[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF07787.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eh3A.bssp"
#ERROR : Can't open dsspfile "2qopA.bssp"
#ERROR : Can't open dsspfile "2fbqA.bssp"
#ERROR : Can't open dsspfile "2vkeA.bssp"
#ERROR : Can't open dsspfile "2tctA.bssp"
#ERROR : Can't open dsspfile "1orkA.bssp"
#ERROR : Can't open dsspfile "2o7oA.bssp"
#ERROR : Can't open dsspfile "1du7A.bssp"
#ERROR : Can't open dsspfile "3dpjF.bssp"
#ERROR : Can't open dsspfile "3dpjE.bssp"
#ERROR : Can't open dsspfile "3dpjB.bssp"
#ERROR : Can't open dsspfile "3dpjA.bssp"
#ERROR : Can't open dsspfile "1bjzA.bssp"
#ERROR : Can't open dsspfile "1bjyB.bssp"
#ERROR : Can't open dsspfile "1bj0A.bssp"
#ERROR : Can't open dsspfile "2zcnD.bssp"
#ERROR : Can't open dsspfile "2zcnB.bssp"
#ERROR : Can't open dsspfile "2zcnA.bssp"
#ERROR : Can't open dsspfile "2zcmB.bssp"
#ERROR : Can't open dsspfile "2zcmA.bssp"
#ERROR : Can't open dsspfile "3btiB.bssp"
#ERROR : Can't open dsspfile "3bt9B.bssp"
#ERROR : Can't open dsspfile "1qpiA.bssp"
#ERROR : Can't open dsspfile "2w53A.bssp"
#ERROR : Can't open dsspfile "2vprA.bssp"
#ERROR : Can't open dsspfile "2ns8D.bssp"
#ERROR : Can't open dsspfile "2ns8C.bssp"
#ERROR : Can't open dsspfile "2ns8A.bssp"
#ERROR : Can't open dsspfile "2ns7B.bssp"
#ERROR : Can't open dsspfile "3geuA.bssp"
#ERROR : Can't open dsspfile "2ns8B.bssp"
#ERROR : Can't open dsspfile "2ns7D.bssp"
#ERROR : Can't open dsspfile "2ns7A.bssp"
#ERROR : Can't open dsspfile "1zkgA.bssp"
#ERROR : Can't open dsspfile "1qvtB.bssp"
#ERROR : Can't open dsspfile "1jusB.bssp"
#ERROR : Can't open dsspfile "1jt6B.bssp"
#ERROR : Can't open dsspfile "1jt0D.bssp"
#ERROR : Can't open dsspfile "1jt0A.bssp"
#ERROR : Can't open dsspfile "3ih2A.bssp"
#ERROR : Can't open dsspfile "2iekA.bssp"
#ERROR : Can't open dsspfile "2id6A.bssp"
#ERROR : Can't open dsspfile "2hq5B.bssp"
#ERROR : Can't open dsspfile "2dtzD.bssp"
#ERROR : Can't open dsspfile "3br6A.bssp"
#ERROR : Can't open dsspfile "3br5E.bssp"
#ERROR : Can't open dsspfile "3br5A.bssp"
#ERROR : Can't open dsspfile "3br5D.bssp"
#ERROR : Can't open dsspfile "3br3A.bssp"
#ERROR : Can't open dsspfile "3br3B.bssp"
#ERROR : Can't open dsspfile "3br2E.bssp"
#ERROR : Can't open dsspfile "3br2A.bssp"
#ERROR : Can't open dsspfile "3br2D.bssp"
#ERROR : Can't open dsspfile "3br1D.bssp"
#ERROR : Can't open dsspfile "3br0A.bssp"
#ERROR : Can't open dsspfile "3br0B.bssp"
#ERROR : Can't open dsspfile "3bqzA.bssp"
#ERROR : Can't open dsspfile "3bqzB.bssp"
#ERROR : Can't open dsspfile "2uxhB.bssp"
#ERROR : Can't open dsspfile "2uxhA.bssp"
#ERROR : Can't open dsspfile "2ns7C.bssp"
#ERROR : Can't open dsspfile "1a6iA.bssp"
#ERROR : Can't open dsspfile "1vi0B.bssp"
#ERROR : Can't open dsspfile "1vi0A.bssp"
#ERROR : Can't open dsspfile "2ibdA.bssp"
#ERROR : Can't open dsspfile "3c2bB.bssp"
#ERROR : Can't open dsspfile "3c07B.bssp"
#ERROR : Can't open dsspfile "3c07A.bssp"
#ERROR : Can't open dsspfile "2ibdB.bssp"
#ERROR : Can't open dsspfile "2vkvA.bssp"
#ERROR : Can't open dsspfile "2hxoB.bssp"
#ERROR : Can't open dsspfile "2hxoA.bssp"
#ERROR : Can't open dsspfile "1ui6A.bssp"
#ERROR : Can't open dsspfile "3colB.bssp"
#ERROR : Can't open dsspfile "3colA.bssp"
#ERROR : Can't open dsspfile "1ui6B.bssp"
#ERROR : Can't open dsspfile "1ui5B.bssp"
#ERROR : Can't open dsspfile "1ui5A.bssp"
#ERROR : Can't open dsspfile "2raeA.bssp"
#ERROR : Can't open dsspfile "3iuvA.bssp"
#ERROR : Can't open dsspfile "3c2bA.bssp"
#ERROR : Can't open dsspfile "2genA.bssp"
#ERROR : Can't open dsspfile "2g3bB.bssp"
#ERROR : Can't open dsspfile "2g3bA.bssp"
#ERROR : Can't open dsspfile "3eupB.bssp"
#ERROR : Can't open dsspfile "3eupA.bssp"
#ERROR : Can't open dsspfile "3g7rB.bssp"
#ERROR : Can't open dsspfile "2dg8D.bssp"
#ERROR : Can't open dsspfile "2dg8B.bssp"
#ERROR : Can't open dsspfile "2dg8A.bssp"
#ERROR : Can't open dsspfile "2dg8C.bssp"
#ERROR : Can't open dsspfile "3dcfB.bssp"
#ERROR : Can't open dsspfile "3dcfA.bssp"

## Summary of PDB Search
:236
    2e-11  27%  2eh3A  [x.x.x] TRANSCRIPTIONAL REGULATOR
    6e-10  38%  2qopA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR ACRR
    5e-07  37%  2fbqA  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR
    1e-06  33%  2vkeA  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN CLASS D
    1e-06  33%  2tctA  [x.x.x] TETRACYCLINE REPRESSOR
    1e-06  33%  1orkA  [x.x.x] TETRACYCLINE REPRESSOR
    1e-06  33%  2o7oA  [a.4.1 - a.121.1 (1bjyA)] TETRACYCLINE REPRESSOR PROTEIN
    1e-06  33%  1du7A  [a.4.1 - a.121.1] PROTEIN (TETRACYCLINE REPRESSOR PROTEIN
    1e-06  38%  3dpjF  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    1e-06  38%  3dpjE  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    1e-06  38%  3dpjB  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    1e-06  38%  3dpjA  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    1e-06  33%  1bjzA  [x.x.x] TETRACYCLINE REPRESSOR
    1e-06  33%  1bjyB  [a.4.1 - a.121.1] TETRACYCLINE REPRESSOR
    1e-06  33%  1bj0A  [x.x.x] TETRACYCLINE REPRESSOR
    1e-06  37%  2zcnD  [x.x.x] BIOFILM OPERON ICAABCD HTH-TYPE NEGATIVE
    1e-06  37%  2zcnB  [x.x.x] BIOFILM OPERON ICAABCD HTH-TYPE NEGATIVE
    1e-06  37%  2zcnA  [x.x.x] BIOFILM OPERON ICAABCD HTH-TYPE NEGATIVE
    1e-06  37%  2zcmB  [x.x.x] BIOFILM OPERON ICAABCD HTH-TYPE NEGATIVE
    1e-06  37%  2zcmA  [x.x.x] BIOFILM OPERON ICAABCD HTH-TYPE NEGATIVE
    1e-06  42%  3btiB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    1e-06  42%  3bt9B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-06  33%  1qpiA  [a.4.1 - a.121.1] PROTEIN (TETRACYCLINE REPRESSOR)
    3e-06  38%  2w53A  [x.x.x] REPRESSOR
    3e-06  27%  2vprA  [x.x.x] TETRACYCLINE RESISTANCE REPRESSOR PROTEIN
    3e-06  25%  2ns8D  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    3e-06  25%  2ns8C  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    3e-06  25%  2ns8A  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    3e-06  25%  2ns7B  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    4e-06  39%  3geuA  [x.x.x] INTERCELLULAR ADHESION PROTEIN R
    5e-06  25%  2ns8B  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    5e-06  25%  2ns7D  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    5e-06  25%  2ns7A  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    7e-06  32%  1zkgA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    7e-06  47%  1qvtB  [a.4.1 - a.121.1] TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  1jusB  [a.4.1 - a.121.1] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN
    7e-06  47%  1jt6B  [a.4.1 - a.121.1] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN
    7e-06  47%  1jt0D  [a.4.1 - a.121.1] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN
    7e-06  47%  1jt0A  [a.4.1 - a.121.1] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN
    7e-06  32%  3ih2A  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    7e-06  32%  2iekA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    7e-06  32%  2id6A  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    7e-06  47%  2hq5B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  2dtzD  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br6A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br5E  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br5A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br5D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br3A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br3B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br2E  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br2A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br2D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br1D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br0A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3br0B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3bqzA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-06  47%  3bqzB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    9e-06  29%  2uxhB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR TTGR
    9e-06  29%  2uxhA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR TTGR
    9e-06  25%  2ns7C  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    1e-05  29%  1a6iA  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN CLASS D
    3e-05  31%  1vi0B  [a.4.1 - a.121.1] TRANSCRIPTIONAL REGULATOR
    3e-05  31%  1vi0A  [a.4.1 - a.121.1] TRANSCRIPTIONAL REGULATOR
    3e-05  37%  2ibdA  [x.x.x] POSSIBLE TRANSCRIPTIONAL REGULATOR
    3e-05  36%  3c2bB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    3e-05  40%  3c07B  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    3e-05  40%  3c07A  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    3e-05  39%  2ibdB  [x.x.x] POSSIBLE TRANSCRIPTIONAL REGULATOR
    5e-05  29%  2vkvA  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN CLASS B FROM
    6e-05  29%  2hxoB  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    6e-05  29%  2hxoA  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    8e-05  29%  1ui6A  [a.4.1 - a.121.1] A-FACTOR RECEPTOR HOMOLOG
    8e-05  31%  3colB  [x.x.x] PUTATIVE TRANSCRIPTION REGULATOR
    8e-05  31%  3colA  [x.x.x] PUTATIVE TRANSCRIPTION REGULATOR
    1e-04  30%  1ui6B  [a.4.1 - a.121.1] A-FACTOR RECEPTOR HOMOLOG
    1e-04  30%  1ui5B  [a.4.1 - a.121.1] A-FACTOR RECEPTOR HOMOLOG
    1e-04  30%  1ui5A  [a.4.1 - a.121.1] A-FACTOR RECEPTOR HOMOLOG
    1e-04  32%  2raeA  [x.x.x] TRANSCRIPTIONAL REGULATOR, ACRR FAMILY PROTEIN
    1e-04  28%  3iuvA  [x.x.x] UNCHARACTERIZED TETR FAMILY PROTEIN
    1e-04  34%  3c2bA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-04  37%  2genA  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR
    2e-04  33%  2g3bB  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    2e-04  33%  2g3bA  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    2e-04  30%  3eupB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-04  30%  3eupA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    4e-04  33%  3g7rB  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    4e-04  35%  2dg8D  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    4e-04  35%  2dg8B  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    4e-04  35%  2dg8A  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    5e-04  33%  2dg8C  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    6e-04  30%  3dcfB  [x.x.x] TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR
    6e-04  30%  3dcfA  [x.x.x] TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR
:236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxQAGPRRTRDRILDVSLRLFNELGEPNVTTTTIAEAMEISPGNLYYHFRNKDDIINSIFVRFEQEM
2eh3A           -----------TKERILEVSKELFFEKGYQGTSVEEIVKRANLSKGAFYFHFKSKEELITEIIERTHKKI
2qopA           ---------QETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWELSESEL
2fbqA           -----------TVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFGSKKALIQAVFSRFEKEL
2vkeA           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
2tctA           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
1orkA           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
2o7oA           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
1du7A           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
3dpjF           ----------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEV--------
3dpjE           ----------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEV--------
3dpjB           ----------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEV--------
3dpjA           ----------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEV--------
1bjzA           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
1bjyB           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
1bj0A           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
2zcnD           ------------KDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEI------------
2zcnB           ------------KDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEI------------
2zcnA           ------------KDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEI------------
2zcmB           ------------KDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEI------------
2zcmA           ------------KDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEI------------
3btiB           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEI--------
3bt9B           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEI--------
1qpiA           ------------RESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
2w53A           -----------TREGILDAAEACFHEHGVARTTLEMIGARAGYTRGAVYWHFKNKSEVLAAIVERFMQEL
2vprA           ------------KEQVIDNALILLNEVGIEGLTTRKLAQKIGVEQPTLYWHVKNKRALLDAL-------A
2ns8D           ---------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEM----
2ns8C           ---------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEM----
2ns8A           ---------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEM----
2ns7B           ---------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEM----
3geuA           ------------KDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSI------------
2ns8B           ------------KSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEM----
2ns7D           ------------KSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEM----
2ns7A           ------------KSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEM----
1zkgA           ------------RDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELAYSVTEKLQKEF
1qvtB           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
1jusB           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
1jt6B           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
1jt0D           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
1jt0A           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3ih2A           ------------RDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELAYSVTEKLQKEF
2iekA           ------------RDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELAYSVTEKLQKEF
2id6A           ------------RDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELAYSVTEKLQKEF
2hq5B           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
2dtzD           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br6A           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br5E           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br5A           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br5D           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br3A           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br3B           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br2E           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br2A           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br2D           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br1D           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br0A           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3br0B           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3bqzA           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
3bqzB           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
2uxhB           ---------QETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQALLDSLHETH
2uxhA           ---------QETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQALLDSLHETH
2ns7C           --------------KVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEM----
1a6iA           ---------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEI----
1vi0B           --------------QIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKGQFI
1vi0A           --------------QIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKGQFI
2ibdA           -------GKSGRRTELLDIAATLFAERGLRATTVRDIADAAGILSGSLYHHFDSKESV------------
3c2bB           ------------QNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAAI--TFQQSK
3c07B           ----------QTRALILETA-RLFQERGYDR-TTRAIAQEAGVSVGNAYYYFAGKEHLIQGFYDRIAAE-
3c07A           ----------QTRALILETA-RLFQERGYDR-TTRAIAQEAGVSVGNAYYYFAGKEHLIQGFYDRIAAE-
2ibdB           ------------RTELLDIAATLFAERGLRATTVRDIADAAGILSGSLYHHFDSKESV------------
2vkvA           ------------KSKVINSALELGNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEI----
2hxoB           -----------SRERIVGAAVELLDTVGERGLTFRALAERLATGPGAIYWHITGKAELL-----------
2hxoA           -----------SRERIVGAAVELLDTVGERGLTFRALAERLATGPGAIYWHITGKAELL-----------
1ui6A           -----QLRAEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAI-LEIQSRT
3colB           --------------KIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYFKNKQALIDSVYAR-----
3colA           --------------KIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYFKNKQALIDSVYAR-----
1ui6B           ----------QTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAI-LEIQSRT
1ui5B           ----------QTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAI-LEIQSRT
1ui5A           ----------QTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAI-LEIQSRT
2raeA           --------PSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEM
3iuvA           ------------RQRIIDAAIRVVGQKGIAGLSHRTVAAEADVPLGSTTYHFATLDDLVAAL--------
3c2bA           ------------QNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAAI--TFQQSK
2genA           ------------KDEILQAALACFSEHGV-DATTIEIRDRSGASIGSLYHHFGNKERIHGELYL------
2g3bB           ------------RDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLEA---------
2g3bA           ------------RDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLEA---------
3eupB           ----------RTRQFIIESTAPVFNVKGLAGTSLTDLTEATNLTKGSIYGNFENKEAVAIAAF-------
3eupA           ----------RTRQFIIESTAPVFNVKGLAGTSLTDLTEATNLTKGSIYGNFENKEAVAIAAF-------
3g7rB           --------PSEARARLLGTATRIFYAEGIHSVGIDRITAEAQVTRATLYRHFSGKDDLI-----------
2dg8D           --------PQR-RERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRF----
2dg8B           --------PQR-RERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRF----
2dg8A           --------PQR-RERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRF----
2dg8C           ------------RERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRF----
3dcfB           ------------RTQIIKVATELFREKGYYATSLDDIADRIGFTKPAIYYYFKSKEDVLFAI--------
3dcfA           ------------RTQIIKVATELFREKGYYATSLDDIADRIGFTKPAIYYYFKSKEDVLFAI--------


                         .         .         *         .         .         .         .:140
query           ERRLKMPEDHKATLGESWGYLQYMSEFLWNYRFLYRDINDLLARNRMLETNFKRIVDQKKRFALEICRQF
2eh3A           ---ISLFEENKEKTPEE--LLEFLEVLYREKKVVYIFLFDLLCSEKFRNIYFEKIEDAKRRFEKFLEKHF
2qopA           EYQAKFPGDPLSVLRE------------------------------------------------------
2fbqA           DRRQAKPEAQHATL--------------------------------------------------------
2vkeA           ---LARHHDYSPAAGESW----------------------------------------------------
2tctA           ---LARHHDYSPAAGESW----------------------------------------------------
1orkA           ---LARHHDYSPAAGESW----------------------------------------------------
2o7oA           ---LARHHDYSPAAGESW----------------------------------------------------
1du7A           ---LARHHDYSPAAGESW----------------------------------------------------
3dpjF           ----------------------------------------------------------------------
3dpjE           ----------------------------------------------------------------------
3dpjB           ----------------------------------------------------------------------
3dpjA           ----------------------------------------------------------------------
1bjzA           ---LARHHDYSPAAGESW----------------------------------------------------
1bjyB           ---LARHHDYSPAAGESW----------------------------------------------------
1bj0A           ---LARHHDYSPAAGESW----------------------------------------------------
2zcnD           ----------------------------------------------------------------------
2zcnB           ----------------------------------------------------------------------
2zcnA           ----------------------------------------------------------------------
2zcmB           ----------------------------------------------------------------------
2zcmA           ----------------------------------------------------------------------
3btiB           ----------------------------------------------------------------------
3bt9B           ----------------------------------------------------------------------
1qpiA           ---LARHHDYSPAAGESW----------------------------------------------------
2w53A           ER--------------------------------------------------------------------
2vprA           ETILQKHHHHVLPLNETWDFLRNNAKSFRQALLMYRDGGKIHAGTRPSESQFE-----------------
2ns8D           ---LDRHHTHFSPLGESWDFLRNNAKSFRNALLSHRDGAKVHLGTRPTEKQYETLENQ------------
2ns8C           ---LDRHHTHFSPLGESWDFLRNNAKSFRNALLSHRDGAKVHLGTRPTEKQYETLENQ------------
2ns8A           ---LDRHHTHFSPLGESWDFLRNNAKSFRNALLSHRDGAKVHLGTRPTEKQYETLENQ------------
2ns7B           ---LDRHHTHFSPLGESWDFLRNNAKSFRNALLSHRDGAKVHLGTRPTEKQYETLENQ------------
3geuA           ----------------------------------------------------------------------
2ns8B           ---LDRHHTHFSPLGESWDFLRNNAKSFRNALLSHRDGAKVHLGTRPTEKQYETLENQ------------
2ns7D           ---LDRHHTHFSPLGESWDFLRNNAKSFRNALLSHRDGAKVHLGTRPTEKQYETLENQ------------
2ns7A           ---LDRHHTHFSPLGESWDFLRNNAKSFRNALLSHRDGAKVHLGTRPTEKQYETLENQ------------
1zkgA           ENFLK-----------------------------------------------------------------
1qvtB           ----------------------------------------------------------------------
1jusB           ----------------------------------------------------------------------
1jt6B           ----------------------------------------------------------------------
1jt0D           ----------------------------------------------------------------------
1jt0A           ----------------------------------------------------------------------
3ih2A           ENFLK-----------------------------------------------------------------
2iekA           ENFLK-----------------------------------------------------------------
2id6A           ENFLK-----------------------------------------------------------------
2hq5B           ----------------------------------------------------------------------
2dtzD           ----------------------------------------------------------------------
3br6A           ----------------------------------------------------------------------
3br5E           ----------------------------------------------------------------------
3br5A           ----------------------------------------------------------------------
3br5D           ----------------------------------------------------------------------
3br3A           ----------------------------------------------------------------------
3br3B           ----------------------------------------------------------------------
3br2E           ----------------------------------------------------------------------
3br2A           ----------------------------------------------------------------------
3br2D           ----------------------------------------------------------------------
3br1D           ----------------------------------------------------------------------
3br0A           ----------------------------------------------------------------------
3br0B           ----------------------------------------------------------------------
3bqzA           ----------------------------------------------------------------------
3bqzB           ----------------------------------------------------------------------
2uxhB           DHRASESEDEVDPLGMRKLLLQVFNELVLDAR--TRRINEILHHDDMCEIRQQRVLDCHKGITLALARRG
2uxhA           DHRASESEDEVDPLGMRKLLLQVFNELVLDAR--TRRINEILHHDDMCEIRQQRVLDCHKGITLALARRG
2ns7C           ---LDRHHTHFSPLGESWDFLRNNAKSFRNALLSHRDGAKVHLGTRPTEKQYETLENQ------------
1a6iA           ---LARHHDYSPAAGESW----------------------------------------------------
1vi0B           ER--------------------------------------------------------------------
1vi0A           ER--------------------------------------------------------------------
2ibdA           ----------------------------------------------------------------------
3c2bB           VDRVSAPQDH------------------------------------------------------------
3c07B           ----------------------------------------------------------------------
3c07A           ----------------------------------------------------------------------
2ibdB           ----------------------------------------------------------------------
2vkvA           ---LARHHDYSPAAGESW----------------------------------------------------
2hxoB           ----------------------------------------------------------------------
2hxoA           ----------------------------------------------------------------------
1ui6A           SRRL------------------------------------------------------------------
3colB           ----------------------------------------------------------------------
3colA           ----------------------------------------------------------------------
1ui6B           SRRL------------------------------------------------------------------
1ui5B           SRRL------------------------------------------------------------------
1ui5A           SRRL------------------------------------------------------------------
2raeA           RAQLAQPDDIPIVDGLTAALLQF-----------------------------------------------
3iuvA           ----------------------------------------------------------------------
3c2bA           VRTFEKAGD-------------------------------------------------------------
2genA           ----------------------------------------------------------------------
2g3bB           ----------------------------------------------------------------------
2g3bA           ----------------------------------------------------------------------
3eupB           ----------------------------------------------------------------------
3eupA           ----------------------------------------------------------------------
3g7rB           ----------------------------------------------------------------------
2dg8D           ----------------------------------------------------------------------
2dg8B           ----------------------------------------------------------------------
2dg8A           ----------------------------------------------------------------------
2dg8C           ----------------------------------------------------------------------
3dcfB           ----------------------------------------------------------------------
3dcfA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QEDGDMDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eh3A           PSKAEI----------------------------------------------------------------
2qopA           ----------------------------------------------------------------------
2fbqA           ----------------------------------------------------------------------
2vkeA           ----------------------------------------------------------------------
2tctA           ----------------------------------------------------------------------
1orkA           ----------------------------------------------------------------------
2o7oA           ----------------------------------------------------------------------
1du7A           ----------------------------------------------------------------------
3dpjF           ----------------------------------------------------------------------
3dpjE           ----------------------------------------------------------------------
3dpjB           ----------------------------------------------------------------------
3dpjA           ----------------------------------------------------------------------
1bjzA           ----------------------------------------------------------------------
1bjyB           ----------------------------------------------------------------------
1bj0A           ----------------------------------------------------------------------
2zcnD           ----------------------------------------------------------------------
2zcnB           ----------------------------------------------------------------------
2zcnA           ----------------------------------------------------------------------
2zcmB           ----------------------------------------------------------------------
2zcmA           ----------------------------------------------------------------------
3btiB           ----------------------------------------------------------------------
3bt9B           ----------------------------------------------------------------------
1qpiA           ----------------------------------------------------------------------
2w53A           ----------------------------------------------------------------------
2vprA           ----------------------------------------------------------------------
2ns8D           ----------------------------------------------------------------------
2ns8C           ----------------------------------------------------------------------
2ns8A           ----------------------------------------------------------------------
2ns7B           ----------------------------------------------------------------------
3geuA           ----------------------------------------------------------------------
2ns8B           ----------------------------------------------------------------------
2ns7D           ----------------------------------------------------------------------
2ns7A           ----------------------------------------------------------------------
1zkgA           ----------------------------------------------------------------------
1qvtB           ----------------------------------------------------------------------
1jusB           ----------------------------------------------------------------------
1jt6B           ----------------------------------------------------------------------
1jt0D           ----------------------------------------------------------------------
1jt0A           ----------------------------------------------------------------------
3ih2A           ----------------------------------------------------------------------
2iekA           ----------------------------------------------------------------------
2id6A           ----------------------------------------------------------------------
2hq5B           ----------------------------------------------------------------------
2dtzD           ----------------------------------------------------------------------
3br6A           ----------------------------------------------------------------------
3br5E           ----------------------------------------------------------------------
3br5A           ----------------------------------------------------------------------
3br5D           ----------------------------------------------------------------------
3br3A           ----------------------------------------------------------------------
3br3B           ----------------------------------------------------------------------
3br2E           ----------------------------------------------------------------------
3br2A           ----------------------------------------------------------------------
3br2D           ----------------------------------------------------------------------
3br1D           ----------------------------------------------------------------------
3br0A           ----------------------------------------------------------------------
3br0B           ----------------------------------------------------------------------
3bqzA           ----------------------------------------------------------------------
3bqzB           ----------------------------------------------------------------------
2uxhB           QLPGELDA--------------------------------------------------------------
2uxhA           QLPGELDA--------------------------------------------------------------
2ns7C           ----------------------------------------------------------------------
1a6iA           ----------------------------------------------------------------------
1vi0B           ----------------------------------------------------------------------
1vi0A           ----------------------------------------------------------------------
2ibdA           ----------------------------------------------------------------------
3c2bB           ----------------------------------------------------------------------
3c07B           ----------------------------------------------------------------------
3c07A           ----------------------------------------------------------------------
2ibdB           ----------------------------------------------------------------------
2vkvA           ----------------------------------------------------------------------
2hxoB           ----------------------------------------------------------------------
2hxoA           ----------------------------------------------------------------------
1ui6A           ----------------------------------------------------------------------
3colB           ----------------------------------------------------------------------
3colA           ----------------------------------------------------------------------
1ui6B           ----------------------------------------------------------------------
1ui5B           ----------------------------------------------------------------------
1ui5A           ----------------------------------------------------------------------
2raeA           ----------------------------------------------------------------------
3iuvA           ----------------------------------------------------------------------
3c2bA           ----------------------------------------------------------------------
2genA           ----------------------------------------------------------------------
2g3bB           ----------------------------------------------------------------------
2g3bA           ----------------------------------------------------------------------
3eupB           ----------------------------------------------------------------------
3eupA           ----------------------------------------------------------------------
3g7rB           ----------------------------------------------------------------------
2dg8D           ----------------------------------------------------------------------
2dg8B           ----------------------------------------------------------------------
2dg8A           ----------------------------------------------------------------------
2dg8C           ----------------------------------------------------------------------
3dcfB           ----------------------------------------------------------------------
3dcfA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
2eh3A           --------------------------
2qopA           --------------------------
2fbqA           --------------------------
2vkeA           --------------------------
2tctA           --------------------------
1orkA           --------------------------
2o7oA           --------------------------
1du7A           --------------------------
3dpjF           --------------------------
3dpjE           --------------------------
3dpjB           --------------------------
3dpjA           --------------------------
1bjzA           --------------------------
1bjyB           --------------------------
1bj0A           --------------------------
2zcnD           --------------------------
2zcnB           --------------------------
2zcnA           --------------------------
2zcmB           --------------------------
2zcmA           --------------------------
3btiB           --------------------------
3bt9B           --------------------------
1qpiA           --------------------------
2w53A           --------------------------
2vprA           --------------------------
2ns8D           --------------------------
2ns8C           --------------------------
2ns8A           --------------------------
2ns7B           --------------------------
3geuA           --------------------------
2ns8B           --------------------------
2ns7D           --------------------------
2ns7A           --------------------------
1zkgA           --------------------------
1qvtB           --------------------------
1jusB           --------------------------
1jt6B           --------------------------
1jt0D           --------------------------
1jt0A           --------------------------
3ih2A           --------------------------
2iekA           --------------------------
2id6A           --------------------------
2hq5B           --------------------------
2dtzD           --------------------------
3br6A           --------------------------
3br5E           --------------------------
3br5A           --------------------------
3br5D           --------------------------
3br3A           --------------------------
3br3B           --------------------------
3br2E           --------------------------
3br2A           --------------------------
3br2D           --------------------------
3br1D           --------------------------
3br0A           --------------------------
3br0B           --------------------------
3bqzA           --------------------------
3bqzB           --------------------------
2uxhB           --------------------------
2uxhA           --------------------------
2ns7C           --------------------------
1a6iA           --------------------------
1vi0B           --------------------------
1vi0A           --------------------------
2ibdA           --------------------------
3c2bB           --------------------------
3c07B           --------------------------
3c07A           --------------------------
2ibdB           --------------------------
2vkvA           --------------------------
2hxoB           --------------------------
2hxoA           --------------------------
1ui6A           --------------------------
3colB           --------------------------
3colA           --------------------------
1ui6B           --------------------------
1ui5B           --------------------------
1ui5A           --------------------------
2raeA           --------------------------
3iuvA           --------------------------
3c2bA           --------------------------
2genA           --------------------------
2g3bB           --------------------------
2g3bA           --------------------------
3eupB           --------------------------
3eupA           --------------------------
3g7rB           --------------------------
2dg8D           --------------------------
2dg8B           --------------------------
2dg8A           --------------------------
2dg8C           --------------------------
3dcfB           --------------------------
3dcfA           --------------------------