[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF07913.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d2aA.bssp"
#ERROR : Can't open dsspfile "1s98A.bssp"
#ERROR : Can't open dsspfile "1r94A.bssp"
#ERROR : Can't open dsspfile "2d2aB.bssp"
#ERROR : Can't open dsspfile "2apnA.bssp"
#ERROR : Can't open dsspfile "1nwbA.bssp"
#ERROR : Can't open dsspfile "1x0gD.bssp"
#ERROR : Can't open dsspfile "1x0gC.bssp"
#ERROR : Can't open dsspfile "1x0gB.bssp"
#ERROR : Can't open dsspfile "1x0gA.bssp"

## Summary of PDB Search
:113
    4e-21  41%  2d2aA  [x.x.x] SUFA PROTEIN
    1e-20  46%  1s98A  [b.124.1] PROTEIN YFHF
    3e-20  46%  1r94A  [b.124.1] PROTEIN YFHF
    5e-13  51%  2d2aB  [x.x.x] SUFA PROTEIN
    5e-13  35%  2apnA  [x.x.x] PROTEIN HI1723
    1e-12  44%  1nwbA  [b.124.1] HYPOTHETICAL PROTEIN AQ_1857
    8e-08  30%  1x0gD  [x.x.x] ISCA
    8e-08  30%  1x0gC  [x.x.x] ISCA
    8e-08  30%  1x0gB  [x.x.x] ISCA
    8e-08  30%  1x0gA  [x.x.x] ISCA
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFDSKAKMISMTEKAAKHVARYLEXXXXXXXXXXXXXXXXCSGLAYKLEYVDEVLPEDQVFETHGIKVIV
2d2aA           --------LTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKLFV
1s98A           --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
1r94A           --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
2d2aB           ------------------------------------------GFGYVLDSVSEPDKDDLLFEHDGAKLFV
2apnA           MIDDMAVPLTFTDAAANKVKSLIEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVI
1nwbA           ----------------------------------------CSGFQYAMGFDDTVEEGDHVFEYDGVKVVI
1x0gD           ----------------------------------------CGDWRYDLALVAEPKPTDLLTQSQGWTXXX
1x0gC           ----------------------------------------CGDWRYDLALVAEPKPTDLLTQSQGWTXXX
1x0gB           ----------------------------------------CGDWRYDLALVAEPKPTDLLTQSQGWTXXX
1x0gA           ----------------------------------------CGDWRYDLALVAEPKPTDLLTQSQGWTXXX


                         .         .         *         .         .         .         .:140
query           DPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV
2d2aA           PLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV
1s98A           XXXSMQFLDGTQLDFVKEGLNEGFKFTNPNVKDE---------
1r94A           XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKD----------
2d2aB           PLQAMPFIDGTEVDFVREGLNQIFKFHNP--------------
2apnA           DPMSLQYLIGGTVDYT-EGL-EGSRFNNPNATSTCGCGSSFSI
1nwbA           DPFSMPYVNGAELDYVVDFMGGGFTIRNP--------------
1x0gD           XXXXXXXXRGLRVDYIEDLMGGAFRFHNPNASQTCGCGMAFRV
1x0gC           XXXXXXXXRGLRVDYIEDLMGGAFRFHNPNASQTCGCGMAFRV
1x0gB           XXXXXXXXRGLRVDYIEDLMGGAFRFHNPNASQTCGCGMAFRV
1x0gA           XXXXXXXXRGLRVDYIEDLMGGAFRFHNPNASQTCGCGMAFRV