[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF07859.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3h81B.bssp"
#ERROR : Can't open dsspfile "3h81A.bssp"
#ERROR : Can't open dsspfile "2hw5A.bssp"
#ERROR : Can't open dsspfile "1mj3A.bssp"
#ERROR : Can't open dsspfile "1ey3A.bssp"
#ERROR : Can't open dsspfile "1dubB.bssp"
#ERROR : Can't open dsspfile "1dubA.bssp"
#ERROR : Can't open dsspfile "2dubE.bssp"
#ERROR : Can't open dsspfile "2dubA.bssp"
#ERROR : Can't open dsspfile "3gowA.bssp"
#ERROR : Can't open dsspfile "2dubD.bssp"
#ERROR : Can't open dsspfile "2qq3I.bssp"
#ERROR : Can't open dsspfile "2qq3C.bssp"
#ERROR : Can't open dsspfile "2pbpA.bssp"
#ERROR : Can't open dsspfile "3hrxF.bssp"
#ERROR : Can't open dsspfile "3gowF.bssp"
#ERROR : Can't open dsspfile "2vx2I.bssp"
#ERROR : Can't open dsspfile "2vx2H.bssp"
#ERROR : Can't open dsspfile "2vx2G.bssp"
#ERROR : Can't open dsspfile "2vx2F.bssp"
#ERROR : Can't open dsspfile "2vx2E.bssp"
#ERROR : Can't open dsspfile "2vx2B.bssp"
#ERROR : Can't open dsspfile "2vx2A.bssp"
#ERROR : Can't open dsspfile "2iexA.bssp"
#ERROR : Can't open dsspfile "2iexB.bssp"
#ERROR : Can't open dsspfile "3he2C.bssp"
#ERROR : Can't open dsspfile "3he2A.bssp"
#ERROR : Can't open dsspfile "1ef9A.bssp"
#ERROR : Can't open dsspfile "1ef8A.bssp"
#ERROR : Can't open dsspfile "2uzfA.bssp"
#ERROR : Can't open dsspfile "2uzfB.bssp"
#ERROR : Can't open dsspfile "1ef8B.bssp"
#ERROR : Can't open dsspfile "1ef8C.bssp"
#ERROR : Can't open dsspfile "1hzdB.bssp"
#ERROR : Can't open dsspfile "1hzdA.bssp"
#ERROR : Can't open dsspfile "2vreC.bssp"
#ERROR : Can't open dsspfile "2vreB.bssp"
#ERROR : Can't open dsspfile "2vreA.bssp"
#ERROR : Can't open dsspfile "2gtrC.bssp"
#ERROR : Can't open dsspfile "2gtrB.bssp"
#ERROR : Can't open dsspfile "2gtrA.bssp"
#ERROR : Can't open dsspfile "2ej5A.bssp"
#ERROR : Can't open dsspfile "2ppyE.bssp"
#ERROR : Can't open dsspfile "2ppyC.bssp"
#ERROR : Can't open dsspfile "2ppyB.bssp"
#ERROR : Can't open dsspfile "2ppyA.bssp"
#ERROR : Can't open dsspfile "2fbmB.bssp"
#ERROR : Can't open dsspfile "2fbmA.bssp"
#ERROR : Can't open dsspfile "2ej5B.bssp"
#ERROR : Can't open dsspfile "1rjnB.bssp"
#ERROR : Can't open dsspfile "2zqqF.bssp"
#ERROR : Can't open dsspfile "1q52B.bssp"
#ERROR : Can't open dsspfile "1q51B.bssp"
#ERROR : Can't open dsspfile "2fw2F.bssp"
#ERROR : Can't open dsspfile "2fw2E.bssp"
#ERROR : Can't open dsspfile "2fw2D.bssp"
#ERROR : Can't open dsspfile "2fw2C.bssp"
#ERROR : Can't open dsspfile "2fw2B.bssp"
#ERROR : Can't open dsspfile "2fw2A.bssp"
#ERROR : Can't open dsspfile "1q51A.bssp"
#ERROR : Can't open dsspfile "1q52K.bssp"
#ERROR : Can't open dsspfile "1q52A.bssp"
#ERROR : Can't open dsspfile "2vssF.bssp"
#ERROR : Can't open dsspfile "2j5iI.bssp"
#ERROR : Can't open dsspfile "2j5iG.bssp"
#ERROR : Can't open dsspfile "2j5iF.bssp"
#ERROR : Can't open dsspfile "2j5iE.bssp"
#ERROR : Can't open dsspfile "2j5iD.bssp"
#ERROR : Can't open dsspfile "2j5iC.bssp"
#ERROR : Can't open dsspfile "2j5iB.bssp"
#ERROR : Can't open dsspfile "2j5iA.bssp"
#ERROR : Can't open dsspfile "2vsuF.bssp"
#ERROR : Can't open dsspfile "2vsuD.bssp"
#ERROR : Can't open dsspfile "2vsuC.bssp"
#ERROR : Can't open dsspfile "2vsuB.bssp"
#ERROR : Can't open dsspfile "2vssE.bssp"
#ERROR : Can't open dsspfile "2vsuE.bssp"
#ERROR : Can't open dsspfile "3h02D.bssp"
#ERROR : Can't open dsspfile "2vssC.bssp"
#ERROR : Can't open dsspfile "2vssA.bssp"
#ERROR : Can't open dsspfile "3h02E.bssp"
#ERROR : Can't open dsspfile "2vsuA.bssp"
#ERROR : Can't open dsspfile "3h02A.bssp"
#ERROR : Can't open dsspfile "3h02B.bssp"
#ERROR : Can't open dsspfile "1rjnC.bssp"
#ERROR : Can't open dsspfile "1rjnA.bssp"
#ERROR : Can't open dsspfile "3h02C.bssp"
#ERROR : Can't open dsspfile "2a7kI.bssp"
#ERROR : Can't open dsspfile "2a7kA.bssp"
#ERROR : Can't open dsspfile "1rjmB.bssp"
#ERROR : Can't open dsspfile "1rjmA.bssp"
#ERROR : Can't open dsspfile "2a7kC.bssp"
#ERROR : Can't open dsspfile "1nzyC.bssp"
#ERROR : Can't open dsspfile "1nzyA.bssp"
#ERROR : Can't open dsspfile "1nzyB.bssp"
#ERROR : Can't open dsspfile "1jxzC.bssp"
#ERROR : Can't open dsspfile "1jxzB.bssp"
#ERROR : Can't open dsspfile "1jxzA.bssp"
#ERROR : Can't open dsspfile "1dciA.bssp"
#ERROR : Can't open dsspfile "3fduA.bssp"
#ERROR : Can't open dsspfile "2a81A.bssp"
#ERROR : Can't open dsspfile "2a7kH.bssp"
#ERROR : Can't open dsspfile "2a7kF.bssp"
#ERROR : Can't open dsspfile "2a7kE.bssp"
#ERROR : Can't open dsspfile "2a7kB.bssp"
#ERROR : Can't open dsspfile "2a7kD.bssp"
#ERROR : Can't open dsspfile "3fduB.bssp"
#ERROR : Can't open dsspfile "1rjmC.bssp"
#ERROR : Can't open dsspfile "2a7kG.bssp"
#ERROR : Can't open dsspfile "3fduE.bssp"
#ERROR : Can't open dsspfile "3fduD.bssp"
#ERROR : Can't open dsspfile "2f6qA.bssp"
#ERROR : Can't open dsspfile "3i47A.bssp"
#ERROR : Can't open dsspfile "3h02F.bssp"
#ERROR : Can't open dsspfile "3fduF.bssp"
#ERROR : Can't open dsspfile "2f6qB.bssp"
#ERROR : Can't open dsspfile "3fduC.bssp"
#ERROR : Can't open dsspfile "2f6qC.bssp"
#ERROR : Can't open dsspfile "2q35A.bssp"
#ERROR : Can't open dsspfile "3g64A.bssp"
#ERROR : Can't open dsspfile "1uiyA.bssp"
#ERROR : Can't open dsspfile "3hinA.bssp"
#ERROR : Can't open dsspfile "3hinB.bssp"
#ERROR : Can't open dsspfile "1pjhB.bssp"
#ERROR : Can't open dsspfile "1pjhA.bssp"
#ERROR : Can't open dsspfile "2pg8C.bssp"
#ERROR : Can't open dsspfile "2pg8A.bssp"
#ERROR : Can't open dsspfile "2np9C.bssp"
#ERROR : Can't open dsspfile "2np9B.bssp"
#ERROR : Can't open dsspfile "2np9A.bssp"
#ERROR : Can't open dsspfile "1wdmB.bssp"
#ERROR : Can't open dsspfile "1wdmA.bssp"
#ERROR : Can't open dsspfile "1wdlB.bssp"
#ERROR : Can't open dsspfile "1wdlA.bssp"
#ERROR : Can't open dsspfile "1wdkB.bssp"
#ERROR : Can't open dsspfile "1wdkA.bssp"
#ERROR : Can't open dsspfile "1pjhC.bssp"
#ERROR : Can't open dsspfile "1k39C.bssp"
#ERROR : Can't open dsspfile "1k39B.bssp"
#ERROR : Can't open dsspfile "1k39A.bssp"
#ERROR : Can't open dsspfile "1hnoA.bssp"
#ERROR : Can't open dsspfile "1szoF.bssp"
#ERROR : Can't open dsspfile "1szoD.bssp"
#ERROR : Can't open dsspfile "1szoB.bssp"
#ERROR : Can't open dsspfile "1szoA.bssp"
#ERROR : Can't open dsspfile "3h0uC.bssp"
#ERROR : Can't open dsspfile "3h0uB.bssp"
#ERROR : Can't open dsspfile "3h0uA.bssp"
#ERROR : Can't open dsspfile "2q34A.bssp"
#ERROR : Can't open dsspfile "2q2xA.bssp"
#ERROR : Can't open dsspfile "3isaF.bssp"
#ERROR : Can't open dsspfile "3isaD.bssp"
#ERROR : Can't open dsspfile "3isaC.bssp"
#ERROR : Can't open dsspfile "3isaB.bssp"
#ERROR : Can't open dsspfile "3isaA.bssp"
#ERROR : Can't open dsspfile "2w3pB.bssp"
#ERROR : Can't open dsspfile "2w3pA.bssp"
#ERROR : Can't open dsspfile "3hp0B.bssp"
#ERROR : Can't open dsspfile "3hp0A.bssp"
#ERROR : Can't open dsspfile "3gkbC.bssp"
#ERROR : Can't open dsspfile "3gkbB.bssp"
#ERROR : Can't open dsspfile "3gkbA.bssp"

## Summary of PDB Search
:259
    4e-31  31%  3h81B  [x.x.x] ENOYL-COA HYDRATASE ECHA8
    4e-31  31%  3h81A  [x.x.x] ENOYL-COA HYDRATASE ECHA8
    1e-29  30%  2hw5A  [x.x.x] ENOYL-COA HYDRATASE
    5e-29  30%  1mj3A  [c.14.1] ENOYL-COA HYDRATASE, MITOCHONDRIAL
    8e-29  30%  1ey3A  [c.14.1] ENOYL-COA HYDRATASE
    8e-29  30%  1dubB  [c.14.1] 2-ENOYL-COA HYDRATASE
    8e-29  30%  1dubA  [c.14.1] 2-ENOYL-COA HYDRATASE
    4e-28  29%  2dubE  [c.14.1] 2-ENOYL-COA HYDRATASE
    4e-28  29%  2dubA  [c.14.1] 2-ENOYL-COA HYDRATASE
    3e-27  31%  3gowA  [x.x.x] PROBABLE ENOYL-COA HYDRATASE
    3e-27  30%  2dubD  [c.14.1] 2-ENOYL-COA HYDRATASE
    5e-27  28%  2qq3I  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I
    5e-27  28%  2qq3C  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I
    5e-27  28%  2pbpA  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I
    6e-27  31%  3hrxF  [x.x.x] PROBABLE ENOYL-COA HYDRATASE
    6e-27  31%  3gowF  [x.x.x] PROBABLE ENOYL-COA HYDRATASE
    1e-23  28%  2vx2I  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    1e-23  28%  2vx2H  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    1e-23  28%  2vx2G  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    1e-23  28%  2vx2F  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    1e-23  28%  2vx2E  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    1e-23  28%  2vx2B  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    1e-23  28%  2vx2A  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    7e-23  31%  2iexA  [x.x.x] DIHYDROXYNAPTHOIC ACID SYNTHETASE
    2e-22  32%  2iexB  [x.x.x] DIHYDROXYNAPTHOIC ACID SYNTHETASE
    2e-22  30%  3he2C  [x.x.x] ENOYL-COA HYDRATASE ECHA6
    3e-22  30%  3he2A  [x.x.x] ENOYL-COA HYDRATASE ECHA6
    3e-22  31%  1ef9A  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    2e-21  32%  1ef8A  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    4e-21  31%  2uzfA  [x.x.x] NAPHTHOATE SYNTHASE
    5e-21  31%  2uzfB  [x.x.x] NAPHTHOATE SYNTHASE
    1e-20  32%  1ef8B  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    3e-20  32%  1ef8C  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    5e-20  27%  1hzdB  [c.14.1] AU-BINDING PROTEIN/ENOYL-COA HYDRATASE
    5e-20  27%  1hzdA  [c.14.1] AU-BINDING PROTEIN/ENOYL-COA HYDRATASE
    9e-20  30%  2vreC  [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE
    9e-20  30%  2vreB  [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE
    9e-20  30%  2vreA  [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE
    1e-19  29%  2gtrC  [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN
    1e-19  29%  2gtrB  [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN
    1e-19  29%  2gtrA  [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN
    1e-19  28%  2ej5A  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II
    2e-19  31%  2ppyE  [x.x.x] ENOYL-COA HYDRATASE
    2e-19  31%  2ppyC  [x.x.x] ENOYL-COA HYDRATASE
    2e-19  31%  2ppyB  [x.x.x] ENOYL-COA HYDRATASE
    2e-19  31%  2ppyA  [x.x.x] ENOYL-COA HYDRATASE
    2e-19  27%  2fbmB  [x.x.x] Y CHROMOSOME CHROMODOMAIN PROTEIN 1, TELOMERIC
    2e-19  27%  2fbmA  [x.x.x] Y CHROMOSOME CHROMODOMAIN PROTEIN 1, TELOMERIC
    3e-19  28%  2ej5B  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II
    8e-19  31%  1rjnB  [c.14.1] MENB
    1e-18  27%  2zqqF  [x.x.x] METHYLGLUTACONYL-COA HYDRATASE
    1e-18  31%  1q52B  [c.14.1] MENB
    1e-18  30%  1q51B  [c.14.1] MENB
    1e-18  26%  2fw2F  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    1e-18  26%  2fw2E  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    1e-18  26%  2fw2D  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    1e-18  26%  2fw2C  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    1e-18  26%  2fw2B  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    1e-18  26%  2fw2A  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    2e-18  31%  1q51A  [c.14.1] MENB
    5e-18  32%  1q52K  [c.14.1] MENB
    5e-18  32%  1q52A  [c.14.1] MENB
    3e-17  26%  2vssF  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-17  26%  2j5iI  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-17  26%  2j5iG  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-17  26%  2j5iF  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-17  26%  2j5iE  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-17  26%  2j5iD  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-17  26%  2j5iC  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-17  26%  2j5iB  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-17  26%  2j5iA  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    7e-17  25%  2vsuF  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    7e-17  25%  2vsuD  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    7e-17  25%  2vsuC  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    7e-17  25%  2vsuB  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    1e-16  26%  2vssE  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    1e-16  26%  2vsuE  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    2e-16  37%  3h02D  [x.x.x] NAPHTHOATE SYNTHASE
    3e-16  27%  2vssC  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-16  27%  2vssA  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-16  37%  3h02E  [x.x.x] NAPHTHOATE SYNTHASE
    4e-16  26%  2vsuA  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    4e-16  37%  3h02A  [x.x.x] NAPHTHOATE SYNTHASE
    5e-16  36%  3h02B  [x.x.x] NAPHTHOATE SYNTHASE
    6e-16  33%  1rjnC  [c.14.1] MENB
    8e-16  32%  1rjnA  [c.14.1] MENB
    2e-15  37%  3h02C  [x.x.x] NAPHTHOATE SYNTHASE
    2e-15  29%  2a7kI  [x.x.x] CARB
    2e-15  29%  2a7kA  [x.x.x] CARB
    3e-15  34%  1rjmB  [c.14.1] MENB
    3e-15  34%  1rjmA  [c.14.1] MENB
    7e-15  28%  2a7kC  [x.x.x] CARB
    9e-15  25%  1nzyC  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    9e-15  25%  1nzyA  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-14  25%  1nzyB  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-14  25%  1jxzC  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-14  25%  1jxzB  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-14  25%  1jxzA  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-14  24%  1dciA  [c.14.1] DIENOYL-COA ISOMERASE
    2e-14  25%  3fduA  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    2e-14  29%  2a81A  [x.x.x] CARB
    2e-14  29%  2a7kH  [x.x.x] CARB
    2e-14  29%  2a7kF  [x.x.x] CARB
    2e-14  29%  2a7kE  [x.x.x] CARB
    2e-14  29%  2a7kB  [x.x.x] CARB
    2e-14  29%  2a7kD  [x.x.x] CARB
    3e-14  28%  3fduB  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    6e-14  32%  1rjmC  [c.14.1] MENB
    6e-14  29%  2a7kG  [x.x.x] CARB
    1e-13  27%  3fduE  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    2e-13  28%  3fduD  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    2e-13  29%  2f6qA  [x.x.x] PEROXISOMAL 3,2-TRANS-ENOYL-COA ISOMERASE
    5e-13  22%  3i47A  [x.x.x] ENOYL COA HYDRATASE/ISOMERASE (CROTONASE)
    5e-13  36%  3h02F  [x.x.x] NAPHTHOATE SYNTHASE
    5e-13  29%  3fduF  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    5e-13  28%  2f6qB  [x.x.x] PEROXISOMAL 3,2-TRANS-ENOYL-COA ISOMERASE
    8e-13  27%  3fduC  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    1e-12  29%  2f6qC  [x.x.x] PEROXISOMAL 3,2-TRANS-ENOYL-COA ISOMERASE
    1e-11  24%  2q35A  [x.x.x] CURF
    1e-10  28%  3g64A  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    1e-09  26%  1uiyA  [c.14.1] ENOYL-COA HYDRATASE
    3e-09  21%  3hinA  [x.x.x] PUTATIVE 3-HYDROXYBUTYRYL-COA DEHYDRATASE
    4e-09  21%  3hinB  [x.x.x] PUTATIVE 3-HYDROXYBUTYRYL-COA DEHYDRATASE
    1e-08  20%  1pjhB  [c.14.1] ENOYL-COA ISOMERASE ECI1P
    1e-08  20%  1pjhA  [c.14.1] ENOYL-COA ISOMERASE ECI1P
    2e-08  36%  2pg8C  [x.x.x] DPGC
    2e-08  36%  2pg8A  [x.x.x] DPGC
    2e-08  36%  2np9C  [x.x.x] DPGC
    2e-08  36%  2np9B  [x.x.x] DPGC
    2e-08  36%  2np9A  [x.x.x] DPGC
    6e-08  27%  1wdmB  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    6e-08  27%  1wdmA  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    6e-08  27%  1wdlB  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    6e-08  27%  1wdlA  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    6e-08  27%  1wdkB  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    6e-08  27%  1wdkA  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    2e-07  21%  1pjhC  [c.14.1] ENOYL-COA ISOMERASE ECI1P
    2e-07  22%  1k39C  [c.14.1] D3,D2-ENOYL COA ISOMERASE ECI1
    2e-07  22%  1k39B  [c.14.1] D3,D2-ENOYL COA ISOMERASE ECI1
    2e-07  22%  1k39A  [c.14.1] D3,D2-ENOYL COA ISOMERASE ECI1
    2e-07  21%  1hnoA  [c.14.1] D3,D2-ENOYL COA ISOMERASE ECI1
    4e-07  26%  1szoF  [c.14.1] 6-OXOCAMPHOR HYDROLASE
    4e-07  26%  1szoD  [c.14.1] 6-OXOCAMPHOR HYDROLASE
    4e-07  26%  1szoB  [c.14.1] 6-OXOCAMPHOR HYDROLASE
    4e-07  26%  1szoA  [c.14.1] 6-OXOCAMPHOR HYDROLASE
    9e-07  23%  3h0uC  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    9e-07  23%  3h0uB  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    9e-07  23%  3h0uA  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    3e-06  26%  2q34A  [x.x.x] CURF
    3e-06  26%  2q2xA  [x.x.x] CURF
    3e-06  25%  3isaF  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    3e-06  25%  3isaD  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    3e-06  25%  3isaC  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    3e-06  25%  3isaB  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    3e-06  25%  3isaA  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    4e-06  35%  2w3pB  [x.x.x] BENZOYL-COA-DIHYDRODIOL LYASE
    4e-06  35%  2w3pA  [x.x.x] BENZOYL-COA-DIHYDRODIOL LYASE
    6e-06  25%  3hp0B  [x.x.x] PUTATIVE POLYKETIDE BIOSYNTHESIS ENOYL-COA
    6e-06  25%  3hp0A  [x.x.x] PUTATIVE POLYKETIDE BIOSYNTHESIS ENOYL-COA
    2e-05  24%  3gkbC  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    2e-05  24%  3gkbB  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    2e-05  24%  3gkbA  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
:259

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxAQLLSERVDSTLVLTISNPEARNALHPDIYXXXXXXXXXXXRDDSIRAVILTGADGVFCAGGNLNRLL
3h81B           ----ILVERDQRVGIITLNRPQALNALNSQVMNEVTSAATELDDDPDIGAIIITGSAKAFAAGADIKEMX
3h81A           ----ILVERDQRVGIITLNRPQALNALNSQVMNEVTSAATELDDDPDIGAIIITGSAKAFAAGADIKEMX
2hw5A           --------------LIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQ
1mj3A           --------------LIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQ
1ey3A           --------------LIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQ
1dubB           --------------LIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQ
1dubA           --------------LIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQ
2dubE           --------------LIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQ
2dubA           --------------LIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQ
3gowA           ----VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEF-
2dubD           --------------LIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQ
2qq3I           --------------IIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGADIQEM-
2qq3C           --------------IIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGADIQEM-
2pbpA           --------------IIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGADIQEM-
3hrxF           ----VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDL----
3gowF           ----VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTE--
2vx2I           ------ARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKEL-
2vx2H           ------ARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKEL-
2vx2G           ------ARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKEL-
2vx2F           ------ARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKEL-
2vx2E           ------ARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKEL-
2vx2B           ------ARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKEL-
2vx2A           ------ARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKEL-
2iexA           ----IIYETYNGIAKITINRPEVHNAFRPKTVNEMIDAFTKARDDSNIGVIILTGAGGAFCSGGD-----
2iexB           ----IIYETYNGIAKITINRPEVHNAFRPKTVNEMIDAFTKARDDSNIGVIILTGAGGAFCSGGDLQRLI
3he2C           --------QAEAVLTIELQRPERRNALNSQLVEELTQAI----RKASARAIVLTGQGTAFCAGADLS---
3he2A           --------QAEAVLTIELQRPERRNALNSQLVEELTQAI----RKASARAIVLTGQGTAFCAGADLSG--
1ef9A           -----------------------------------------------IRCIILRAPSGVFSAGHDIHELP
1ef8A           -----------------------------------------------IRCIILRAPSGVFSAGHDIHEL-
2uzfA           ---------------VTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGGDLAFCSGGDQK---
2uzfB           ---------------VTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGGDLAFCSGGDQKKI-
1ef8B           -----------------------------------------------IRCIILRAPSGVFSAGHDID---
1ef8C           -----------------------------------------------IRCIILRAPSGVFSAGHDLS---
1hzdB           -----LEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSVPGIFCAGADLKERA
1hzdA           -----LEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSVPGIFCAGADLKERA
2vreC           -------------LHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMA
2vreB           -------------LHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMA
2vreA           -------------LHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMA
2gtrC           ------------THILLSTKSSENNSLNPEVMREVQSALSTAAADDS-KLVLLSAVGSVFCCGLDIRRLT
2gtrB           ------------THILLSTKSSENNSLNPEVMREVQSALSTAAADDS-KLVLLSAVGSVFCCGLDIRRLT
2gtrA           ------------THILLSTKSSENNSLNPEVMREVQSALSTAAADDS-KLVLLSAVGSVFCCGLDIRRLT
2ej5A           ---------------LTLNRPDQLNAFTEQMNAEVTKALKQAGADPNVRCVVITGAGRAFCAGEDLDHVL
2ppyE           --------------------------------------------DPDIKVVIVSDVPKFFSAGADINFL-
2ppyC           --------------------------------------------DPDIKVVIVSDVPKFFSAGADINFL-
2ppyB           --------------------------------------------DPDIKVVIVSDVPKFFSAGADINFL-
2ppyA           --------------------------------------------DPDIKVVIVSDVPKFFSAGADINFL-
2fbmB           -------------IVLSTRSTE-KNALNTEVIKEIVNALNSAAADDS-KLVLFSAAGSVFCCGLDFGYFV
2fbmA           -------------IVLSTRSTE-KNALNTEVIKEIVNALNSAAADDS-KLVLFSAAGSVFCCGLDFGYFV
2ej5B           ---------------LTLNRPDQLNAFTEQMNAEVTKALKQAGADPNVRCVVITGAGRAFCAGEDLSDVL
1rjnB           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGGDQRHIL
2zqqF           -----LEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSVPGIFCAGA------
1q52B           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGGDTVDV-
1q51B           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGGD-----
2fw2F           -------------IVLSTRSTE-KNALNTEVIKEMVNALNSAAADDS-KLVLFSAAGSVFCCGLDFGYFV
2fw2E           -------------IVLSTRSTE-KNALNTEVIKEMVNALNSAAADDS-KLVLFSAAGSVFCCGLDFGYFV
2fw2D           -------------IVLSTRSTE-KNALNTEVIKEMVNALNSAAADDS-KLVLFSAAGSVFCCGLDFGYFV
2fw2C           -------------IVLSTRSTE-KNALNTEVIKEMVNALNSAAADDS-KLVLFSAAGSVFCCGLDFGYFV
2fw2B           -------------IVLSTRSTE-KNALNTEVIKEMVNALNSAAADDS-KLVLFSAAGSVFCCGLDFGYFV
2fw2A           -------------IVLSTRSTE-KNALNTEVIKEMVNALNSAAADDS-KLVLFSAAGSVFCCGLDFGYFV
1q51A           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGGDQLHIL
1q52K           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGG------
1q52A           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGG------
2vssF           ----------DGIAFVILNRPERRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2j5iI           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2j5iG           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2j5iF           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2j5iE           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2j5iD           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2j5iC           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2j5iB           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2j5iA           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2vsuF           ----------DGIAFVILNRPERRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2vsuD           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2vsuC           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2vsuB           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2vssE           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
2vsuE           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYF
3h02D           ----------DGIAKITINRPQVRNAFRP-LTVKEIQALADARYDDNVGVIILTGGDKAFCAGG------
2vssC           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLG---
2vssA           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDL----
3h02E           ----------DGIAKITINRPQVRNAFRP-LTVKEIQALADARYDDNVGVIILTGGDKAFCAGG------
2vsuA           ----------DGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKE--
3h02A           ----------DGIAKITINRPQVRNAFRP-LTVKEIQALADARYDDNVGVIILTGGDKAFCAGGDQHHL-
3h02B           ----------DGIAKITINRPQVRNAFRP-LTVKEIQALADARYDDNVGVIILTGGDKAFCAGGHHLNVL
1rjnC           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGGDLHILE
1rjnA           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGGDQAR--
3h02C           ----------DGIAKITINRPQVRNAFRP-LTVKEIQALADARYDDNVGVIILTGGDKAFCAGG------
2a7kI           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGAERSFSAGGDFNEVK
2a7kA           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGAERSFSAGGDFNEVK
1rjmB           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGGHI----
1rjmA           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGGHI----
2a7kC           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGAERSFSAGGDFNEVK
1nzyC           ----------DGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREIP
1nzyA           ----------DGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREIP
1nzyB           ----------DGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREIP
1jxzC           ----------DGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREIP
1jxzB           ----------DGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREIP
1jxzA           ----------DGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREIP
1dciA           -------------LHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMA
3fduA           -------------LTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEHDFTAGNDMKDFM
2a81A           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGAERSFSAGGDFNEVK
2a7kH           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGAERSFSAGGDFNEVK
2a7kF           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGAERSFSAGGDFNEVK
2a7kE           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGAERSFSAGGDFNEVK
2a7kB           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGAERSFSAGGDFNEVK
2a7kD           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGAERSFSAGGDFNEV-
3fduB           -------------LTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEHDFTAGNDMKDFM
1rjmC           ----------DATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGKDGAFCSGGDLHILE
2a7kG           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGAERSFSAGGDEVKQL
3fduE           -------------LTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEHDFTAGNDMKDFM
3fduD           -------------LTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEHDFTAGNDMKDFG
2f6qA           ------------------NRPKKKNAINTEYHEIRALKAAS--KDDSI-ITVLTGNGDYYSSGNDLDIPP
3i47A           --SDLLYEIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANGKHFSAGADLTWMQ
3h02F           ----------DGIAKITINRPQVRNAFRP-LTVKEIQALADARYDDNVGVIILTGGDKAFCAGG------
3fduF           -------------LTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEHDFTAGNDAGQV-
2f6qB           ------------------NRPKKKNAINTEYHEIRALKAAS--KDDSI-ITVLTGNGDYYSSGNDLTNFT
3fduC           -------------LTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEHDFTAGNDMK---
2f6qC           ------------------NRPKKKNAINTEYHEIRALKAAS--KDDSI-ITVLTGNGDYYSSGNDLT--V
2q35A           -----LTELGNGVVQITMKDESSRNGFSPSIVEGLRHCFSVVAQNQQYKVVILTGYGNYFSSGASKEFLI
3g64A           -------EITDGVATVTLARPDKLNALTFEAYADLRDXXXXXXXXXXXXXXXXXGEGRGFCSGGDVDEII
1uiyA           --------------VVFLNDPERRNPLSPEALSLLQALDDLEA-DPGVRAVVLTGRGKAFSAGADLAFL-
3hinA           ----LVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDIP--DQIRAVVIHGIGDHFSAGLDLSELR
3hinB           ----LVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDIP--DQIRAVVIHGIGDHFSAGLDLSELR
1pjhB           -----ISYRIEGPFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIA
1pjhA           -----ISYRIEGPFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIA
2pg8C           ----------------------------------------------------------------------
2pg8A           ----------------------------------------------------------------------
2np9C           ----------------------------------------------------------------------
2np9B           ----------------------------------------------------------------------
2np9A           ----------------------------------------------------------------------
1wdmB           --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
1wdmA           --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
1wdlB           --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
1wdlA           --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
1wdkB           --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
1wdkA           --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
1pjhC           -----ISYRIEGPFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIA
1k39C           -----ISYRIEGPFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIA
1k39B           -----ISYRIEGPFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIA
1k39A           -----ISYRIEGPFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIA
1hnoA           -----ISYRIEGPFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKET-
1szoF           --------------------------------------------DRENKVVILTGTGPSFCNEIDFTSFL
1szoD           --------------------------------------------DRENKVVILTGTGPSFCNEIDFTSFL
1szoB           --------------------------------------------DRENKVVILTGTGPSFCNEIDFTSFL
1szoA           --------------------------------------------DRENKVVILTGTGPSFCNEIDFTSFL
3h0uC           ---ETIKARLDGTVLSATFNAPPMNLIGPEVVRDLVALLEELAHPTAPRVVIFDSADAFFFPHVDMTKVP
3h0uB           ---ETIKARLDGTVLSATFNAPPMNLIGPEVVRDLVALLEELAHPTAPRVVIFDSADAFFFPHVDMTKVP
3h0uA           ---ETIKARLDGTVLSATFNAPPMNLIGPEVVRDLVALLEELAHPTAPRVVIFDSADAFFFPHVDMTKVP
2q34A           --------------VVQITKDESRNGFSPSIVEGLRHCFSVVAQNQQYKVVILTGYGNYFSSGASKEYLI
2q2xA           --------------VVQITKDESRNGFSPSIVEGLRHCFSVVAQNQQYKVVILTGYGNYFSSGASKEYLI
3isaF           ----LAIERRPAAWTFTLSRPEKRNALSAELVEALIDGVDAAHREQ-VPLLVFAGAGRNFSAGFDFTDYE
3isaD           ----LAIERRPAAWTFTLSRPEKRNALSAELVEALIDGVDAAHREQ-VPLLVFAGAGRNFSAGFDFTDYE
3isaC           ----LAIERRPAAWTFTLSRPEKRNALSAELVEALIDGVDAAHREQ-VPLLVFAGAGRNFSAGFDFTDYE
3isaB           ----LAIERRPAAWTFTLSRPEKRNALSAELVEALIDGVDAAHREQ-VPLLVFAGAGRNFSAGFDFTDYE
3isaA           ----LAIERRPAAWTFTLSRPEKRNALSAELVEALIDGVDAAHREQ-VPLLVFAGAGRNFSAGFDFTDYE
2w3pB           -----------------------------------------------VRTVVLTSLDRVFCSGANIFMLL
2w3pA           -----------------------------------------------VRTVVLTSLDRVFCSGANIFMLL
3hp0B           -----------SVCYITFHRPEANNTIN-DTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIY
3hp0A           -----------SVCYITFHRPEANNTIN-DTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIY
3gkbC           --------------------------------------------DSSVRVIVFSSADPEFFLA-HVDMRI
3gkbB           --------------------------------------------DSSVRVIVFSSADPEFFLA-HVDMRI
3gkbA           --------------------------------------------DSSVRVIVFSSADPEFFLA-HVDMRI


                         .         .         *         .         .         .         .:140
query           GNRSQPPSVQADSIEVLNQWIESFHAFPKPIIAAVEGPAAGAGFSLVLACDFVVAASDAKFVMAYVKVGL
3h81B           XXXXXXXXXXXXXXX----W-GKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGV
3h81A           XXXXXXXXXXXXXXX----W-GKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGV
2hw5A           NLSFQ----DCYSSKFLKHW-DHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGT
1mj3A           NRTFQ------DCYSGLSHW-DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
1ey3A           NRTFQ----DCYSGKFLSHW-DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
1dubB           NRTFQ----DCYSGKFLSHW-DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
1dubA           NRTFQ----DCYSGKFLSHW-DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
2dubE           NRTFQ---------DCYSHW-DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
2dubA           NRTFQ---------DCYSHW-DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
3gowA           GDRK--PDYEAH-LRRYNRVVEALSGLEKPLXXXXXXXXXXXXMSLALWGDLRLAAVGASFTTAFVRIGL
2dubD           -NRTFQDCYSG------KHW-DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
2qq3I           ---AKDDPIRLEWLNQFADW-DRLSIVKTPMIAAVNXXXXXXXXXXXXSCDLIVASSAAEFGFPEVNLGV
2qq3C           ---AKDDPIRLEWLNQFADW-DRLSIVKTPMIAAVNXXXXXXXXXXXXSCDLIVASSAAEFGFPEVNLGV
2pbpA           ---AKDDPIRLEWLNQFADW-DRLSIVKTPMIAAVNXXXXXXXXXXXXSCDLIVASSAAEFGFPEVNLGV
3hrxF           ---TEKPDYEAH-LRRYNRVVEALSGLEKPLXXXXXXXXXXXXMSLALWGDLRLAAVGASFTTAFVRIGL
3gowF           ---DRKPDYEAH-LRRYNRVVEALSGLEKPLXXXXXXXXXXXXMSLALWGDLRLAAVGASFTTAFVRIGL
2vx2I           -TEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGL
2vx2H           -TEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGL
2vx2G           -TEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGL
2vx2F           -TEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGL
2vx2E           -TEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGL
2vx2B           -TEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGL
2vx2A           -TEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGL
2iexA           ------PRLNVLDLQRL------IRVIPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGS
2iexB           ------------------------RVIPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGS
3he2C           -------AFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGL
3he2A           ------DAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGL
1ef9A           SGGRDPLSYD----DPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV
1ef8A           -----DPLSYDDPLRQITRMIQKF---PKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV
2uzfA           -GEDQIPRLNVLDLQRLIRII------PKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
2uzfB           ------PRLNVLDLQRLIRII------PKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
1ef8B           ------PLSYDDPLRQITRMIQKF---PKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV
1ef8C           ---------YDDPLRQITRMIQKF---PKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV
1hzdB           KMSSSEVGPFVSKIRAV---INDIANLPVPTIXXXXXXXXXXXXXXXXXCDIRVAASSAKMGLVETKLAI
1hzdA           KMSSSEVGPFVSKIRAV---INDIANLPVPTIXXXXXXXXXXXXXXXXXCDIRVAASSAKMGLVETKLAI
2vreC           SDILQPKGDDVARIDIITRYQETFNVIPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGL
2vreB           SDILQPKGDDVARIDIITRYQETFNVIPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGL
2vreA           SDILQPKGDDVARIDIITRYQETFNVIPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGL
2gtrC           DDRKRESTKMAEAIR---NFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQ
2gtrB           DDRKRESTKMAEAIR---NFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQ
2gtrA           DDRKRESTKMAEAIR---NFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQ
2ej5A           RSRYAP-------------MMKALHHLEKPXXXXXXXXXXXXXXXXXXXCDFRLLSEKASFAPAFIHVGL
2ppyE           --RSADPRFKTQFCLFCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGV
2ppyC           --RSADPRFKTQFCLFCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGV
2ppyB           --RSADPRFKTQFCLFCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGV
2ppyA           --RSADPRFKTQFCLFCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGV
2fbmB           KHRNNRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQ
2fbmA           KHRNNRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQ
2ej5B           RSRYAP-------------MMKALHHLEKPXXXXXXXXXXXXXXXXXXXCDFRLLSEKASFAPAFIHVGL
1rjnB           ------------EVQRLIRFM------PKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
2zqqF           -------SEVGPFVSKIRAVINDIANLPVPTIXXXXXXXXXXXXXXXXXCDIRVAASSAKMGLVETKLAI
1q52B           --------ARAGRLHILE--VQRLIRFPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
1q51B           ---QTVDVARAGRLHILE--VQRLIRFPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
2fw2F           RHRNDRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQ
2fw2E           RHRNDRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQ
2fw2D           RHRNDRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQ
2fw2C           RHRNDRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQ
2fw2B           RHRNDRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQ
2fw2A           RHRNDRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQ
1q51A           ------------EVQRLIRFM------PKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
1q52K           -----------DHILEVQRLIRFM---PKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
1q52A           -----------DHILEVQRLIRFM---PKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
2vssF           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
2j5iI           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
2j5iG           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
2j5iF           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
2j5iE           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
2j5iD           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
2j5iC           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
2j5iB           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
2j5iA           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
2vsuF           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGI
2vsuD           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGI
2vsuC           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGI
2vsuB           REVDAGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGI
2vssE           -----PEILQEKIRREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINYGI
2vsuE           --REVGPEILQEKIREASQWQKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINYGI
3h02D           -----------DQLNVLD-FQRQIRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVG-
2vssC           -----PEILQEKIRREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
2vssA           ---AGPEILQEKIRREASQWQKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGI
3h02E           -----------DHLNVLD-FQRQIRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVG-
2vsuA           ---AGPEILQEKIRREASQWQKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGI
3h02A           --------------NVLD-FQRQIRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVG-
3h02B           DFQRQ------------------IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVG-
1rjnC           VQRL-------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
1rjnA           ----------AGRLHILE--VQRLIRFPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
3h02C           -------------LNVLD-FQRQIRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVG-
2a7kI           QLRSEDIEEWIDRVIDLYQAVLNVN---KPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kA           QLRSEDIEEWIDRVIDLYQAVLNVN---KPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
1rjmB           -------------LEV--QRLIRF--MPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
1rjmA           -------------LEV--QRLIRF--MPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
2a7kC           QSRSEDIEEWIDRVIDLYQAVLNVN---KPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
1nzyC           LDKGVAGVRDHFRIAALHQMIHKIIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGI
1nzyA           LDKGVAGVRDHFRIAALHQMIHKIIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGI
1nzyB           LDKGVAGVRDHFRIAALHQMIHKIIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGI
1jxzC           LDKGVAGVRDHFRIAALQQMIHKIIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGI
1jxzB           LDKGVAGVRDHFRIAALQQMIHKIIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGI
1jxzA           LDKGVAGVRDHFRIAALQQMIHKIIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGI
1dciA           SDILQPPGDDVARIDLISRYQKTFTVIPKPVXXXXXXXXXXXXVDLISACDIRYCTQDAFFQVKEVDVGL
3fduA           GFVQNPNAGPAGQVPPF-VLLKSAARLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGL
2a81A           QSRSEDIEEWIDRVIDLYQAVLNVN---KPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kH           QSRSEDIEEWIDRVIDLYQAVLNVN---KPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kF           QSRSEDIEEWIDRVIDLYQAVLNVN---KPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kE           QSRSEDIEEWIDRVIDLYQAVLNVN---KPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kB           QSRSEDIEEWIDRVIDLYQAVLNVN---KPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kD           ------KQLSEDIEEWIDRVIDLYQAVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
3fduB           PAGQVPPFVLLKSAARLS----------KPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGL
1rjmC           VQRL-------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASRE---YARFKQTDA
2a7kG           -SRSEDIEEWIDRVIDLYQAVLNVN---KPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
3fduE           G--FVQPAGQVPPFVLL----KSAARLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGL
3fduD           PAGQVPPFVLLKSAARLS----------KPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGL
2f6qA           GGVEEKAKNNA---VLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQ
3i47A           SMANFTEEENLEDSLVLGNLMYSISQSPKPTIXXXXXXXXXXXXXXXXXXXXXXXXXXXRFCFSEVKLGL
3h02F           -----------DHLNVLD-FQRQIRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVG-
3fduF           -----PPFVLLKSAARLS----------KPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGL
2f6qB           D--IPPGGVEENNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQ
3fduC           ------PAGQVPPFVLL----KSAARLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGL
2f6qC           EEKAKNNAV------LLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQ
2q35A           RKTRGEVEVLDLSGLILDCEI--------PIIAAMQGHSFXXXXXXXXYADFVVFSQESVYATNFMKYGF
3g64A           G------ATLSDTARLLDQVVRAVRECPFPXXXXXXXXXXXXXXXXXXXXDFRVADPSTRFAFLFTRVGL
1uiyA           ---ERVTELGAEENYRHSLSLRLFHTYPKPTXXXXXXXXXXXXXXXXXXXXXXXD-EEARLGYTEVKIGF
3hinA           ERDATEGLVHS---QTWHRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAEASAYYALPEXXXXX
3hinB           ERDATEGLVHS---QTWHRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAEASAYYALPEXXXXX
1pjhB           KKYPSETSKWVSNFVARNVYVDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLPFANLGL
1pjhA           KKYPSETSKWVSNFVARNVYVDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLPFANLGL
2pg8C           ----------------------------KPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGI
2pg8A           ----------------------------KPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGI
2np9C           ----------------------------KPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGI
2np9B           ----------------------------KPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGI
2np9A           ----------------------------KPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGI
1wdmB           ENFKLPDALIAGNLEA-NKIFSDFEDLNVPTVXXXXXXXXXXXXEMCLAADFRVMADSAKIGLPEVKLGI
1wdmA           ENFKLPDALIAGNLEA-NKIFSDFEDLNVPTVXXXXXXXXXXXXEMCLAADFRVMADSAKIGLPEVKLGI
1wdlB           ENFKLPDALIAGNLEA-NKIFSDFEDLNVPTVXXXXXXXXXXXXEMCLAADFRVMADSAKIGLPEVKLGI
1wdlA           ENFKLPDALIAGNLEA-NKIFSDFEDLNVPTVXXXXXXXXXXXXEMCLAADFRVMADSAKIGLPEVKLGI
1wdkB           ENFKLPDALIAGNLEA-NKIFSDFEDLNVPTVXXXXXXXXXXXXEMCLAADFRVMADSAKIGLPEVKLGI
1wdkA           ENFKLPDALIAGNLEA-NKIFSDFEDLNVPTVXXXXXXXXXXXXEMCLAADFRVMADSAKIGLPEVKLGI
1pjhC           --YPSETSKWVSNFVARNVYVDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLPFANLGL
1k39C           --KAQGDDTNKYPSET-SKWVSNFVAHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLPFANLGL
1k39B           --KAQGDDTNKYPSET-SKWVSNFVAHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLPFANLGL
1k39A           --KAQGDDTNKYPSET-SKWVSNFVAHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLPFANLGL
1hnoA           -------SKWVSNFVARNVYVDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLPFANLGL
1szoF           GTPHDWDEIIFEGQRLLNNLL----SIEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDGHFPSGI
1szoD           GTPHDWDEIIFEGQRLLNNLL----SIEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDGHFPSGI
1szoB           GTPHDWDEIIFEGQRLLNNLL----SIEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDGHFPSGI
1szoA           GTPHDWDEIIFEGQRLLNNLL----SIEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDGHFPSGI
3h0uC           EYTAEAAKAGGPGDASLGMLFRKLSQLPAVTIAKLRGRARGAGSEFLLACDMRFASENAILGQPEVXXXX
3h0uB           EYTAEAAKAGGPGDASLGMLFRKLSQLPAVTIAKLRGRARGAGSEFLLACDMRFASENAILGQPEVXXXX
3h0uA           EYTAEAAKAGGPGDASLGMLFRKLSQLPAVTIAKLRGRARGAGSEFLLACDMRFASENAILGQPEVXXXX
2q34A           RKTRGEVEVLDLSGLILDCEI--------PIIAA-QGHSFXXXXXXXXYADFVVFSQESVYATNF-KYGF
2q2xA           RKTRGEVEVLDLSGLILDCEI--------PIIAA-QGHSFXXXXXXXXYADFVVFSQESVYATNF-KYGF
3isaF           TQSEGDLLLRMVRIEMLLQRVAGS---PSLTLALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGL
3isaD           TQSEGDLLLRMVRIEMLLQRVAGS---PSLTLALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGL
3isaC           TQSEGDLLLRMVRIEMLLQRVAGS---PSLTLALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGL
3isaB           TQSEGDLLLRMVRIEMLLQRVAGS---PSLTLALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGL
3isaA           TQSEGDLLLRMVRIEMLLQRVAGS---PSLTLALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGL
2w3pB           STHAWKVNFCKFTNETRNGLEDSSRHSGLKFLAAVNGACAGGGYELALACDEIYLVDD------------
2w3pA           STHAWKVNFCKFTNETRNGLEDSSRHSGLKFLAAVNGACAGGGYELALACDEIYLVDD------------
3hp0B           --QEKRGRKQASSQEPLYD-LWKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGL
3hp0A           --QEKRGRKQASSQEPLYD-LWKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGL
3gkbC           GEKMDALQELAASVNVFQAVGELIRHQPQVTIVKLAGKARGGGXXXXXXXXXXXXXXXXXGLQIEALMGI
3gkbB           GEKMDALQELAASVNVFQAVGELIRHQPQVTIVKLAGKARGGGXXXXXXXXXXXXXXXXXGLQIEALMGI
3gkbA           GEKMDALQELAASVNVFQAVGELIRHQPQVTIVKLAGKARGGGXXXXXXXXXXXXXXXXXGLQIEALMGI


                         +         .         .         .         .         *         .:210
query           TPDGGGSYEIARMLPRQLASEIMMEGKPVDPARLAHFGIVNRVAAPGQALTEALRIAENLAKESPNAVSG
3h81B           LPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARM
3h81A           LPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARM
2hw5A           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAM
1mj3A           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
1ey3A           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
1dubB           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
1dubA           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
2dubE           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
2dubA           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
3gowA           VPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYAL
2dubD           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
2qq3I           MPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPELLMEETMRLAGRLAEQPPLALRL
2qq3C           MPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPELLMEETMRLAGRLAEQPPLALRL
2pbpA           MPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPELLMEETMRLAGRLAEQPPLALRL
3hrxF           VPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYAL
3gowF           VPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYAL
2vx2I           FCSTPG-VALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSL
2vx2H           FCSTPG-VALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSL
2vx2G           FCSTPG-VALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSL
2vx2F           FCSTPG-VALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSL
2vx2E           FCSTPG-VALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSL
2vx2B           FCSTPG-VALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSL
2vx2A           FCSTPG-VALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSL
2iexA           FDGGYGAGYLARIVGHKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRF
2iexB           FDGGYGAGYLARIVGHKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRF
3he2C           ALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIG----TLADAQAWAAEIARLAPLAIQH
3he2A           ALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIG----TLADAQAWAAEIARLAPLAIQH
1ef9A           PYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
1ef8A           PYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
2uzfA           FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRF
2uzfB           FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRF
1ef8B           PYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
1ef8C           PYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
1hzdB           IPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQAYRKALDLAREFLPQGPVAMRV
1hzdA           IPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQAYRKALDLAREFLPQGPVAMRV
2vreC           AADVGTLQRLPKVIGNQLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDALALAAEISSKSPVAVQS
2vreB           AADVGTLQRLPKVIGNQLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDALALAAEISSKSPVAVQS
2vreA           AADVGTLQRLPKVIGNQLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDALALAAEISSKSPVAVQS
2gtrC           SPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEE
2gtrB           SPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEE
2gtrA           SPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEE
2ej5A           VPDAGHLYYLPRLVGRAKALELAVLGEKVXXXXXXXXXXXXKVIPLSDWEEEVKQFAERLSAMPTKAIGL
2ppyE           LAGTGGTQRLARLIGYSRALD-NITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSATYAVSN
2ppyC           LAGTGGTQRLARLIGYSRALD-NITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSATYAVSN
2ppyB           LAGTGGTQRLARLIGYSRALD-NITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSATYAVSN
2ppyA           LAGTGGTQRLARLIGYSRALD-NITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSATYAVSN
2fbmB           SPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVLEE
2fbmA           SPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVLEE
2ej5B           VPDAGHLYYLPRLVGRAKALELAVLGEKVXXXXXXXXXXXXKVIPLSDWEEEVKQFAERLSAMPTKAIGL
1rjnB           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
2zqqF           IPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQAYRKALDLAREFLPQGPVAMRV
1q52B           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
1q51B           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
2fw2F           SPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEE
2fw2E           SPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEE
2fw2D           SPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEE
2fw2C           SPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEE
2fw2B           SPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEE
2fw2A           SPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEE
1q51A           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
1q52K           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
1q52A           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
2vssF           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2j5iI           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2j5iG           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2j5iF           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2j5iE           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2j5iD           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2j5iC           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2j5iB           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2j5iA           PPGNLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2vsuF           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2vsuD           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2vsuC           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2vsuB           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2vssE           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2vsuE           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
3h02D           SFDGGWGASYARIVGQKKAREIWFLCRQYD-AQQALDGLVNTVVPLADLEKETVRWCREL-QNSP-ALRC
2vssC           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
2vssA           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
3h02E           SFDGGWGASYARIVGQKKAREIWFLCRQYD-AQQALDGLVNTVVPLADLEKETVRWCREL-QNSP-ALRC
2vsuA           PPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA
3h02A           SFDGGWGASYARIVGQKKAREIWFLCRQYD-AQQALDGLVNTVVPLADLEKETVRWCREL-QNSP-ALRC
3h02B           SFDGGWGASYARIVGQKKAREIWFLCRQYD-AQQALDGLVNTVVPLADLEKETVRWCREL-QNSP-ALRC
1rjnC           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
1rjnA           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
3h02C           SFDGGWGASYARIVGQKKAREIWFLCRQYD-AQQALDGLVNTVVPLADLEKETVRWCREL-QNSP-ALRC
2a7kI           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kA           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
1rjmB           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
1rjmA           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
2a7kC           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
1nzyC           GNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELA-AAPTHLQV
1nzyA           GNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELA-AAPTHLQV
1nzyB           GNDTATSYSLARIVGMRRAMELMLTDRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELA-AAPTHLQV
1jxzC           GNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELA-AAPTHLQV
1jxzB           GNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELA-AAPTHLQV
1jxzA           GNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELA-AAPTHLQV
1dciA           AADVGTLQRLPKVINRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVLNAAFALAADISSKSPVAVQG
3fduA           SPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEI---------------------------
2a81A           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kH           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kF           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kE           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kB           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kD           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
3fduB           SPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEI---------------------------
1rjmC           DFDGGGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
2a7kG           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
3fduE           SPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEI---------------------------
3fduD           SPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEI---------------------------
2f6qA           SPEGCSSYTFPKISPAK-ATELIF-GKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRI
3i47A           IPAVISPY-VVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLEFTLKYASQISNNAPEAVKN
3h02F           SFDGGWGASYARIVGQKKAREIWFLCRQYD-AQQALDGLVNTVVPLADLEKETVRWCREL-QNSP-ALRC
3fduF           SPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEI---------------------------
2f6qB           SPEGCSSYTFPKISPAK-ATELIF-GKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRI
3fduC           SPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEI---------------------------
2f6qC           SPEGCSSYTFPKISPAK-ATELIF-GKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRI
2q35A           TPVGATSLILREKLGSELAQEMIYTGENYRGKELAERGIPFPVVSRQDVLNYAQQLGQKIAKSPRLSLVA
3g64A           SGGDGAAYLLPRVVGLGHATRLLL-GDTVRAPEAERIGLISELTEEGRADEAARTLARRLADGPALAHAQ
1uiyA           VA-ALVSVILVRAVGEKAAKDLLLTGRLVEAREAKALGLVNRIAPPGXXXXXXXXXXXXVAKNAPTSLRL
3hinA           XXXXXXXXXLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIENGSAYDKALELGNRVAQNAPLTNFA
3hinB           XXXXXXXXXLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIENGSAYDKALELGNRVAQNAPLTNFA
1pjhB           ITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISK----------------------------
1pjhA           ITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISK----------------------------
2pg8C           IP-GAANLRLGRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDESLTRANRRMLNLADESPD----
2pg8A           IP-GAANLRLGRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDESLTRANRRMLNLADESPD----
2np9C           IP-GAANLRLGRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDESLTRANRRMLNLADESPD----
2np9B           IP-GAANLRLGRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDESLTRANRRMLNLADESPD----
2np9A           IP-GAANLRLGRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDESLTRANRRMLNLADESPD----
1wdmB           YPGFGGTVRLPRLIGVDNAVEWIASGK-------------------------------------------
1wdmA           YPGFGGTVRLPRLIGVDNAVEWIASGK-------------------------------------------
1wdlB           YPGFGGTVRLPRLIGVDNAVEWIASGK-------------------------------------------
1wdlA           YPGFGGTVRLPRLIGVDNAVEWIASGK-------------------------------------------
1wdkB           YPGFGGTVRLPRLIGVDNAVEWIASGK-------------------------------------------
1wdkA           YPGFGGTVRLPRLIGVDNAVEWIASGK-------------------------------------------
1pjhC           ITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISK----------------------------
1k39C           ITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISK----------------------------
1k39B           ITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISK----------------------------
1k39A           ITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISK----------------------------
1hnoA           ITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISK----------------------------
1szoF           VPGDGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEK-------
1szoD           VPGDGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEK-------
1szoB           VPGDGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEK-------
1szoA           VPGDGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEK-------
3h0uC           XXXXXXXQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNR-AVPDAELDEFVAIAARMSGFPRDALIA
3h0uB           XXXXXXXQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNR-AVPDAELDEFVAIAARMSGFPRDALIA
3h0uA           XXXXXXXQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNR-AVPDAELDEFVAIAARMSGFPRDALIA
2q34A           TPVGATSLILREKLGSELAQEI-YTGENYRGKELAERGIPFPVVSRQDVLNYAQQLGQKIAKSPRLSLVA
2q2xA           TPVGATSLILREKLGSELAQEI-YTGENYRGKELAERGIPFPVVSRQDVLNYAQQLGQKIAKSPRLSLVA
3isaF           VL---GTRRFRDIVGADQALSILGSARAFDADEARRIGFVRDCAAQAQ----------------------
3isaD           VL---GTRRFRDIVGADQALSILGSARAFDADEARRIGFVRDCAAQAQ----------------------
3isaC           VL---GTRRFRDIVGADQALSILGSARAFDADEARRIGFVRDCAAQAQ----------------------
3isaB           VL---GTRRFRDIVGADQALSILGSARAFDADEARRIGFVRDCAAQAQ----------------------
3isaA           VL---GTRRFRDIVGADQALSILGSARAFDADEARRIGFVRDCAAQAQ----------------------
2w3pB           ----------------------------------------------------------------------
2w3pA           ----------------------------------------------------------------------
3hp0B           YPACVLPF-LIRRIGRQKAHYTLT--KPISVQEASEWGLID-----------------------------
3hp0A           YPACVLPF-LIRRIGRQKAHYTLT--KPISVQEASEWGLID-----------------------------
3gkbC           IPGGGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINR-ALPADELDEYVRVARNIAALPDGVIEA
3gkbB           IPGGGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINR-ALPADELDEYVRVARNIAALPDGVIEA
3gkbA           IPGGGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINR-ALPADELDEYVRVARNIAALPDGVIEA


                         .         .         .         +         .         .         .:280
query           IKSLINHAGTATLTEHLAAERDSFVAALHHKDGGEGISAFLEKRKPNYR
3h81B           AKEAVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQF-
3h81A           AKEAVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQF-
2hw5A           AKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFK
1mj3A           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
1ey3A           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
1dubB           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
1dubA           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
2dubE           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
2dubA           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
3gowA           TKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQ
2dubD           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
2qq3I           IKEAVQKAVDYPLYEGMQFERKNFYLLFASEDQKEGMAAFLEKRKPRFQ
2qq3C           IKEAVQKAVDYPLYEGMQFERKNFYLLFASEDQKEGMAAFLEKRKPRFQ
2pbpA           IKEAVQKAVDYPLYEGMQFERKNFYLLFASEDQKEGMAAFLEKRKPRFQ
3hrxF           TKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQ
3gowF           TKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQ
2vx2I           GKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP---
2vx2H           GKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP---
2vx2G           GKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP---
2vx2F           GKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP---
2vx2E           GKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP---
2vx2B           GKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP---
2vx2A           GKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP---
2iexA           LKAAFN-ADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDF-
2iexB           LKAAFN-ADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDF-
3he2C           AKRVLNDDG--AIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKFQ
3he2A           AKRVLNDDG--AIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKFQ
1ef9A           IKEELRVLGEAHTMNSDEFERIQGMAVYDSEDYQEGMNAFLEKRKPNF-
1ef8A           IKEELRVLGEAHTMNSDEFERIQGMAVYDSEDYQEGMNAFLEKRKPNF-
2uzfA           LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDF-
2uzfB           LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDF-
1ef8B           IKEELRVLGEAHTMNSDEFERIQGMAVYDSEDYQEGMNAFLEKRKPNF-
1ef8C           IKEELRVLGEAHTMNSDEFERIQGMAVYDSEDYQEGMNAFLEKRKPNF-
1hzdB           AKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYK
1hzdA           AKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYK
2vreC           TKVNLLYS-----RDHSVAESLNYVAS----------------------
2vreB           TKVNLLYS-----RDHSVAESLNYVAS----------------------
2vreA           TKVNLLYS-----RDHSVAESLNYVAS----------------------
2gtrC           SKALV--------------------------------------------
2gtrB           SKALV--------------------------------------------
2gtrA           SKALV--------------------------------------------
2ej5A           IKRLLRESEETTFDRYLEREAECQRIAGLTSDHREGVKAFFEKRKPLFQ
2ppyE           IKLAIN--GKEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNWK
2ppyC           IKLAIN--GKEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNWK
2ppyB           IKLAIN--GKEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNWK
2ppyA           IKLAIN--GKEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNWK
2fbmB           CKALV--------------------------------------------
2fbmA           CKALV--------------------------------------------
2ej5B           IKRLLRESEETTFDRYLEREAECQRIAGLTSDHREGVKAFFEKRKPLFQ
1rjnB           LKFAFNLLDDGLVGQQLFAGEATRLAYM-TDEAVEGRDAFLQKRPPDW-
2zqqF           AKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYK
1q52B           LKFAFNLLDDGLVGQQLFAGEATRLAYM-TDEAVEGRDAFLQKRPPDW-
1q51B           LKFAFNLLDDGLVGQQLFAGEATRLAYM-TDEAVEGRDAFLQKRPPDW-
2fw2F           CKALV--------------------------------------------
2fw2E           CKALV--------------------------------------------
2fw2D           CKALV--------------------------------------------
2fw2C           CKALV--------------------------------------------
2fw2B           CKALV--------------------------------------------
2fw2A           CKALV--------------------------------------------
1q51A           LKFAFNLLDDGLVGQQLFAGEATRLAYM-TDEAVEGRDAFLQKRPPDW-
1q52K           LKFAFNLLDDGLVGQQLFAGEATRLAYM-TDEAVEGRDAFLQKRPPDW-
1q52A           LKFAFNLLDDGLVGQQLFAGEATRLAYM-TDEAVEGRDAFLQKRPPDW-
2vssF           AK-----------------------------------------------
2j5iI           AK-----------------------------------------------
2j5iG           AK-----------------------------------------------
2j5iF           AK-----------------------------------------------
2j5iE           AK-----------------------------------------------
2j5iD           AK-----------------------------------------------
2j5iC           AK-----------------------------------------------
2j5iB           AK-----------------------------------------------
2j5iA           AK-----------------------------------------------
2vsuF           AK-----------------------------------------------
2vsuD           AK-----------------------------------------------
2vsuC           AK-----------------------------------------------
2vsuB           AK-----------------------------------------------
2vssE           AK-----------------------------------------------
2vsuE           AK-----------------------------------------------
3h02D           LKAALNADGQAGLQE-LAGNATLF----YTEEGQEGRNAFNQKRQPDF-
2vssC           AK-----------------------------------------------
2vssA           AK-----------------------------------------------
3h02E           LKAALNADGQAGLQE-LAGNATLF----YTEEGQEGRNAFNQKRQPDF-
2vsuA           AK-----------------------------------------------
3h02A           LKAALNADGQAGLQE-LAGNATLF----YTEEGQEGRNAFNQKRQPDF-
3h02B           LKAALNADGQAGLQE-LAGNATLF----YTEEGQEGRNAFNQKRQPDF-
1rjnC           LKFAFN-------------------------------------------
1rjnA           LKFAFN-------------------------------------------
3h02C           LKAALNADGQAGLQE-LAGNATLF----YTEEGQEGRNAFNQKRQPDF-
2a7kI           TKRAVN-------------------------------------------
2a7kA           TKRAVN-------------------------------------------
1rjmB           LKFAFN-------------------------------------------
1rjmA           LKFAFN-------------------------------------------
2a7kC           TKRAVNKPFIHLLEQTRDASKAVHKAAFQARD-----------------
1nzyC           MAKERFHAGWMQPVEECTEEIQNVIASVTHPHFMPCLTRFLD-------
1nzyA           MAKERFHAGWMQPVEECTEEIQNVIASVTHPHFMPCLTRFLD-------
1nzyB           MAKERFHAGWMQPVEECTEEIQNVIASVTHPHFMPCLTRFLD-------
1jxzC           MAKERFHAGWMQPVEECTEEIQNVIASVTHPHFMPCLTRFLD-------
1jxzB           MAKERFHAGWMQPVEECTEEIQNVIASVTHPHFMPCLTRFLD-------
1jxzA           MAKERFHAGWMQPVEECTEEIQNVIASVTHPHFMPCLTRFLD-------
1dciA           SKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKK-----
3fduA           -------------------------------------------------
2a81A           TKRAVN-------------------------------------------
2a7kH           TKRAVN-------------------------------------------
2a7kF           TKRAVN-------------------------------------------
2a7kE           TKRAVN-------------------------------------------
2a7kB           TKRAVN-------------------------------------------
2a7kD           TKRAVN-------------------------------------------
3fduB           -------------------------------------------------
1rjmC           LKFAFN-------------------------------------------
2a7kG           TKRAVN-------------------------------------------
3fduE           -------------------------------------------------
3fduD           -------------------------------------------------
2f6qA           SKEVI--------------------------------------------
3i47A           SKQLAQYVANKKIDEELVRYTASLIAHKRVSDEGEGLKAFLNKEIPNW-
3h02F           LKAALN-------------------------------------------
3fduF           -------------------------------------------------
2f6qB           SKEVI--------------------------------------------
3fduC           -------------------------------------------------
2f6qC           SKEVI--------------------------------------------
2q35A           LKQHLSADIKAKFPEAIKKE-----------------------------
3g64A           TKALL----TAELDPLAAAELDSTQALLTGEDYAEFHAAFTEKRPPKWQ
1uiyA           TKELLALPGGLEDGFRLAALANAWVR--ETGDLAEGIRAFFEKRPPRF-
3hinA           VLQALPMIAEANPQTGLLMESLMATVAQSDQEAKTRIRAFLDHK-----
3hinB           VLQALPMIAEANPQTGLLMESLMATVAQSDQEAKTRIRAFLD-------
1pjhB           -------------------------------------------------
1pjhA           -------------------------------------------------
2pg8C           -------------------------------------------------
2pg8A           -------------------------------------------------
2np9C           -------------------------------------------------
2np9B           -------------------------------------------------
2np9A           -------------------------------------------------
1wdmB           -------------------------------------------------
1wdmA           -------------------------------------------------
1wdlB           -------------------------------------------------
1wdlA           -------------------------------------------------
1wdkB           -------------------------------------------------
1wdkA           -------------------------------------------------
1pjhC           -------------------------------------------------
1k39C           -------------------------------------------------
1k39B           -------------------------------------------------
1k39A           -------------------------------------------------
1hnoA           -------------------------------------------------
1szoF           -------------------------------------------------
1szoD           -------------------------------------------------
1szoB           -------------------------------------------------
1szoA           -------------------------------------------------
3h0uC           AKSAIN-------------------------------------------
3h0uB           AKSAIN-------------------------------------------
3h0uA           AKSAIN-------------------------------------------
2q34A           LKQHLSADIKAKFPEAIKKE-----------------------------
2q2xA           LKQHLSADIKAKFPEAIKKE-----------------------------
3isaF           -------------------------------------------------
3isaD           -------------------------------------------------
3isaC           -------------------------------------------------
3isaB           -------------------------------------------------
3isaA           -------------------------------------------------
2w3pB           -------------------------------------------------
2w3pA           -------------------------------------------------
3hp0B           -------------------------------------------------
3hp0A           -------------------------------------------------
3gkbC           AKRSL---PADDLKEGLLGENDAWAA-----------------------
3gkbB           AKRSL---PADDLKEGLLGENDAWAA-----------------------
3gkbA           AKRSL---PADDLKEGLLGENDAWAA-----------------------