[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF07921.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1z6zE.bssp"
#ERROR : Can't open dsspfile "1z6zD.bssp"
#ERROR : Can't open dsspfile "1z6zB.bssp"
#ERROR : Can't open dsspfile "1z6zA.bssp"
#ERROR : Can't open dsspfile "1oaaA.bssp"
#ERROR : Can't open dsspfile "2japC.bssp"
#ERROR : Can't open dsspfile "2japA.bssp"
#ERROR : Can't open dsspfile "1rwbA.bssp"
#ERROR : Can't open dsspfile "1g6kA.bssp"
#ERROR : Can't open dsspfile "1geeA.bssp"
#ERROR : Can't open dsspfile "1gcoA.bssp"
#ERROR : Can't open dsspfile "3ftpC.bssp"
#ERROR : Can't open dsspfile "2ph3A.bssp"
#ERROR : Can't open dsspfile "3ennA.bssp"
#ERROR : Can't open dsspfile "3ftpA.bssp"
#ERROR : Can't open dsspfile "3emkD.bssp"
#ERROR : Can't open dsspfile "3emkA.bssp"
#ERROR : Can't open dsspfile "3g1tA.bssp"
#ERROR : Can't open dsspfile "3ftpD.bssp"
#ERROR : Can't open dsspfile "3gvcD.bssp"
#ERROR : Can't open dsspfile "3gvcA.bssp"
#ERROR : Can't open dsspfile "1q7bA.bssp"
#ERROR : Can't open dsspfile "3ennB.bssp"
#ERROR : Can't open dsspfile "1q7bB.bssp"
#ERROR : Can't open dsspfile "3gvcC.bssp"
#ERROR : Can't open dsspfile "3gvcB.bssp"
#ERROR : Can't open dsspfile "1i01E.bssp"
#ERROR : Can't open dsspfile "3grpA.bssp"
#ERROR : Can't open dsspfile "3ennD.bssp"
#ERROR : Can't open dsspfile "3ennC.bssp"
#ERROR : Can't open dsspfile "3emkB.bssp"
#ERROR : Can't open dsspfile "2zatA.bssp"
#ERROR : Can't open dsspfile "3emkC.bssp"
#ERROR : Can't open dsspfile "3grpB.bssp"
#ERROR : Can't open dsspfile "3f1lB.bssp"
#ERROR : Can't open dsspfile "3f1lA.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "1i01D.bssp"
#ERROR : Can't open dsspfile "3gy0A.bssp"
#ERROR : Can't open dsspfile "3ezlA.bssp"
#ERROR : Can't open dsspfile "1pr9A.bssp"
#ERROR : Can't open dsspfile "3gz4B.bssp"
#ERROR : Can't open dsspfile "3gz4A.bssp"
#ERROR : Can't open dsspfile "1i01B.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"

## Summary of PDB Search
:256
    5e-11  34%  1z6zE  [x.x.x] SEPIAPTERIN REDUCTASE
    5e-11  34%  1z6zD  [x.x.x] SEPIAPTERIN REDUCTASE
    5e-11  34%  1z6zB  [x.x.x] SEPIAPTERIN REDUCTASE
    5e-11  34%  1z6zA  [x.x.x] SEPIAPTERIN REDUCTASE
    4e-09  34%  1oaaA  [x.x.x] SEPIAPTERIN REDUCTASE
    1e-08  32%  2japC  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    1e-08  32%  2japA  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    7e-07  31%  1rwbA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    7e-07  31%  1g6kA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    1e-06  31%  1geeA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    1e-06  31%  1gcoA  [c.2.1] GLUCOSE DEHYDROGENASE
    4e-06  32%  3ftpC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    6e-06  32%  2ph3A  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    6e-06  29%  3ennA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    8e-06  31%  3ftpA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-05  29%  3emkD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-05  29%  3emkA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-05  27%  3g1tA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-05  33%  3ftpD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-05  34%  3gvcD  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    5e-05  34%  3gvcA  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    6e-05  24%  1q7bA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    6e-05  28%  3ennB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    8e-05  25%  1q7bB  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    8e-05  32%  3gvcC  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    8e-05  32%  3gvcB  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    1e-04  26%  1i01E  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-04  30%  3grpA  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    1e-04  29%  3ennD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-04  29%  3ennC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-04  30%  3emkB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-04  25%  2zatA  [x.x.x] DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 4
    3e-04  30%  3emkC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    4e-04  31%  3grpB  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    4e-04  25%  3f1lB  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    4e-04  25%  3f1lA  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    4e-04  29%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    5e-04  27%  1i01D  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    5e-04  25%  3gy0A  [x.x.x] DEHYDROGENASE
    5e-04  29%  3ezlA  [x.x.x] ACETOACETYL-COA REDUCTASE
    7e-04  34%  1pr9A  [c.2.1] L-XYLULOSE REDUCTASE
    7e-04  25%  3gz4B  [x.x.x] HYPOTHETICAL OXIDOREDUCTASE YCIK
    7e-04  25%  3gz4A  [x.x.x] HYPOTHETICAL OXIDOREDUCTASE YCIK
    0.001  26%  1i01B  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    0.001  23%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
:256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRVIGVARSRNPELEAEATASGVRVAWHLQDLSQPGP
1z6zE           ----------------------------------------------------------------------
1z6zD           ----------------------------------------------------------------------
1z6zB           ----------------------------------------------------------------------
1z6zA           ----------------------------------------------------------------------
1oaaA           ----------------------------------------------------------------------
2japC           -------------------------------------------------ELTAAGAKV--HVLELDV-AD
2japA           -------------------------------------------------ELTAAGAKV--HVLELDV-AD
1rwbA           ----------------------------------------------------------------------
1g6kA           ----------------------------------------------------------------------
1geeA           ----------------------------------------------------------------------
1gcoA           ----------------------------------------------------------------------
3ftpC           ----------------------------------------------------------------------
2ph3A           ----------------------------------------------------------------------
3ennA           ----------------------------------------------------------------------
3ftpA           ----------------------------------------------------------------------
3emkD           ----------------------------------------------------------------------
3emkA           ----------------------------------------------------------------------
3g1tA           --------------------------------------------------------RVAQHIADEQHVQP
3ftpD           ----------------------------------------------------------------------
3gvcD           ----------------------------------------------------------------------
3gvcA           ----------------------------------------------------------------------
1q7bA           ----------------------------------KVIGTATSENGA-QAISDYLGANGKGLMLNVTDPAS
3ennB           ----------------------------------------------------------------------
1q7bB           ----------------------------------KVIGTATSENGA-QAISDYLGANGKGLMLNVTDPAS
3gvcC           ----------------------------------------------------------------------
3gvcB           ----------------------------------------------------------------------
1i01E           ----------------------------------KVIGTATSENGA-QAISDYLGANGKGLMLNVTDPAS
3grpA           -----------------------------------IVGLHGTREDKLKEIAADLGKDVFVFSANLSDR-K
3ennD           ----------------------------------------------------------------------
3ennC           ----------------------------------------------------------------------
3emkB           ----------------------------------------------------------------------
2zatA           ----------------------------------------------------------------------
3emkC           ----------------------------------------------------------------------
3grpB           -----------------------------------IVGLHGTREDKLKEIAADLGKDVFVFSANLSDR-K
3f1lB           ----------------------------------------------------------------------
3f1lA           ----------------------------------------------------------------------
2cfcA           ---------------------------------------------DLSAETLEETARTHWHLRVRADVAD
1i01D           ----------------------------------KVIGTATSENGA-QAISDYLGANGKGLMLNVTDPAS
3gy0A           ----------------------------------------------------------------------
3ezlA           ----------------------------------------------------------------------
1pr9A           ----------------------------------------------------------------------
3gz4B           ----------------------------------------------------------------------
3gz4A           ----------------------------------------------------------------------
1i01B           ----------------------------------KVIGTATSENGA-QAISDYLGANGKGLMLNVTDPAS
3cxrA           ----------------------------------------------------AAGINAHGYVCDVTDED-


                         .         .         *         .         .         .         .:140
query           SAGWLASVLDAVEEAPASITLILNAGVVEPIGPITQLHDSTLVPHLQTNLVTPMTMTGAFIEHTVRFDCP
1z6zE           ------------------LLLINNAGSLGDVSKFVDLSDSTQVNNYWANLTSMLCLTSSVLKAFP--DSP
1z6zD           ------------------LLLINNAGSLGDVSKFVDLSDSTQVNNYWANLTSMLCLTSSVLKAFP--DSP
1z6zB           ------------------LLLINNAGSLGDVSKFVDLSDSTQVNNYWANLTSMLCLTSSVLKAFP--DSP
1z6zA           ------------------LLLINNAGSLGDVSKFVDLSDSTQVNNYWANLTSMLCLTSSVLKAFP--DSP
1oaaA           ----------------------------------------------------------------------
2japC           RQGVDAAVASTVEALGGLDILVNNAGIML-LGPVEDADTTDWTRMIDTNLLGLMYMTRAALPHLLR--SK
2japA           RQGVDAAVASTVEALGGLDILVNNAGIML-LGPVEDADTTDWTRMIDTNLLGLMYMTRAALPHLLR--SK
1rwbA           -------VQSAIKEFGKLDVMINNAGLENPVSS----HEMSLS---DWNKVIDTNLTGAFIKYFVENDIK
1g6kA           -------VQSAIKEFGKLDVMINNAGLANPVSS----HEMSLS---DWNKVIDTNLTGAFIKYFVENDIK
1geeA           -------VQSAIKEFGKLDVMINNAGLENPVSS----HEMSLS---DWNKVIDTNLTGAFIKYFVENDIK
1gcoA           -------VQSAIKEFGKLDVMINNAGLENPVSS----HEMSLS---DWNKVIDTNLTGAFIKYFVENDIK
3ftpC           -----ALVESTLKEFGALNVLVNNAGITQDQLAM-RMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGG
2ph3A           -------------------TLVNNAGITRDT-LLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFG
3ennA           ----------AEEEMGGVDILVNNAGITRD-GLFVRMSDEDWDAVLTVNLTSVFNLTRE-LTHPMMXXXX
3ftpA           -----ALVESTLKEFGALNVLVNNAGITQDQLAM-RMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGG
3emkD           ----------AEEEMGGVDILVNNAGITRD-GLFVRMSDEDWDAVLTVNLTSVFNLTRE-LTHPMMXXXX
3emkA           ----------AEEEMGGVDILVNNAGITRD-GLFVRMSDEDWDAVLTVNLTSVFNLTRE-LTHPMMXXXX
3g1tA           QWFTLDLLTCTAEECPRLDGVLHNAGLLGEIGPMSEQDPQIWQDVMQVNVNATFMLTQALLPLLLKSDAG
3ftpD           -----ALVESTLKEFGALNVLVNNAGITQDQLAM-RMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGG
3gvcD           --------------------LVANAGVVH----LASLIDTTVEDF---DRVIAINLRGAWL--CTKHAAP
3gvcA           --------------------LVANAGVVH----LASLIDTTVEDF---DRVIAINLRGAWL--CTKHAAP
1q7bA           ----IESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHG
3ennB           ----------AEEEMGGVDILVNNAGITRD-GLFVRMSDEDWDAVLTVNLTSVFNLTRE-LTHPMMXXXX
1q7bB           ----IESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHG
3gvcC           --------------------LVANAGVVH----LASLIDTTVEDF---DRVIAINLRGAWL--CTKHAAP
3gvcB           --------------------LVANAGVVH----LASLIDTTVEDF---DRVIAINLRGAWL--CTKHAAP
1i01E           ----IESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHG
3grpA           SIKQLAEV--AEREMEGIDILVNNAGIT------VRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYG
3ennD           ----------AEEEMGGVDILVNNAGITRD-GLFVRMSDEDWDAVLTVNLTSVFNLTRE-LTHPMMXXXX
3ennC           ----------AEEEMGGVDILVNNAGITRD-GLFVRMSDEDWDAVLTVNLTSVFNLTRE-LTHPMMXXXX
3emkB           ----------AEEEMGGVDILVNNAGITRD-GLFVRMSDEDWDAVLTVNLTSVFNLTRE-LTHPMMXXXX
2zatA           --------------------LVSNAAVNPFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEK-RXX
3emkC           ----------AEEEMGGVDILVNNAGITRD-GLFVRMSDEDWDAVLTVNLTSVFNLTRE-LTHPMMXXXX
3grpB           SIKQLAEV--AEREMEGIDILVNNAGV--------RMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYG
3f1lB           -----------------------NAGLLGDVCPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAG
3f1lA           -----------------------NAGLLGDVCPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAG
2cfcA           EGDVNAAIAATMEQFGAIDVLVNNAGITGN-SEAGVLHTT---PVEQFDKVMAVNVRGIFLG--CRAVLP
1i01D           ----IESVLEKIRAEFGEVDILVNNDNL-----LMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHG
3gy0A           -----------------------NAGLLGDVCPMSEQNPQVWQDVMQINVNATFMLTQALLPLLLKSDAG
3ezlA           ---------------------------------------------IDTNLTSLFNVTKQVIDGMVERGWG
1pr9A           ---------------------------------------------------------------------P
3gz4B           -----------------------NAGLLGDVCPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAG
3gz4A           -----------------------NAGLLGDVCPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAG
1i01B           ----IESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHG
3cxrA           --GIQAMVAQIESEVGIIDILVNNAGIIRRV-PMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHG


                         +         .         .         .         .         *         .:210
query           RKVLAISSGAARNPVPGWSAYCAGKAGLDMFIRSVNTEYASVPEPRTLRAVALAPGVVDTGMQETIRGAD
1z6zE           RTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALE-----EP-NVRVLNYAPGPLDTDMQQLARSVD
1z6zD           RTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALE-----EP-NVRVLNYAPGPLDTDMQQLARSVD
1z6zB           RTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALE-----EP-NVRVLNYAPGPLDTDMQQLARSVD
1z6zA           RTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALE-----EP-NVRVLNYAPGPLDTDMQQLARSVD
1oaaA           KTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSV------RVLSYAPGPLDNDMQQLARSKD
2japC           GTVVQMSSIAGRVNVRNAAVYQATKFGVNAFSETLRQEVTE----RGVRVVVIEPGTTDTELR-------
2japA           GTVVQMSSIAGRVNVRNAAVYQATKFGVNAFSETLRQEVTE----RGVRVVVIEPGTTDTELR-------
1rwbA           GTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYA----PKGIRVNNIGPGAINT----PINAEK
1g6kA           GTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYA----PKGIRVNNIGPGAINT----PINAEK
1geeA           GTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYA----PKGIRVNNIGPGAINT----PINAEK
1gcoA           GTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYA----PKGIRVNNIGPGAINT----PINAEK
3ftpC           RIVNITSVGSAGNP--GQVNYAAAKAGVAGMTRALAREIGS----RGITVNCVAPGFIDTDMTKEQQTAL
2ph3A           R-IVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQ----RGITVNAVAPGFIETEMTERL----
3ennA           XXXXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIAS----RNVTVNCIAPGFIESKQKDAIMG--
3ftpA           RIVNITSVGSAGNP--GQVNYAAAKAGVAGMTRALAREIGS----RGITVNCVAPGFIDTDM---TKGLP
3emkD           XXXXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIAS----RNVTVNCIAPGFIEEKQKDAIMG--
3emkA           XXXXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIAS----RNVTVNCIAPGFIESAMEK------
3g1tA           SLVFT-SSSVGRQGRANWGAYATSKFATEGMMQVLADEY----QNRSLRVNCINPGGTRTSMR-------
3ftpD           RIVNITSVGSAGNP--GQVNYAAAKAGVAGMTRALAREIGS----RGITVNCVAPGFIDTDEQQT---AL
3gvcD           RMIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRS----SGIRSNTLLPAFVDTPMQQTMAGGA
3gvcA           RMIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRS----SGIRSNTLLPAFVDTPMQQTMFGGA
1q7bA           R-IITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVAS----RGITVNVVAPGFIETDMTRAL----
3ennB           XXXXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIAS----RNVTVNCIAPGFIESNEKQ------
1q7bB           R-IITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVAS----RGITVNVVAPGFIETDM--------
3gvcC           RMIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRS----SGIRSNTLLPAFVDTPMQQTAMAMF
3gvcB           RMIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRS----SGIRSNTLLPAFVDTPMQQTAMAMF
1i01E           R-IITIGS------VVGQANYAAAKAGLIGFSKSLAREVAS----RGITVNVVAPGFIETDMTRAL----
3grpA           RIINITSIGQTN--------YCAAKAGLIGFSKALAQEIAS----RNITVNCIAPGFIKSAMTDKL----
3ennD           XXXXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIAS----RNVTVNCIAPGFIE-----------
3ennC           XXXXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIAS----RNVTVNCIAPGFIE-----------
3emkB           XXXXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIAS----RNVTVNCIAPGFIKDAIMGNIPGAD
2zatA           XXXXXXXXXXAYHPFPNLGPYNVSKTALLGLTKNLAVELA----PRNIRVNCLAPGLIKTNFSQVL-WMD
3emkC           XXXXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIAS----RNVTVNCIAPG--------------
3grpB           RIINITSIGQTN--------YCAAKAGLIGFSKALAQEIAS----RNITVNCIAPGFIKSAIMAMI----
3f1lB           SLVFT-SSSVGRQGRANWGAYAASKFATEGMMQVLADEY-----QQRLRVNCINPGGTRTAMR-------
3f1lA           SLVFT-SSSVGRQGRANWGAYAASKFATEGMMQVLADEY-----QQRLRVNCINPGGTRTAMR-------
2cfcA           HMLLQIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAG----SGIRCNAVCPGMIETPMTQ------
1i01D           R-IITIGSVVAN--------YAAAKAGLIGFSKSLAREVAS----RGITVNVVAPGFIETALSDDQRAGI
3gy0A           SLVFT-SSSVGRQGRANWGAYAASKFATEGMMQVLADEY-----QQRLRVNCINPGGTRTAMR-------
3ezlA           R-IINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVAT----KGVTVNTVSPGYIGTDMVKAIRPDV
1pr9A           GAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELG----PHKIRVNAVNPTVVMTSM--------
3gz4B           SLVFT-SSSVGRQGRANWGAYAASKFATEGMMQVLADEY-----QQRLRVNCINPGGTRTAMR-------
3gz4A           SLVFT-SSSVGRQGRANWGAYAASKFATEGMMQVLADEY-----QQRLRVNCINPGGTRTAMR-------
1i01B           R-IITIGSVVGT----GQANYAAAKAGLIGFSKSLAREVAS----RGITVNVVAPGFIETSDDQ--RAGI
3cxrA           KNICSMMSELGRETV---SAYAAAKGGLKMLTKNIASEYGEA----NIQCNGIGPGYIATPQTAPLR---


                         .         .         .         +         .         .         .:280
query           FAQVQRFRDLKDNEQLASPDDTARRIVAYLARPDFGTTELDDxxxx
1z6zE           PDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEF-----------
1z6zD           PDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEF-----------
1z6zB           PDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEF-----------
1z6zA           PDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEF-----------
1oaaA           PELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTF-----------
2japC           ----------------------------------------------
2japA           ----------------------------------------------
1rwbA           FADPEQRADVE-----------------------------------
1g6kA           FADPEQRADVE-----------------------------------
1geeA           FADPEQRADVE-----------------------------------
1gcoA           FADPEQRADVE-----------------------------------
3ftpC           KTQIPLGR-------LGSPEDIA-HAVAFLASPQAG----------
2ph3A           ----------------------------------------------
3ennA           ----------------------------------------------
3ftpA           QEQQTALKTQIPLGRLGSPEDIA-HAVAFLASPQAG----------
3emkD           ----------------------------------------------
3emkA           ----------------------------------------------
3g1tA           ----------------------------------------------
3ftpD           KTQIPLGR-------LGSPEDIA-HAVAFLASPQAG----------
3gvcD           RSMIARLQG-----RMAAPEEMA-GIVVFLLSDDTGTTQIAD----
3gvcA           RSMIARLQG-----RMAAPEEMA-GIVVFLLSDDTGTTQIAD----
1q7bA           ----------------------------------------------
3ennB           ----------------------------------------------
1q7bB           ----------------------------------------------
3gvcC           DGALGGARSMRLQGRMAAPEEMA-GIVVFLLSDDTGTTQIAD----
3gvcB           DGALGGARSMRLQGRMAAPEEMA-GIVVFLLSDDTGTTQIAD----
1i01E           ----------------------------------------------
3grpA           ----------------------------------------------
3ennD           ----------------------------------------------
3ennC           ----------------------------------------------
3emkB           IA--------------------------------------------
2zatA           KARKEYMKESLRIRRLGNPEDCA-GIVSFLCSED------------
3emkC           ----------------------------------------------
3grpB           ----------------------------------------------
3f1lB           ----------------------------------------------
3f1lA           ----------------------------------------------
2cfcA           ----------------------------------------------
1i01D           LAQV------------------------------------------
3gy0A           ----------------------------------------------
3ezlA           LEKIVATIPVR---RLGSPDEIG-SIVAWLASEESG----------
1pr9A           ----------------------------------------------
3gz4B           ----------------------------------------------
3gz4A           ----------------------------------------------
1i01B           LAQV------------------------------------------
3cxrA           ----------------------------------------------