
1hr6H           ----------------------------------------------------------------------
1hr6D           ----------------------------------------------------------------------
1hr6B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SQINKVTREQVRAAFQRHVHPDAMATVIVGGPxx
3gwbB           RQSQELTVEQVKAA-NKHLNVDKV--IVSAGP--
3gwbA           RQSQELTVEQVKAA-NKHLNVDKV--IVSAGP--
1bccA           ----------------------------------
1hr8D           ----------------------------------
1hr7F           ----------------------------------
1hr7D           ----------------------------------
1hr7B           ----------------------------------
1hr6H           ----------------------------------
1hr6D           ----------------------------------
1hr6B           ----------------------------------