[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF07810.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2j8zA.bssp"
#ERROR : Can't open dsspfile "2obyA.bssp"
#ERROR : Can't open dsspfile "1yb5A.bssp"
#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "2eerB.bssp"
#ERROR : Can't open dsspfile "2eerA.bssp"
#ERROR : Can't open dsspfile "1qorA.bssp"
#ERROR : Can't open dsspfile "1wlyA.bssp"
#ERROR : Can't open dsspfile "2vz9B.bssp"
#ERROR : Can't open dsspfile "2vz9A.bssp"
#ERROR : Can't open dsspfile "2vz8B.bssp"
#ERROR : Can't open dsspfile "2vz8A.bssp"
#ERROR : Can't open dsspfile "2vn8B.bssp"
#ERROR : Can't open dsspfile "2vn8A.bssp"
#ERROR : Can't open dsspfile "2c0cB.bssp"
#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "1pqwA.bssp"
#ERROR : Can't open dsspfile "1pqwB.bssp"
#ERROR : Can't open dsspfile "3gmsA.bssp"
#ERROR : Can't open dsspfile "1lluA.bssp"
#ERROR : Can't open dsspfile "3fbgA.bssp"
#ERROR : Can't open dsspfile "1ntoA.bssp"
#ERROR : Can't open dsspfile "3fbgB.bssp"
#ERROR : Can't open dsspfile "1rjwA.bssp"
#ERROR : Can't open dsspfile "3i4cA.bssp"
#ERROR : Can't open dsspfile "1r37A.bssp"
#ERROR : Can't open dsspfile "3i4cH.bssp"
#ERROR : Can't open dsspfile "1xa0B.bssp"
#ERROR : Can't open dsspfile "3i4cC.bssp"
#ERROR : Can't open dsspfile "1xa0A.bssp"
#ERROR : Can't open dsspfile "1h2bB.bssp"
#ERROR : Can't open dsspfile "1v3vB.bssp"
#ERROR : Can't open dsspfile "1v3uB.bssp"
#ERROR : Can't open dsspfile "1v3uA.bssp"
#ERROR : Can't open dsspfile "1v3tB.bssp"
#ERROR : Can't open dsspfile "1v3tA.bssp"
#ERROR : Can't open dsspfile "1h2bA.bssp"
#ERROR : Can't open dsspfile "2dm6A.bssp"
#ERROR : Can't open dsspfile "1iyzA.bssp"
#ERROR : Can't open dsspfile "3i4cD.bssp"
#ERROR : Can't open dsspfile "3i4cB.bssp"
#ERROR : Can't open dsspfile "3i4cE.bssp"
#ERROR : Can't open dsspfile "2dq4A.bssp"
#ERROR : Can't open dsspfile "3gazB.bssp"
#ERROR : Can't open dsspfile "3gazA.bssp"
#ERROR : Can't open dsspfile "2dfvA.bssp"
#ERROR : Can't open dsspfile "2d8aA.bssp"
#ERROR : Can't open dsspfile "2hcyA.bssp"
#ERROR : Can't open dsspfile "3gfbA.bssp"
#ERROR : Can't open dsspfile "2h6eA.bssp"
#ERROR : Can't open dsspfile "1tt7A.bssp"
#ERROR : Can't open dsspfile "1zsyA.bssp"
#ERROR : Can't open dsspfile "2vcyA.bssp"
#ERROR : Can't open dsspfile "3ip1C.bssp"
#ERROR : Can't open dsspfile "3ip1A.bssp"
#ERROR : Can't open dsspfile "1vj0D.bssp"
#ERROR : Can't open dsspfile "1vj0B.bssp"
#ERROR : Can't open dsspfile "1vj0A.bssp"
#ERROR : Can't open dsspfile "2j3hB.bssp"
#ERROR : Can't open dsspfile "2j3hA.bssp"
#ERROR : Can't open dsspfile "1e3jA.bssp"
#ERROR : Can't open dsspfile "3b70A.bssp"
#ERROR : Can't open dsspfile "3b6zA.bssp"
#ERROR : Can't open dsspfile "1jvbA.bssp"
#ERROR : Can't open dsspfile "1pl8A.bssp"
#ERROR : Can't open dsspfile "1zsvA.bssp"
#ERROR : Can't open dsspfile "2zb3A.bssp"
#ERROR : Can't open dsspfile "3gqvA.bssp"
#ERROR : Can't open dsspfile "1y9aA.bssp"
#ERROR : Can't open dsspfile "2zb8A.bssp"
#ERROR : Can't open dsspfile "2zb7A.bssp"
#ERROR : Can't open dsspfile "2zb4A.bssp"
#ERROR : Can't open dsspfile "2w98B.bssp"
#ERROR : Can't open dsspfile "2w98A.bssp"
#ERROR : Can't open dsspfile "2vnaA.bssp"
#ERROR : Can't open dsspfile "2ouiA.bssp"
#ERROR : Can't open dsspfile "1kevA.bssp"
#ERROR : Can't open dsspfile "1f8fA.bssp"
#ERROR : Can't open dsspfile "2b83A.bssp"
#ERROR : Can't open dsspfile "2b5vA.bssp"
#ERROR : Can't open dsspfile "1o8cC.bssp"
#ERROR : Can't open dsspfile "1o8cA.bssp"
#ERROR : Can't open dsspfile "1o89A.bssp"
#ERROR : Can't open dsspfile "1vj1A.bssp"
#ERROR : Can't open dsspfile "3iupB.bssp"
#ERROR : Can't open dsspfile "3iupA.bssp"
#ERROR : Can't open dsspfile "3f9iB.bssp"
#ERROR : Can't open dsspfile "3f9iA.bssp"
#ERROR : Can't open dsspfile "2vwgA.bssp"
#ERROR : Can't open dsspfile "1jqbA.bssp"

## Summary of PDB Search
:334
    2e-61  40%  2j8zA  [x.x.x] QUINONE OXIDOREDUCTASE
    9e-60  40%  2obyA  [x.x.x] PUTATIVE QUINONE OXIDOREDUCTASE
    3e-39  34%  1yb5A  [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
    3e-39  35%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    4e-25  34%  2eerB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    4e-25  34%  2eerA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-24  32%  1qorA  [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
    3e-22  29%  1wlyA  [x.x.x] 2-HALOACRYLATE REDUCTASE
    4e-20  30%  2vz9B  [x.x.x] FATTY ACID SYNTHASE
    4e-20  30%  2vz9A  [x.x.x] FATTY ACID SYNTHASE
    4e-20  30%  2vz8B  [x.x.x] FATTY ACID SYNTHASE
    4e-20  30%  2vz8A  [x.x.x] FATTY ACID SYNTHASE
    4e-20  32%  2vn8B  [x.x.x] RETICULON-4-INTERACTING PROTEIN 1
    4e-20  32%  2vn8A  [x.x.x] RETICULON-4-INTERACTING PROTEIN 1
    5e-20  30%  2c0cB  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    5e-20  30%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    1e-18  36%  1pqwA  [c.2.1] POLYKETIDE SYNTHASE
    1e-17  36%  1pqwB  [c.2.1] POLYKETIDE SYNTHASE
    2e-16  26%  3gmsA  [x.x.x] PUTATIVE NADPH:QUINONE REDUCTASE
    2e-15  27%  1lluA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    4e-15  29%  3fbgA  [x.x.x] PUTATIVE ARGINATE LYASE
    1e-14  31%  1ntoA  [b.35.1 - c.2.1] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    3e-14  32%  3fbgB  [x.x.x] PUTATIVE ARGINATE LYASE
    3e-14  29%  1rjwA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    4e-14  32%  3i4cA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    6e-14  31%  1r37A  [b.35.1 - c.2.1] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    6e-14  29%  3i4cH  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    4e-13  29%  1xa0B  [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES
    4e-13  27%  3i4cC  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    8e-13  32%  1xa0A  [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES
    1e-12  31%  1h2bB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-12  27%  1v3vB  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    2e-12  27%  1v3uB  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    2e-12  28%  1v3uA  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    2e-12  27%  1v3tB  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    2e-12  27%  1v3tA  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    2e-12  31%  1h2bA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-12  27%  2dm6A  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    7e-12  26%  1iyzA  [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
    1e-11  30%  3i4cD  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-11  29%  3i4cB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    5e-11  28%  3i4cE  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    3e-10  32%  2dq4A  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    4e-10  25%  3gazB  [x.x.x] ALCOHOL DEHYDROGENASE SUPERFAMILY PROTEIN
    4e-10  25%  3gazA  [x.x.x] ALCOHOL DEHYDROGENASE SUPERFAMILY PROTEIN
    4e-10  33%  2dfvA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    4e-10  33%  2d8aA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    9e-10  23%  2hcyA  [x.x.x] ALCOHOL DEHYDROGENASE 1
    1e-09  28%  3gfbA  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    2e-09  29%  2h6eA  [x.x.x] D-ARABINOSE 1-DEHYDROGENASE
    3e-09  24%  1tt7A  [b.35.1 - c.2.1] YHFP
    1e-08  31%  1zsyA  [x.x.x] MITOCHONDRIAL 2-ENOYL THIOESTER REDUCTASE
    1e-08  31%  2vcyA  [x.x.x] TRANS-2-ENOYL-COA REDUCTASE
    2e-08  30%  3ip1C  [x.x.x] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    2e-08  30%  3ip1A  [x.x.x] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    3e-07  39%  1vj0D  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    3e-07  39%  1vj0B  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    3e-07  39%  1vj0A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    3e-07  26%  2j3hB  [x.x.x] NADP-DEPENDENT OXIDOREDUCTASE P1
    3e-07  26%  2j3hA  [x.x.x] NADP-DEPENDENT OXIDOREDUCTASE P1
    9e-07  36%  1e3jA  [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
    9e-07  29%  3b70A  [x.x.x] ENOYL REDUCTASE
    9e-07  29%  3b6zA  [x.x.x] ENOYL REDUCTASE
    3e-06  31%  1jvbA  [b.35.1 - c.2.1] NAD(H)-DEPENDENT ALCOHOL DEHYDROGENASE
    4e-06  31%  1pl8A  [b.35.1 - c.2.1] HUMAN SORBITOL DEHYDROGENASE
    8e-06  33%  1zsvA  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    8e-06  30%  2zb3A  [x.x.x] PROSTAGLANDIN REDUCTASE 2
    8e-06  29%  3gqvA  [x.x.x] ENOYL REDUCTASE
    2e-05  29%  1y9aA  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    5e-05  34%  2zb8A  [x.x.x] PROSTAGLANDIN REDUCTASE 2
    5e-05  34%  2zb7A  [x.x.x] PROSTAGLANDIN REDUCTASE 2
    5e-05  34%  2zb4A  [x.x.x] PROSTAGLANDIN REDUCTASE 2
    5e-05  34%  2w98B  [x.x.x] PROSTAGLANDIN REDUCTASE 2
    5e-05  34%  2w98A  [x.x.x] PROSTAGLANDIN REDUCTASE 2
    5e-05  34%  2vnaA  [x.x.x] PROSTAGLANDIN REDUCTASE 2
    5e-05  32%  2ouiA  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    5e-05  35%  1kevA  [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    5e-05  34%  1f8fA  [b.35.1 - c.2.1] BENZYL ALCOHOL DEHYDROGENASE
    5e-05  35%  2b83A  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    6e-05  39%  2b5vA  [x.x.x] GLUCOSE DEHYDROGENASE
    1e-04  24%  1o8cC  [b.35.1 - c.2.1] YHDH
    1e-04  24%  1o8cA  [b.35.1 - c.2.1] YHDH
    1e-04  24%  1o89A  [b.35.1 - c.2.1] YHDH
    2e-04  42%  1vj1A  [b.35.1 - c.2.1] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE
    3e-04  26%  3iupB  [x.x.x] PUTATIVE NADPH:QUINONE OXIDOREDUCTASE
    3e-04  26%  3iupA  [x.x.x] PUTATIVE NADPH:QUINONE OXIDOREDUCTASE
    4e-04  42%  3f9iB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    4e-04  42%  3f9iA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    5e-04  37%  2vwgA  [x.x.x] GLUCOSE DEHYDROGENASE
    7e-04  33%  1jqbA  [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKAIEIREYGAPEVLQETQRPDPEPKAGEILIRVAAAGINRPDVFQRTGNYPVPPGASDLPGLEVAGVVV
2j8zA           MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVL
2obyA           MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVA
1yb5A           MRAVRVFEFGGPEVLKRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIE
2eihA           MRAVVMRARGGPEVLEVADLPVPEPGPKEVRVRLKAAALNHLDVWVRKGKLPLPHXXXXXPGDEV---VI
2eerB           MRAMRLVEIGKPLKLEDI--PIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLRIVEDLGGHEIAGEVV
2eerA           MRAMRLVEIGKPLKLEDI--PIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLRIVEDLGGHEIAGEVV
1qorA           ---IEFHKHGGPEVLQAVEFTPADPAENEIQVENKAIGINFIDTYIRXXXXXXXXXXXXXX-TEAAGIVV
1wlyA           --AAVIHKKGGPDVWEEVKVGSPGP--GQVRLRNTAIGVNFLDTYHRA------------PPIXXXXXXX
2vz9B           ----------------------------------------------------------------------
2vz9A           ----------------------------------------------------------------------
2vz8B           ----------------------------------------------------------------------
2vz8A           ----------------------------------------------------------------------
2vn8B           -----IDKYGKNEVLRFTQNMMMPHYPNEVIVKVHAASVNPIDVNMRSGNMKRDPLHVKIKGEEFP-LTL
2vn8A           -----IDKYGKNEVLRFTQNMMMPHYPNEVIVKVHAASVNPIDVNMRSGNMKRDPLHVKIKGEEFP-LTL
2c0cB           --------------------PVPLPGDGDLLVRNRFVGVNASDINYSAGRYPSVKPPFDI-GFEGIGEVV
2c0cA           --------------------PVPLPGDGDLLVRNRFVGVNASDINYSAGRYPSVKPPFDI-GFEGIGEVV
1pqwA           ----------------------------------------------------------------------
1pqwB           ----------------------------------------------------------------------
3gmsA           -KLIQFHKFGNPKDVLQVEYKNIEPKDNEVFVRMLVRPINPSDLIPITGAYAHRIPLPNIPGYEGVGIVV
1lluA           MKAAVVHAYGAPLRIEEVKVPLPGP--GQVLVKIEASGVCHTDLHAAEGDWPVKPPLPFIPGHEXXXXXX
3fbgA           ----------------------PEPKVHEILVKIQSISVNPVDTKQRLMDVSKAPRVL---GFDAIGVVV
1ntoA           MRAVRLVEIGKPLSLQEIGVP--KPKGPQVLIKVEAAGVCHSDVHMRQGRFGNLRIVEDLGGHEIAGKVV
3fbgB           ----------------------PEPKVHEILVKIQSISVNPVDTKQRLMDV-----SPRVLGFDAIGVVV
1rjwA           MKAAVVEQFKEPLKIKEVEKPTIS--YGEVLVRIKACGVCHTDLHAAHGDWPVKP---KLP-LXXXXXXX
3i4cA           MRAVRLVE---PLSLQEIGVP--KPKGPQVLIKVEAAGVCHSDVHMRQGRFIVEDLGVKLPGHEIAGKVV
1r37A           MRAVRLVEIGKPLSLQEIGVP--KPKGPQVLIKVEAAGVCHSDVHMRQGRFGNLRIVEDLGGHEIAGKVV
3i4cH           MRAVRLVEIGKPLSLQEIGVP--KPKGPQVLIKVEAAGVCHSDVHMRQGRFPVTLGGDEVVGYSKGDLVA
1xa0B           ---------------------------GDVLVRVHYSSVNYKD-----GLASIPDGTPFVPGIDLAGVVV
3i4cC           MRAVRLVEIGKPLSLQEIGVP--KPKGPQVLIKVEAAGVCHSDTLGHEIAGKIEEVGDEVVGYSKGDLVA
1xa0A           ---------------------------GDVLVRVHYSSVNYKD-----GLASIPDGTPFVPGIDLAGVVV
1h2bB           LKAARLHEYNKPLRIEDVDYPRLEGRF-DVIVRIAGAGVCHTDLHLVQGMWPYTLGHENVGYIEVAEGVE
1v3vB           ----------------------PPLKNGEVLLEALFLSV---DPYMRIASKRLKEGAV-MMGQQVARVVE
1v3uB           ----------------------PPLKNGEVLLEALFLSV---DPYMRIASKRLKEGAV-MMGQQVARVVE
1v3uA           ----------------------PPLKNGEVLLEALFLSV---DPYMRIASKRLKEGAV-MMGQQVARVVE
1v3tB           ----------------------PPLKNGEVLLEALFLSV---DPYMRIASKRLKEGAV-MMGQQVARVVE
1v3tA           ----------------------PPLKNGEVLLEALFLSV---DPYMRIASKRLKEGAV-MMGQQVARVVE
1h2bA           -KAARLHEYNKPLRIEDVDYPRLEGRF-DVIVRIAGAGVCHTDLHLVQGMWPYTLGHENVGYIEVAEGVE
2dm6A           ----------------------PPLKNGEVLLEALFLSV---DPYMRIASKRLKEGAV-MMGQQVARVVE
1iyzA           MKAWVLKRLGGP--LELVDLPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPFIPGMXXXXXXX
3i4cD           ----------------------PKPKGPQVLIKVEAAGVCHSDVHMRIVELPVTLGHEIAGKIEEVGEVV
3i4cB           MRAVRLQEIGVPK-----------PKGPQVLIKVEAAGVCHSDVHMRL---PVTLGGDEVVGYSKGDLVA
3i4cE           ----------------------PKPKGPQVLIKVEAAGVCHSDVHMR--QLPVTLGGDEVVGYSKGDLVA
2dq4A           ------------EGLTLVDRPVPEPGPGEILVRVEAASICGTDLWDAWARGRIRPPL--VTGHEFSGVVV
3gazB           --AAVVEEANGPFVLRKLARPQPAP--GQVLVQIEASGTNPLDAKIRAGE--APHAQQPLPAIDLAGTVV
3gazA           --AAVVEEANGPFVLRKLARPQPAP--GQVLVQIEASGTNPLDAKIRAGE--APHAQQPLPAIDLAGTVV
2dfvA           ----------------------------------------------------------------------
2d8aA           ----------------------------------------------------------------------
2hcyA           --------------------PVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLGDYAGIKLNGSCM
3gfbA           --------YGAELVEVDVPKPGP----GEVLIKVLATSIKPPQIMXXXXXXXXXXXXXXXXDLQVGDIVC
2h6eA           ----------------------PEPQGEEVLIRIGGAGVCRTDLRVWKGRLPIILGHENAGTIELAKVKK
1tt7A           ------------------------PKDG-VLIKVAYSGINYKDGLAGKAGGNIVREYPLILGIDAAGTVV
1zsyA           VRALVYGHHGDPAKVVELKNLELAAVRGDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEVAQVVA
2vcyA           VRALVYGHHGDPAKVVELKNLELAAVRGDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEVAQVVA
3ip1C           -------------------------KPTEIIIKVKACGICGSDVHAQTDEYILYPGLTGFPGHEFSGVVV
3ip1A           -------------------------KPTEIIIKVKACGICGSDVHAQTDEYILYPGLTGFPGHEFSGVVV
1vj0D           ----------------------------------------------------------------------
1vj0B           ----------------------------------------------------------------------
1vj0A           ----------------------------------------------------------------------
2j3hB           ----------------------------------------------------------------------
2j3hA           ----------------------------------------------------------------------
1e3jA           --------------LRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYRIADFIVKDPM--VIGHEASGTVV
3b70A           ------------EVTVWNAAPCPMLPRDQVYVRVEAVAINPSDTKMR-GQFATPWA---FLGTDYAGTVV
3b6zA           ------------EVTVWNAAPCPMLPRDQVYVRVEAVAINPSDTKMR-GQFATPWA---FLGTDYAGTVV
1jvbA           -RAVRLVEIGKPLSLQEIGVP--KPKGPQVLIKVEAAGVCHSDVHRRFGNLRIVEDLGKLPGHEIAGEVV
1pl8A           -----------PGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVYGRIGNFIVKKPM--VLGHEASGTVV
1zsvA           ----------------------------------------------------------------------
2zb3A           ----------------------------------------------------------------------
3gqvA           ------------EVTVWNAAPCPMLPRDQVYVRVEAVAINPSD----TSATPWAFLGTDYAGTVVA---V
1y9aA           ----------------------------------------------------------------------
2zb8A           ----------------------------------------------------------------------
2zb7A           ----------------------------------------------------------------------
2zb4A           ----------------------------------------------------------------------
2w98B           ----------------------------------------------------------------------
2w98A           ----------------------------------------------------------------------
2vnaA           ----------------------------------------------------------------------
2ouiA           ----------------------------------------------------------------------
1kevA           ----------------------------------------------------------------------
1f8fA           -----------------------QPQGDEVLVKVVATGMCHTDLIVRDQKYPVPLPA--VLGHEGSGIII
2b83A           ----------------------------------------------------------------------
2b5vA           MKAIAVKR-GRPVVIE---KPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDVLGHEAVGVVV
1o8cC           ------------QTLDESRLPE-----GDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFAGTVT
1o8cA           ------------QTLDESRLPE-----GDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFAGTVT
1o89A           ------------QTLDESRLPE-----GDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFAGTVT
1vj1A           ----------------------------------------------------------------------
3iupB           ----------------------PHPGPDEVLIRIEASPLNPSDLASGTAERPVPEGARSAGRLDASXXXX
3iupA           ----------------------PHPGPDEVLIRIEASPLNPSDLASGTAERPVPEGARSAGRLDASXXXX
3f9iB           ----------------------------------------------------------------------
3f9iA           ----------------------------------------------------------------------
2vwgA           MKAIAVKRGEDRPVVIE--KPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDVLGHEAVGVVV
1jqbA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GGDLSHPANRFGLKAGDRVCALVQGGGYAELCTAPIEQCLPVPEGLTDIEAAALPETFFTVWSNVFDRGQ
2j8zA           GPGCQH------WKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGN
2obyA           --ELG-PGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGN
1yb5A           AGD-----NASAFKKGDRVTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAY-----RAL
2eihA           NPGLSCGRCERCLAGEDNLCPRYQHGTYAEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTAWQMVVDK--
2eerB           GGDLEGEGNCYYCRIGERWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTYRAV-----
2eerA           GGDLEGEGNCYYCRIGERWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTYRAV-----
1qorA           GSGVKH------IKAGDRVVYAQSAGAYSSVHNIIADKAAILPAAISFEQAAASFLKGLTVYYLLRKTYE
1wlyA           XXXXXXXXXXTDFTVGERVCTCLPPGAYSQERLYPAEKLIKVPKDLDDVHLAGLMLKGMTAQYLLHQTHK
2vz9B           --------------SGRRVMGMVPAEGLATSVLLLQHATWEVPSTWTLEEAASVPIVYTTAYYSLVVRGR
2vz9A           --------------SGRRVMGMVPAEGLATSVLLLQHATWEVPSTWTLEEAASVPIVYTTAYYSLVVRGR
2vz8B           --------------SGRRVMGMVPAEGLATSVLLLQHATWEVPSTWTLEEAASVPIVYTTAYYSLVVRGR
2vz8A           --------------SGRRVMGMVPAEGLATSVLLLQHATWEVPSTWTLEEAASVPIVYTTAYYSLVVRGR
2vn8B           GRDVSGVVMECGLKPGDEVWAAVKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGG
2vn8A           GRDVSGVVMECGLKPGDEVWAAVKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGG
2c0cB           ALGLSASAR---YTVGQAV-AYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGT--TAYISLKELGG
2c0cA           ALGLSASAR---YTVGQAV-AYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGT--TAYISLKELGG
1pqwA           -------------------------------------------------EAATFGVAYLTAWHSLCEVGR
1pqwB           ---------------------------------------------------------YLTAWHSLCEVGR
3gmsA           GAFVSREL------IGKRVLPLRGEGTWQEYVKTSADFVVPIPDSIDDFTAAQMYINPLTAWVTCTETLN
1lluA           XXXXXXTRVKEGDRVGETLCESQQNGGYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKGL-----
3fbgA           GNEVTM------FNQGDIVYSPDQNGSNAEYQLINERLVAKAPKNISAEQAVSLPLTGITAYETLFDVFG
1ntoA           GGDLQGEGNCYYCRIGERWLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV-----
3fbgB           GNEVTM------FNQGDIVYSPDQNGSNAEYQLINERLVAKAPKNISAEQAVSLPLTGITAYETLFDVFG
1rjwA           XXXXXXXXXXTHLKVGDRVCLSGQDGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTG-
3i4cA           GGDLQGEGNCYYCRIGERWLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV-----
1r37A           GGDLQGEGNCYYCRIGERWLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV-----
3i4cH           VNPLQGEGNCYYCRIGERWLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV-----
1xa0B           SSQ--HPEGDEVIATGYEI-GVTHFGGYSEYARLHGEWLVPLPKGLT-LKEAAIGTAGFTAALSIHRLEE
3i4cC           VNPLQGEGNCYYCRIGERWLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV-----
1xa0A           SSQ--HP--RF--REGDEVIAVTHFGGYSEYARLHGEWLVPLPKGLT-LKEAAIGTAGFTAALSIHRLEE
1h2bB           GGDILHPAVTDGTRAGDMHCENLEDGGFAEFMRTSHRSVIKLPKDISRVEMAPLADAGITAYRAV-----
1v3vB           SKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTAYF----------GL
1v3uB           SKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTAYF----------GL
1v3uA           SKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLLWPDK--LPLSLALGTIGMPGLTAYF----------GL
1v3tB           SKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTAYF----------GL
1v3tA           SKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTAYF----------GL
1h2bA           GGDILHPAVTDGTRAGDMHCENLEDGGFAEFMRTSHRSVIKLPKDISRVEMAPLADAGITAYRAV-----
2dm6A           SKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTAYF----------GL
1iyzA           XXXYA---------------ALVPQGGLAERVAVPKXXXXXXXXXXXXXXXXXFPVSFLTAYL-ALKRAQ
3i4cD           GGDLQGEGNCYYCRIGERWLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV-----
3i4cB           VNPLQGEGNCYYCRIGERWLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV-----
3i4cE           VNPLQGEGNCYYCRIGERWLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV-----
2dq4A           GDHVSCPACRTGVCLNTQILGVDRDGGFAEYVVVPAENAWVNPKDL-PFEVAAILEPFGNAVHTVY----
3gazB           AVGPEVDSFRVXXXXXXXXXXXXXXXXXXXXFAAVDARLLASKPAALTRQASVLPLVFITAWEGLVDRAQ
3gazA           AVGPEVDSFRVXXXXXXXXXXXXXXXXXXXXFAAVDARLLASKPAALTRQASVLPLVFITAWEGLVDRAQ
2dfvA           -------------------------GVFAEYAVVPAQNIWKNPKSIPP-EYATLQEPLGNAVDTVL----
2d8aA           -------------------------GVFAEYAVVPAQNIWKNPKSIPP-EYATLQEPLGNAVDTVL----
2hcyA           ACEYCELGNESNCPHAD-LSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANL
3gfbA           GKCYACKHNRYHVCQNTKIFGVDMDGVFAHYAIVPAKNAWKNPKDMPP-EYAALQEPLGNAVDTVL----
2h6eA           GGDLTCREGKFNICKNQIIPGQTTNGGFSEYMLVKSSRWLVKLNSLSPVEAAPLADAGTTSMGAI---RQ
1tt7A           SSNDPRFAEGDEVIATSYELGVSRDGGLSEYASVPGDWLVPLPQNLS-LKEAVYGTAGFTAALSVHRLEQ
1zsyA           VG-----SNVTGLKPGDWVIPANAGGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQ
2vcyA           VG-----SNVTGLKPGDWVIPANAGGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQ
3ip1C           GPEAINRRTNKRFEIGEPVCAEELWCGHCRPCAESLRELEGVYEGDRLFLAGSLVEPTSVAYNAVIVRGG
3ip1A           GPEAINRRTNKRFEIGEPVCAEELWCGHCRPCAESLRELEGVYEGDRLFLAGSLVEPTSVAYNAVIVRGG
1vj0D           ----------------------------------------------------------------------
1vj0B           ----------------------------------------------------------------------
1vj0A           ----------------------------------------------------------------------
2j3hB           ----------------------------------------------------------------------
2j3hA           ----------------------------------------------------------------------
1e3jA           GKNVKH------LKKGDRVCQFCKEGKYLTFCATPPDDCHKLPDNVSLEEGALLEPLSVGVHACRRAGVQ
3b70A           GSDVTH------IQVGDRVY-----GAQNEMCPRTPDQWAKIPKGLSFEQAAALPAGISTAGLAMKLLGL
3b6zA           GSDVTH------IQVGDRVY-----GAQNEMCPRTPDQWAKIPKGLSFEQAAALPAGISTAGLAMKLLGL
1jvbA           GGDLQGEGNCYYCRIGERWLGINFDGAYAEYVIVPHYKYYKL-RRLNAVEAAPLTCSGITTYRAV-----
1pl8A           GSSVKHPGDRVAIEPGDEFCKM---GRYIFFCATPPDDCYKLPDNVTFEEGALIEP--LSVGIHACRRGG
1zsvA           ----------------------------------------------------------------------
2zb3A           ----------------------------------------------------------------------
3gqvA           GSDVTH------IQVGDRVY-----GAQNEMCPRTPDQWAKIPKGLSFEQAAALPAGISTAGLAMKLLGL
1y9aA           ----------------------------------------------------------------------
2zb8A           ----------------------------------------------------------------------
2zb7A           ----------------------------------------------------------------------
2zb4A           ----------------------------------------------------------------------
2w98B           ----------------------------------------------------------------------
2w98A           ----------------------------------------------------------------------
2vnaA           ----------------------------------------------------------------------
2ouiA           ----------------------------------------------------------------------
1kevA           ----------------------------------------------------------------------
1f8fA           GPNVTE------LQVGDHV---VLSYGYCGKCT-------------------------------------
2b83A           ----------------------------------------------------------------------
2b5vA           ----------------------------------------------------------------------
1o8cC           SEDPRFHAGQEVLLTGWGV-GENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTAMLCVMALED
1o8cA           SEDPRFHAGQEVLLTGWGV-GENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTAMLCVMALED
1o89A           SEDPRFHAGQEVLLTGWGV-GENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTAMLCVMALED
1vj1A           ----------------------------------------------------------------------
3iupB           XXXXXXXXXXXXXXXGKTVAAI--GGAYSQYRCIPADQCLVLPEGATPADGAS---------SFVNPLTA
3iupA           XXXXXXXXXXXXXXXGKTVAAI--GGAYSQYRCIPADQCLVLPEGATPADGAS---------SFVNPLTA
3f9iB           ----------------------------------------------------------------------
3f9iA           ----------------------------------------------------------------------
2vwgA           ----------------------------------------------------------------------
1jqbA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGKGPRGAAETLLIQGGSSGIGTTAIQIAKALGFKVFVTAGSDDKCKACESLGADRAINYKTQDFVAEVK
2j8zA           VQAG-----DYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATL
2obyA           VQAG-----DYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATL
1yb5A           IHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIK
2eihA           LGVRP---GDDVLVMXXXXXXXXXXIQIAKLFGARVIATAGSEDKLRRAKALGADETVNYTHPDWPKEVR
2eerB           -RKASLDPSKTLVVIGAGGGLGTMAIQIAKAVGATIIGVDVREEALEAAKRAGADYVINASSQDPVSEIR
2eerA           -RKASLDPSKTLVVIGAGGGLGTMAIQIAKAVGATIIGVDVREEALEAAKRAGADYVINASSQDPVSEIR
1qorA           IKPD-----EQFLFHAAAGGVGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAWQVINYREEDLVERLK
1wlyA           VKPG-----DYVLIHAAAGGMGHIMVPWARHLGATVIGTVSTEEKAETARKLGCHHTINYSTQDFAEVVR
2vz9B           MQPG-----ESVLIHSGSGGVGQAAIAIALSRGCRVFTTVGSAEKRAYLQALDETCFANSRDTSFEQHVL
2vz9A           MQPG-----ESVLIHSGSGGVGQAAIAIALSRGCRVFTTVGSAEKRAYLQALDETCFANSRDTSFEQHVL
2vz8B           MQPG-----ESVLIHSGSGGVGQAAIAIALSRGCRVFTTVGSAEKRAYLQALDETCFANSRDTSFEQHVL
2vz8A           MQPG-----ESVLIHSGSGGVGQAAIAIALSRGCRVFTTVGSAEKRAYLQALDETCFANSRDTSFEQHVL
2vn8B           LND-KNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVC-SQDASELVRKLGADDVIDYKSGSVEEQLK
2vn8A           LND-KNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVC-SQDASELVRKLGADDVIDYKSGSVEEQLK
2c0cB           LSEGKK-----VLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEP-VGTVL
2c0cA           LSEGKK-----VLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEP-VGTVL
1pqwA           LSPGER-----VLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEIL
1pqwB           LSPGER-----VLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEIL
3gmsA           LQRN-----DVLLVNACGSAIGHLFAQLSQILNFRLIAVTRNNKHTEELLRLGAAYVIDTSTAPLYETVM
1lluA           --KQTNARPGQWVAISGIGGLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPVEAIQ
3fbgA           ISRNRNNEGKTLLIINGAGGVGSIATQIAKAYGLRVITTASRNETIEWTKKMGADIVLNHK-ESLLNQFK
1ntoA           -RKASLDPTKXXXXXXXXXXXXXXXXQIAKAVGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPLAEIR
3fbgB           ISRNRNNEGKTLLIINGAGGVGSIATQIAKAYGLRVITTASRNETIEWTKKMGADIVLNHK---------
1rjwA           -----AKPGEWVAIY-GIGGLGHVAVQYAKAMGLNVVAVDIGDEKLELAKELGADLVVNPLKEDAAKFMK
3i4cA           -RKASLDPTKXXXXXXXXXXXXXXXXQIAKAVGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPLAEIR
1r37A           -RKASLDPTKXXXXXXXXXXXXXXXXQIAKAVGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPLAEIR
3i4cH           -RKASLDPTKXXXXXXXXXXXXXXXXQIAKAVGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPLAEIR
1xa0B           HGLTPRG---PVLVTGATGGVGSLAVSLAKR-GYTVEASTGKAAEHDYLRVLGAKEVL-------AERIR
3i4cC           -RKASLDPTKXXXXXXXXXXXXXXXXQIAKAVGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPLAEIR
1xa0A           HGLTPRG---PVLVTGATGGVGSLAVSLAKR-GYTVEASTGKAAEHDYLRVLGAKEVLELDKQRWAAAV-
1h2bB           -----KKAARTLYPGAGVGGLGHIAVQLLKVMTPATVIALDKEEKLKLAERLGADHVVDAR-RDPVKQVM
1v3vB           LEVCGVKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEAL
1v3uB           LEVCGVKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEAL
1v3uA           LEVCGVKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEAL
1v3tB           LEVCGVKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEAL
1v3tA           LEVCGVKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEAL
1h2bA           -----KKAARTLYPGAGVGGLGHIAVQLLKVMTPATVIALDKEEKLKLAERLGADHVVDAR-RDPVKQVM
2dm6A           LEVCGVKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEAL
1iyzA           ARPG-----EKXXXXXXXXXXXXXXXXXXRAMGLRVLAAASRPXXXXXXXXXXXXXXXTY------AEVP
3i4cD           -RKASLDPTKXXXXXXXXXXXXXXXXQIAKAVGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPLAEIR
3i4cB           -RKASLDPTKXXXXXXXXXXXXXXXXQIAKAVGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPLAEIR
3i4cE           -RKASLDPTKXXXXXXXXXXXXXXXXQIAKAVGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPLAEIR
2dq4A           AGSGVSG--KSVLIT-GAGPIGLMAAMVVRASGAGPILVSDPNPYRLAFARPYADRLVNPLEEDLLEVVR
3gazB           VQD-----XXXXXXXXXXXXXXXXXXXXALARGARVFATARGSD-LEYVRDLGATPIASREPEDYAAE--
3gazA           VQD-----XXXXXXXXXXXXXXXXXXXXALARGARVFATARGSD-LEYVRDLGATPIASREPEDYAAE--
2dfvA           --AGPISGKSVLIT--GAGPLGLLGIAVAKASGYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVD
2d8aA           --AGPISGKSVLIT--GAGPLGLLGIAVAKASGYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVD
2hcyA           M------AGHWVXXXXXXXXXXXXXVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFKEKDIVGAVL
3gfbA           --AGPIAGRSTLIT--GAGPLGLLGIAVAKASGYPVIVSEPSEFRRKLAKKVGADYVVNPFEEDPVKFVM
2h6eA           ALPFISKFAEPVVIVNGIGGLAVYTIQILKALMKNITIVGISRSKKHRALELGADYVSEMK--DAESLIN
1tt7A           NGLSPE---KXXXXXXXXXXXXXXXXXXLNKRGYDVVASTGNREAADYLKQLGASEVIS-REDVYDGTLK
1zsyA           LQPG-----DSVIQNASNSGVGQAVIQIAAALGLRINVVRDRPDIQKLSDSLGAEHVI------------
2vcyA           LQPG-----DSVIQNASNSGVGQAVIQIAAALGLRINVVRDRPDIQKLSDSLGAEHVI------------
3ip1C           ---GIRPGDNVVILGGGPIGLAAVAI-LKHAGASKVILSEPSEVRRNLAKELGADHVIDPTKENFVEAVL
3ip1A           ---GIRPGDNVVILGGGPIGLAAVAI-LKHAGASKVILSEPSEVRRNLAKELGADHVIDPTKENFVEAVL
1vj0D           -------AGKTVVIQGAGP-LGLFGVVIARSLGAEVIVIAGSPNRLKLAEEIGADLTLNRRETSVEERRK
1vj0B           -------AGKTVVIQGAGP-LGLFGVVIARSLGAEVIVIAGSPNRLKLAEEIGADLTLNRRETSVEERRK
1vj0A           -------AGKTVVIQGAGP-LGLFGVVIARSLGAEVIVIAGSPNRLKLAEEIGADLTLNRRETSVEERRK
2j3hB           ---------ETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTFGFDDAFNYKEESDLTAAL
2j3hA           ---------ETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTFGFDDAFNYKEESDLTAAL
1e3jA           LG--------TTVLVIGAGPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGAD---------------
3b70A           PLPSPHSKPVYVLVYGGSTATATVTMQMLRLSGYIPIATC-SPHNFDLAKSRGAEEVFDYRAPNLAQTIR
3b6zA           PLPSPHSKPVYVLVYGGSTATATVTMQMLRLSGYIPIATC-SPHNFDLAKSRGAEEVFDYRAPNLAQTIR
1jvbA           --RKASLDPTKXXXXXXXXXXXXXXXQIAKAVGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPLAEIR
1pl8A           VTLGHK------VLVCGAGPIGMVTLLVAKAMGAQVVVTDLSATRLSKAKEIGADLVLQI-SKESPQEIA
1zsvA           -----------------------------KLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETL
2zb3A           ------GSNQTMVVXXXXXXXXXXXXQIGHLLGCRVVGICGTQEKCLFLTSLGFDAAVNYKTGNVAEQLR
3gqvA           PLPSPHSKPVYVLVYGGSTATATVTMQMLRLSGYIPIATC-SPHNFDLAKSRGAEEVFDYRAPNLAQTIR
1y9aA           ----------------GIGPVGLMSVAGANHLGARIFAVGSRKHCCDIALEYGATDIINYKNGDIVEQIL
2zb8A           --------------------------QIGHFLGCRVVGICGTHEKCILLTSLGFDAAINYK-KDNVAEQL
2zb7A           --------------------------QIGHFLGCRVVGICGTHEKCILLTSLGFDAAINYK-KDNVAEQL
2zb4A           --------------------------QIGHFLGCRVVGICGTHEKCILLTSLGFDAAINYK-KDNVAEQL
2w98B           --------------------------QIGHFLGCRVVGICGTHEKCILLTSLGFDAAINYK-KDNVAEQL
2w98A           --------------------------QIGHFLGCRVVGICGTHEKCILLTSLGFDAAINYK-KDNVAEQL
2vnaA           --------------------------QIGHFLGCRVVGICGTHEKCILLTSLGFDAAINYK-KDNVAEQL
2ouiA           ----------------GIGPVGLMSVAGANHLGARIFAVGSRKHCCDIALEYGATDIINYKNGDIVEQIL
1kevA           -----------------------------KLRGAGRIIGVGSRPICEAAKFYGATDILNYKNGHIVDQVM
1f8fA           ------------------------------------------ESRLELAKQLGATHVINSKTQDPVAAIK
2b83A           -----------------------------KLRGAGRIIGVGSRPICEAAKFYGATDILNYKNGHIVDQVM
2b5vA           ----------------------------------------------------------------------
1o8cC           AGVRPQDG--EIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVL---PRDEFAESR
1o8cA           AGVRPQDG--EIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVL---PRDEFAESR
1o89A           AGVRPQDG--EIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVL---PRDEFAESR
1vj1A           --------------------------QIGHLLGCRVVGICGTQEKCLFLTSLGFDAAVNYKTGNVAEQLR
3iupB           LGVETRLEGHSALVHTAAASNLGQLNQICLKDGIKLVNIVRKQEQADLLKAQGAVHVCNAASPTFQDLTE
3iupA           LGVETRLEGHSALVHTAAASNLGQLNQICLKDGIKLVNIVRKQEQADLLKAQGAVHVCNAASPTFQDLTE
3f9iB           ---------KTSLITGASSGIGSAIARLLHKLGSKVIISGSNEEKLK---SLGNALKDNY----------
3f9iA           ---------KTSLITGASSGIGSAIARLLHKLGSKVIISGSNEEKLK---SLGNALKDNY----------
2vwgA           ----------------------------------------------------------------------
1jqbA           -----------------------------KLRGAGRIIGVGSRPICEAAKFYGATDILNYKNGHIEDQVM


                         .         .         .         +         .         .         .:280
query           ALTEGKGVDVILDMVAGSYLARELSCIADDGRIVIIALLGGGKAEIPLGDILRRRITITGSTLRPRPASF
2j8zA           KFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLSKLLFKRGSLITSLLRSRDNKY
2obyA           KFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLSKLLFKRGSLITSLLRSRDNKY
1yb5A           KYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVG--SRGTIEINPRDTMAKESSIIGVTLFSSTKEE
2eihA           RLTGGKGADKVVDHTGALYFEGVIKATXXXXXXXXXXXXXXYEGTLPFAHVFYRQLSILGSTMASKSRLF
2eerB           RITQGKGADAVIDLNSEKTLSIYPYVLAKQGKYVMVGLFGADKYHAPL--ITLNEVQFIGS-LVGNQSDF
2eerA           RITQGKGADAVIDLNSEKTLSIYPYVLAKQGKYVMVGLFGADKYHAPL--ITLNEVQFIGS-LVGNQSDF
1qorA           EITGGKKVRVVYDSVGRDTWERSLDCLQRRGLMVSFGNSSGAVTGVNLG-ILNQK----GSLYVTRP-SL
1wlyA           EITGGKGVDVVYDSIGKDTLQKSLDCLRPRGMCAAYGHASG------VADPIREDLGVRGSLFITRPASN
2vz9B           RHTAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHALGMAVFLKNVTFHGILL---DSLF
2vz9A           RHTAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHALGMAVFLKNVTFHGILL---DSLF
2vz8B           RHTAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHALGMAVFLKNVTFHGILL---DSLF
2vz8A           RHTAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHALGMAVFLKNVTFHGILL---DSLF
2vn8B           SL---KPFDFILDNVGGSTETWAPDFLATYVTLVTPFLLNMDRLGIADG-MLQTGVTVGSKALKHKGVHY
2vn8A           SL---KPFDFILDNVGGSTETWAPDFLATYVTLVTPFLLNMDRLGIADG-MLQTGVTVGSKALKHKGVHY
2c0cB           KQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGGLSPVKAGKLLKKSASVQGFFLNHYLSKY
2c0cA           KQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGGLSPVKAGKLLKKSASVQGFFLNHYLSKY
1pqwA           ELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFI------------------------------------
1pqwB           ELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFI------------------------------------
3gmsA           ELTNGIGADAAIDSIGGPDGNELAFSLRPNGHFLTIGLLSG-----------------------------
1lluA           R-DIGGAHGVLVTAVSNSAFGQAIGMARRGGTIALVG-LPPGDFPTPIFDVVLKGLHIAGSIVGTR----
3fbgA           --TQGELVDVFCTFNTDMYYDDMIQLVKPRGHIATIVAF---ENDQDLNALKPKSLSFSHEFMFARPLNY
1ntoA           RITESKGVDAVIDL---NYSEKTLSALAKQGKYVMVGLFG--------ADLHYHAPLITLSEIQ-----F
3fbgB           ----------------------------------------------------------------------
1rjwA           EKXXXXXXXXXXXXSKPAFQS-AYNSIRRGGACVLVG-LPPEEMPIPIFDTVLNGIKIIGSIVGTRKDL-
3i4cA           RITESKGVDAVIDL---NYSEKTLSALAKQGKYVMVGLFG--------ADLHYHAPLITLSEIQ-----F
1r37A           RITESKGVDAVIDLNSEKTLSVYPKALAKQGKYVMVGLFG--------ADLHYHAPLITLSEIQ-----F
3i4cH           RITESKGVDAVIDL---NYSEKTLSALAKQGKYVMVGLFG--------ADLHYHAPLITLSEIQ-----F
1xa0B           PLDKQRWAAAV-DPVGGRTLATVLS-RRYGGAVAVSGLTGGAEVPTTVHPFILRGVSLLG---------I
3i4cC           RITESKGVDAVIDL---NYSEKTLSALAKQGKYVMVGLFG--------ADLHYHAPLITLSEIQ-----F
1xa0A           ------------DPVGGRTLATVLS-RRYGGAVAVSGLTGGAEVPTTVHPFILRGVSLLG---------I
1h2bB           ELTRGRGVNVAMDFV-GSQATVDYTLLGRMGRLIIVGY--GGELRFPTIRVISSEVSFEGSLV-------
1v3vB           KKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISNRMDQLPPGSIIYKQLRIEGFIV----YRW
1v3uB           KKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISNRMDQLPPGSIIYKQLRIEGFIV----YRW
1v3uA           KKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAIC-----GAISLPPGSIIYKQLRIEGFIV----YRW
1v3tB           KKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISNRMDQLPPGSIIYKQLRIEGFIV----YRW
1v3tA           KKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISNRMDQLPPGSIIYKQLRIEGFIV----YRW
1h2bA           ELTRGRGVNVAMDFV-GSQATVDYTLLGRMGRLIIVGY--GGELRFPTIRVISSEVSFEGSLV-------
2dm6A           KKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISNRMDQLPPGSIIYKQLRIEGFIV----YRW
1iyzA           ERAKAGGLDLVLE-VRGKEVEESLGLLAHGGRLVYI---GAAEAPIPPLRLMRRNLAVLGFWL--TPLLR
3i4cD           RITESKGVDAVIDL---NYSEKTLSALAKQGKYVMVGLFG--------ADLHYHAPLITLSEIQ-----F
3i4cB           RITESKGVDAVIDL---NYSEKTLSALAKQGKYVMVGLFG--------ADLHYHAPLITLSEIQ-----F
3i4cE           RITESKGVDAVIDL---NYSEKTLSALAKQGKYVMVGLFG--------ADLHYHAPLITLSEIQ-----F
2dq4A           RVT-GSGVEVLLEFSGNEAAIHQ----------GLMALIPGGEARIPIGELVMRGITAFGIAGRRLWQTW
3gazB           -HTAGQGFDLVYDTLGGPVLDASFSAVKRFGHVV--SCLGWGTHK--LAPLSFKQATYSGVFTLHTLLAN
3gazA           -HTAGQGFDLVYDTLGGPVLDASFSAVKRFGHVV--SCLGWGTHK--LAPLSFKQATYSGVFTLHTLLAN
2dfvA           -ITDGNGVDVFLEFSAPKALEQGLQAVTPAGRVSLLGLY-PGKVTIDFNNIIFKALTIYGITGR------
2d8aA           -ITDGNGVDVFLEFSAPKALEQGLQAVTPAGRVSLLGLY-PGKVTIDFNNIIFKALTIYGITGR------
2hcyA           KATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNR----
3gfbA           DITDGAGVEVFLEFSAPKALEQGLKAVTPGGRVSLLGL--------------------------------
2h6eA           KLTDGLGASIAIDLVGTEETTYNLKLLAQEGAIILVGMEG-------------KRVSLEAFDTAVWNKKL
1tt7A           ALSKQQWQGAV-DPVGGKQLASLLSKIQYGGSVAVSGLTGGGEVPATVYPFILRGVSLLG----------
1zsyA           ----------------------------------------------------------------------
2vcyA           ----------------------------------------------------------------------
3ip1C           DYTNGLGAKLFLEATGVPQLVIEEVIWRARGINATVAIVARADAKIPLGEVFQRRAQIVGSQGHSGHGTF
3ip1A           DYTNGLGAKLFLEATGVPQLVIEEVIWRARGINATVAIVARADAKIPLGEVFQRRAQIVGSQGHSGHGTF
1vj0D           AITHGRGADFILE---------------------------------------------------------
1vj0B           AITHGRGADFILE---------------------------------------------------------
1vj0A           AITHGRGADFILE---------------------------------------------------------
2j3hB           KRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQLSNIIYKRNRIQGFVV----SDF
2j3hA           KRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQLSNIIYKRNRIQGFVV----SDF
1e3jA           ----------------------------------------------------------------------
3b70A           TYTK------------------------------------------------------------------
3b6zA           TYTK------------------------------------------------------------------
1jvbA           RITESKGVDAVIDLNSEKTLSVYPKALAKQGKYVVGLFGADLHYHAPL--ITLSEIQFVGS-LVGNQSDF
1pl8A           RKVEGQ----------------------------------------------------------------
1zsvA           KKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAI-----------------------------------
2zb3A           EACPG-GVDVYFDNVGGDISNAVISQMNENSHIIL-----------------------------------
3gqvA           TYTK------------------------------------------------------------------
1y9aA           KATDGKGVDKVVIAGGVHTFAQAVKMIKPGSDIGNVNYLGGDNIDIP-----------------------
2zb8A           RESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVP-----------------------
2zb7A           RESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVP-----------------------
2zb4A           RESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVP-----------------------
2w98B           RESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVP-----------------------
2w98A           RESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVP-----------------------
2vnaA           RESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVP-----------------------
2ouiA           KATDGKGVDKVV----------------------------------------------------------
1kevA           KLTNGKGVDRVIMAGGGSTLSQAVSMVKPGGIISNINYHGSGDA--------------------------
1f8fA           EITDG-GVNFALESTGSPEILKQVDALGILGKIAVVAPQLGTTAQFDVNDLLLGGKTILG----------
2b83A           KLTNGKGVDRVIMAGGGSTLSQAVSMVKPGGIISNINYHGSGDA--------------------------
2b5vA           ----------------------------------------------------------------------
1o8cC           PLEKAGAIDTVGDKVLAKVLAQ------------------------------------------------
1o8cA           PLEKAGAIDTVGDKVLAKVLAQ------------------------------------------------
1o89A           PLEKAGAIDTVGDKVLAKVLAQ------------------------------------------------
1vj1A           EACPG-GVDVYFDNVGG-----------------------------------------------------
3iupB           ALV-STGATIAFDATGGGKLGGQLTCEA------------------------------------------
3iupA           ALV-STGATIAFDATGGGKLGGQLTCEA------------------------------------------
3f9iB           ----------------------------------------------------------------------
3f9iA           ----------------------------------------------------------------------
2vwgA           ----------------------------------------------------------------------
1jqbA           KLTNGKGVDRVIMAGGGSTLSQAVKMVKPGGIISNINYHGSGDA--------------------------


                         .         *         .         .         .         .         +:350
query           KGAIAQALHQNVWPLLASGKIKPVIHKVFPAAQAADAHRLMESSEHIGKIVLTx
2j8zA           KQMLVNAFTEQILPHFSTQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVL--
2obyA           KQMLVNAFTEQILPHFSTQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVL--
1yb5A           FQQYAAALQAG----MEIGWLKPVIGSQYPLEKVAEAHNIIHGSGATGKMIL--
2eihA           P----------ILRFVEEGKLKPVVGQVLPLEAAAEGHRLLEERRVFGKVVL--
2eerB           LG---------IMSLAEAGKVKPMVTKTMKLEEANEAIDNLENFKAVGRQVL--
2eerA           LG---------IMSLAEAGKVKPMVTKTMKLEEANEAIDNLENFKAVGRQVL--
1qorA           QGYITTEASNELFSLIASGVIKVDVQQKYPLKDAQRAHEILESRATQGSSLL--
1wlyA           RSEIDEG-SKCLFDAVKAGVLHSSVAKTFPLREAAAAHKYMGGRQTIGSIVL--
2vz9B           EGATWQEVSELLKAGIQEGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVI--
2vz9A           EGATWQEVSELLKAGIQEGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVI--
2vz8B           EGATWQEVSELLKAGIQEGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVI--
2vz8A           EGATWQEVSELLKAGIQEGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVI--
2vn8B           RWAFFMASGDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVI--
2vn8A           RWAFFMASGDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVI--
2c0cB           QAAMSHLLEMCV------------------------------------------
2c0cA           QAAMSHLLEMCV------------------------------------------
1pqwA           ------------------------------------------------------
1pqwB           ------------------------------------------------------
3gmsA           ------------------------------------------------------
1lluA           ------ADLQEALDFAGEGLVKATIHKLDDINQILDQ---MRAGQIEGRIVL--
3fbgA           LEDITNKVEQNIY--------QPTTTKVIEGLTTENAHQILESNTMIGKLVI--
1ntoA           VGSLVQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAIGRQVL--
3fbgB           ------------------------------------------------------
1rjwA           ---------QEALQFAAEGKVKTII-EVQPLEKINEVFDRMLKGQINGRVVLT-
3i4cA           VGSLVQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAIGRQVL--
1r37A           VGSLVQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAIGRQVL--
3i4cH           VGSLVQSDFLGIMRLAEAGKVKPMITKTMKLEEANEA-----------------
1xa0B           DSVYCPDLRLRIWERLA-GDLKPDLERI--------------------------
3i4cC           VGSLVQSDFLGIMRLAEAGKVKPMITKTMKLEEANEA-----------------
1xa0A           DSVYCPDLRLRIWERLA-GDLKPDLERI--------------------------
1h2bB           -GNYVE-LHELV-TLALQGKVRVEIHKL---DEINDVLERLEKGEVLGRAVL--
1v3vB           QGDVREKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT-
1v3uB           QGDVREKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT-
1v3uA           QGDVREKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT-
1v3tB           QGDVREKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT-
1v3tA           QGDVREKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT-
1h2bA           -GNYVE-LHELV-TLALQGKVRVEIHKL---DEINDVLERLEKGEVLGRAVL--
2dm6A           QGDVREKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT-
1iyzA           EGALVEEALGFLLPRLGR-ELRPVVGPVFPXXXXXXXXXXXXXXGHTGKVVV--
3i4cD           VGSLVQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENRQ---------
3i4cB           VGSLVQSDFLGIMRLAEAGKVKPMITKTMKLEEANEA-----------------
3i4cE           VGSLVQSDFLGIMRLAEAGKVKPMITKTMKLEEANEA-----------------
2dq4A           MQGTA---------LVYSGRVSPLLTHRLPLSRYREAFGLLASGQAV-KVIL--
3gazB           EGLAHFGELREADALVQTGKLAPRLDRTFSIAEIGSAYDAVLGRNDVGKIAIT-
3gazA           EGLAHFGELREADALVQTGKLAPRLDRTFSIAEIGSAYDAVLGRNDVGKIAIT-
2dfvA           ------------------------------------------------------
2d8aA           ------------------------------------------------------
2hcyA           ------ADTREALDFFARGLVKSPI-KVVGLSTLPEIYEKMEKGQIVGRYVV--
3gfbA           ------------------------------------------------------
2h6eA           LGSNYGSLNEDVVRLSESGKIKPYIIKV--------------------------
1tt7A           ------------------------------------------------------
1zsyA           ------------------------------------------------------
2vcyA           ------------------------------------------------------
3ip1C           PRVISLA-----------------------------------------------
3ip1A           PRVISLA-----------------------------------------------
1vj0D           ------------------------------------------------------
1vj0B           ------------------------------------------------------
1vj0A           ------------------------------------------------------
2j3hB           YDKYSKFL-EFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVV--
2j3hA           YDKYSKFL-EFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVV--
1e3jA           ------------------------------------------------------
3b70A           ------------------------------------------------------
3b6zA           ------------------------------------------------------
1jvbA           LGI----------RLAEAGKVKPITKKLEEANEAIDN---LENFKAIGRQVL--
1pl8A           ------------------------------------------------------
1zsvA           ------------------------------------------------------
2zb3A           ------------------------------------------------------
3gqvA           ------------------------------------------------------
1y9aA           ------------------------------------------------------
2zb8A           ------------------------------------------------------
2zb7A           ------------------------------------------------------
2zb4A           ------------------------------------------------------
2w98B           ------------------------------------------------------
2w98A           ------------------------------------------------------
2vnaA           ------------------------------------------------------
2ouiA           ------------------------------------------------------
1kevA           ------------------------------------------------------
1f8fA           ------------------------------------------------------
2b83A           ------------------------------------------------------
2b5vA           ------------------------------------------------------
1o8cC           ------------------------------------------------------
1o8cA           ------------------------------------------------------
1o89A           ------------------------------------------------------
1vj1A           ------------------------------------------------------
3iupB           ------------------------------------------------------
3iupA           ------------------------------------------------------
3f9iB           ------------------------------------------------------
3f9iA           ------------------------------------------------------
2vwgA           ------------------------------------------------------
1jqbA           ------------------------------------------------------