[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF07698.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ke0A.bssp"
#ERROR : Can't open dsspfile "1fklA.bssp"
#ERROR : Can't open dsspfile "1tcoC.bssp"
#ERROR : Can't open dsspfile "2ppnA.bssp"
#ERROR : Can't open dsspfile "1bkfA.bssp"
#ERROR : Can't open dsspfile "2pppA.bssp"
#ERROR : Can't open dsspfile "2ppoA.bssp"
#ERROR : Can't open dsspfile "1yatA.bssp"
#ERROR : Can't open dsspfile "2pbcB.bssp"
#ERROR : Can't open dsspfile "2pbcA.bssp"
#ERROR : Can't open dsspfile "1eymA.bssp"
#ERROR : Can't open dsspfile "1bl4A.bssp"
#ERROR : Can't open dsspfile "2dg4A.bssp"
#ERROR : Can't open dsspfile "2dg9A.bssp"
#ERROR : Can't open dsspfile "1u79A.bssp"
#ERROR : Can't open dsspfile "1c9hA.bssp"
#ERROR : Can't open dsspfile "1rotA.bssp"
#ERROR : Can't open dsspfile "1q1cA.bssp"
#ERROR : Can't open dsspfile "1jvwA.bssp"
#ERROR : Can't open dsspfile "2vn1B.bssp"
#ERROR : Can't open dsspfile "2vn1A.bssp"
#ERROR : Can't open dsspfile "2ofnA.bssp"
#ERROR : Can't open dsspfile "2uz5A.bssp"
#ERROR : Can't open dsspfile "1fd9A.bssp"
#ERROR : Can't open dsspfile "1r9hA.bssp"
#ERROR : Can't open dsspfile "1n1aA.bssp"
#ERROR : Can't open dsspfile "1q6uA.bssp"
#ERROR : Can't open dsspfile "1q6hA.bssp"
#ERROR : Can't open dsspfile "1kt0A.bssp"
#ERROR : Can't open dsspfile "1pbkA.bssp"
#ERROR : Can't open dsspfile "1kt1A.bssp"
#ERROR : Can't open dsspfile "3b7xA.bssp"
#ERROR : Can't open dsspfile "1ix5A.bssp"
#ERROR : Can't open dsspfile "2f2dA.bssp"
#ERROR : Can't open dsspfile "2awgA.bssp"
#ERROR : Can't open dsspfile "2if4A.bssp"
#ERROR : Can't open dsspfile "2f4eB.bssp"
#ERROR : Can't open dsspfile "2f4eA.bssp"
#ERROR : Can't open dsspfile "1l1pA.bssp"

## Summary of PDB Search
:115
    2e-45  77%  2ke0A  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    4e-26  56%  1fklA  [x.x.x] FK506 BINDING PROTEIN
    5e-26  56%  1tcoC  [d.26.1] FK506-BINDING PROTEIN
    2e-25  55%  2ppnA  [d.26.1 (1a7xA)] FK506-BINDING PROTEIN 1A
    2e-25  54%  1bkfA  [x.x.x] FK506 BINDING PROTEIN
    3e-25  55%  2pppA  [x.x.x] FK506-BINDING PROTEIN 1A
    6e-25  55%  2ppoA  [x.x.x] FK506-BINDING PROTEIN 1A
    9e-25  58%  1yatA  [x.x.x] FK506 BINDING PROTEIN
    9e-25  55%  2pbcB  [x.x.x] FK506-BINDING PROTEIN 2
    9e-25  55%  2pbcA  [x.x.x] FK506-BINDING PROTEIN 2
    9e-25  54%  1eymA  [d.26.1] FK506 BINDING PROTEIN
    1e-24  54%  1bl4A  [d.26.1] PROTEIN (FK506 BINDING PROTEIN)
    3e-24  54%  2dg4A  [x.x.x] FK506-BINDING PROTEIN 1A
    6e-24  54%  2dg9A  [x.x.x] FK506-BINDING PROTEIN 1A
    2e-23  54%  1u79A  [d.26.1] FKBP-TYPE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 3
    2e-23  51%  1c9hA  [d.26.1] FKBP12.6
    3e-22  55%  1rotA  [x.x.x] FKBP59-I
    2e-21  53%  1q1cA  [d.26.1 - d.26.1] FK506-BINDING PROTEIN 4
    1e-19  49%  1jvwA  [d.26.1] MACROPHAGE INFECTIVITY POTENTIATOR
    1e-18  49%  2vn1B  [x.x.x] 70 KDA PEPTIDYLPROLYL ISOMERASE
    1e-18  49%  2vn1A  [x.x.x] 70 KDA PEPTIDYLPROLYL ISOMERASE
    1e-18  49%  2ofnA  [x.x.x] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE
    2e-18  47%  2uz5A  [x.x.x] MACROPHAGE INFECTIVITY POTENTIATOR
    2e-18  47%  1fd9A  [d.26.1] PROTEIN (MACROPHAGE INFECTIVITY POTENTIATOR
    4e-18  54%  1r9hA  [d.26.1] FK506 BINDING PROTEIN FAMILY
    9e-18  52%  1n1aA  [d.26.1] FKBP52
    2e-15  41%  1q6uA  [d.26.1] FKBP-TYPE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    2e-15  41%  1q6hA  [d.26.1] FKBP-TYPE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    4e-14  52%  1kt0A  [d.26.1 - d.26.1 - a.118.8] 51 KDA FK506-BINDING PROTEIN
    4e-13  44%  1pbkA  [x.x.x] FKBP25
    7e-12  50%  1kt1A  [d.26.1 - d.26.1 - a.118.8] FK506-BINDING PROTEIN FKBP51
    4e-08  36%  3b7xA  [x.x.x] FK506-BINDING PROTEIN 6
    3e-06  42%  1ix5A  [d.26.1] FKBP
    3e-06  41%  2f2dA  [x.x.x] 38 KDA FK-506 BINDING PROTEIN HOMOLOG, FKBP38
    3e-06  41%  2awgA  [x.x.x] 38 KDA FK-506 BINDING PROTEIN
    6e-06  33%  2if4A  [x.x.x] ATFKBP42
    6e-06  33%  2f4eB  [x.x.x] ATFKBP42
    6e-06  33%  2f4eA  [x.x.x] ATFKBP42
    4e-04  30%  1l1pA  [d.26.1] TRIGGER FACTOR
:115

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQTTPSGLQFEDTVVGSGDEAKAGKHVTVHYTGWLFENGQAGRKFDSSKDRNDPFVFPLGAGHVIRGWDE
2ke0A           --TTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTD----GQKFDSSKDRNDPFAFVLGGGMVIKGWDE
1fklA           ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFVLGKQEVIRGWEE
1tcoC           ------GVQVETISPGDGRTPKAGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFMLGKQEVIRGWEE
2ppnA           ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFMLGKQEVIRGWEE
1bkfA           ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDKNKPFKFMLGKQEVIRGWEE
2pppA           ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFMLGKQEVIRGWQE
2ppoA           ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFMLGKQEVIRGWAE
1yatA           --------------ISPGDGAKTGDLVTIHYTGTL-ENGQ---KFDSSVDRGSPFQCNIGVGQVIKGWDV
2pbcB           ---------------GSPIKSRKGDVLHMHYTGKL----EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQ
2pbcA           ---------------GSPIKSRKGDVLHMHYTGKL----EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQ
1eymA           ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKMDSSRDRNKPFKFMLGKQEVIRGWEE
1bl4A           ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKVDSSRDRNKPFKFMLGKQEVIRGWEE
2dg4A           ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFMLGKQEVIRGFEE
2dg9A           ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFMLGKQEVIRGLEE
1u79A           ---SPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKL-ENGKV---FDSSYNRGKPLTFRIGVGEVIKGWDQ
1c9hA           ------GVEIETISPGDGRTPKKGQTCVVHYTGML----QNGKKFDSSRDRNKPFKFRIGKQEVIKGFEE
1rotA           ---------------GTGTETPMGDRVFVHYTGWLLD----GTKFDSSLDRKDKFSFDLGKGEVIKAWDI
1q1cA           ---------------GTGTEMPMGDRVFVHYTGWLLD----GTKFDSSLDRKDKFSFDLGKGEVIKAWDI
1jvwA           ----PSGLVFQRIARGSGKRAPADDKCEVHYTGRLRD----GTVFDSSRERGKPTTFR--PNEVIKGWTE
2vn1B           ------------TILKKGDEGKKGNEVTVHYVGKLESTGKV---FDSSFDRNVPFKFHLEQGEVIKGWDI
2vn1A           ------------TILKKGDEGKKGNEVTVHYVGKLESTGKV---FDSSFDRNVPFKFHLEQGEVIKGWDI
2ofnA           ------------TILKKGDEGKKGNEVTVHYVGKLESTGKV---FDSSFDRNVPFKFHLEQGEVIKGWDI
2uz5A           ----PSGLQYK--VINSGNGVKPGKSVTVEYTGRLID----GTVFDSTEKTGKPATFQVS--QVIPGWTE
1fd9A           ----PSGLQYK--VINSGNGVKPGKSVTVEYTGRLID----GTVFDSTEKTGKPATFQVS--QVIPGWTE
1r9hA           -----------------------------HYVGTL----ENGTKFDSSRDRGDQFSFNLGRGNVIKGWDL
1n1aA           ---------------GTGTEMPMGDRVFVHYTGWLLD----GTKFDSSLK----FSFDLGKGEVIKAWDI
1q6uA           VKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLID----GKEFDNSYTRGEPLSFRLDG--VIPGWTE
1q6hA           VKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLID----GKEFDNSYTRGEPLSFRLDG--VIPGWTE
1kt0A           -----------------------GDKVYVHYKGKLFDS---------------PFVFSLGKGQVIKAWDI
1pbkA           --------KYTKSVLKKGDKTKKGDVVHCWYTGTL----QDGTVFDTNKKNAKPLSFKVGVGKVIRGWDE
1kt1A           -------------IVHGEETPMIGDRVYVHYNGKLA----------------NPFVFSIGKGQVIKAWDI
3b7xA           ---------------GAGDLVAPDASVLVKYSGYL---EHMDRPFDSNLMKLEDIT--------LWGMEL
1ix5A           -----------------------GVKIKVDYIGKL----ESGDVFDTSPDREEPLEFVVGEGQLIQGFEE
2f2dA           -----NGLLRKKTLVGSSRPVK-GQVVTVHLQTSL-ENG--------TRVQEEPLVFTLGDCDVIQALDL
2awgA           -----NGLLRKKTLVGSSRPVK-GQVVTVHLQTSL-ENG--------TRVQEEPLVFTLGDCDVIQALDL
2if4A           -------------IIKEGHGSKPSKYSTLHYRAWT-KNSQ--HKFEDTWHEQQPIELVLGKEKKLAGLAI
2f4eB           -------------IIKEGHGSKPSKYSTLHYRAWT-KNSQ--HKFEDTWHEQQPIELVLGKEKKLAGLAI
2f4eA           -------------IIKEGHGSKPSKYSTLHYRAWT-KNSQ--HKFEDTWHEQQPIELVLGKEKKLAGLAI
1l1pA           ---------------------EAEDRVTIDFTGSV-----DGEEFEGGKASD--FVLAMGQGRMIPGFED


                         .         .         *         .         .         .         .:140
query           GVQGMKVGGTRRLVIPADLGYGARGAGGVIPPNATLLFEVELLAV
2ke0A           GVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
1fklA           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELL--
1tcoC           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL--
2ppnA           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL--
1bkfA           GVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELL--
2pppA           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL--
2ppoA           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL--
1yatA           GIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKV
2pbcB           GLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKI
2pbcA           GLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKI
1eymA           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL--
1bl4A           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL--
2dg4A           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL--
2dg9A           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL--
1u79A           GILGMLTGGKRTLRIPPELAYGDRGAGCLIPPASVLLFDIEYI--
1c9hA           GAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELL--
1rotA           AVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVEL---
1q1cA           AIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVEL---
1jvwA           ALQLMREGDRWRLFIPYDLAYGVTGGGGMIPPYSPLEFDVELISI
2vn1B           CVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLS-
2vn1A           CVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLS-
2ofnA           CVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLS-
2uz5A           ALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISV
1fd9A           ALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISV
1r9hA           GVATMTKGEVAEFTIRSDYGYGDAGSPPKIPGGATLIFEVEL---
1n1aA           AIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVEL---
1q6uA           XXXXXXXXXXXXXVIPPELAYGKAGVPG-IPPNSTLVFDVELLDV
1q6hA           XXXXXXXXXXXXXVIPPELAYGKAGVPG-IPPNSTLVFDVELLDV
1kt0A           GVATMKRGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELL--
1pbkA           ALLTMSKGEKARLEIEPEWAYGKKGPDAKIPPNAKLTFEVELVDI
1kt1A           GVATMKKGEICHLL----CAYGATGSLPKIPSNATLFFEVELL--
3b7xA           GLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELL--
1ix5A           AVLDMEVGDEKTVKIPAEKAYGNR---------------------
2f2dA           SVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTL---
2awgA           SVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTL---
2if4A           GVASMKSGERALVHVGWELAYGKEGNFSFVPPMADLLYEVEVI--
2f4eB           GVASMKSGERALVHVGWELAYGKEGNFSFVPPMADLLYEVEVI--
2f4eA           GVASMKSGERALVHVGWELAYGKEGNFSFVPPMADLLYEVEVI--
1l1pA           GIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVE----