[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF07996.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2j66A.bssp"
#ERROR : Can't open dsspfile "2p3eB.bssp"
#ERROR : Can't open dsspfile "3c5qA.bssp"
#ERROR : Can't open dsspfile "2qghA.bssp"
#ERROR : Can't open dsspfile "2p3eA.bssp"
#ERROR : Can't open dsspfile "1twiA.bssp"
#ERROR : Can't open dsspfile "1tufA.bssp"
#ERROR : Can't open dsspfile "2pljB.bssp"
#ERROR : Can't open dsspfile "1hkvA.bssp"
#ERROR : Can't open dsspfile "2o0tA.bssp"
#ERROR : Can't open dsspfile "2plkB.bssp"
#ERROR : Can't open dsspfile "2pljA.bssp"
#ERROR : Can't open dsspfile "2plkA.bssp"
#ERROR : Can't open dsspfile "1hkwB.bssp"
#ERROR : Can't open dsspfile "1hkwA.bssp"
#ERROR : Can't open dsspfile "1ko0A.bssp"
#ERROR : Can't open dsspfile "1knwA.bssp"
#ERROR : Can't open dsspfile "7odcA.bssp"
#ERROR : Can't open dsspfile "1njjC.bssp"
#ERROR : Can't open dsspfile "1szrB.bssp"
#ERROR : Can't open dsspfile "1szrC.bssp"
#ERROR : Can't open dsspfile "1f3tD.bssp"
#ERROR : Can't open dsspfile "1njjB.bssp"
#ERROR : Can't open dsspfile "1f3tC.bssp"
#ERROR : Can't open dsspfile "1f3tA.bssp"
#ERROR : Can't open dsspfile "2nvaB.bssp"
#ERROR : Can't open dsspfile "1njjA.bssp"
#ERROR : Can't open dsspfile "1f3tB.bssp"
#ERROR : Can't open dsspfile "2todB.bssp"
#ERROR : Can't open dsspfile "1szrA.bssp"
#ERROR : Can't open dsspfile "2nvaE.bssp"
#ERROR : Can't open dsspfile "2nvaD.bssp"
#ERROR : Can't open dsspfile "2nvaG.bssp"
#ERROR : Can't open dsspfile "2nv9D.bssp"
#ERROR : Can't open dsspfile "1njjD.bssp"
#ERROR : Can't open dsspfile "2nv9E.bssp"
#ERROR : Can't open dsspfile "2nv9A.bssp"
#ERROR : Can't open dsspfile "1qu4A.bssp"
#ERROR : Can't open dsspfile "2nvaH.bssp"
#ERROR : Can't open dsspfile "2nvaF.bssp"
#ERROR : Can't open dsspfile "2on3A.bssp"
#ERROR : Can't open dsspfile "2nvaA.bssp"
#ERROR : Can't open dsspfile "1szrD.bssp"
#ERROR : Can't open dsspfile "2oo0B.bssp"
#ERROR : Can't open dsspfile "2oo0A.bssp"
#ERROR : Can't open dsspfile "2nvaC.bssp"
#ERROR : Can't open dsspfile "2nv9F.bssp"
#ERROR : Can't open dsspfile "2nv9B.bssp"
#ERROR : Can't open dsspfile "2todA.bssp"
#ERROR : Can't open dsspfile "2nv9H.bssp"
#ERROR : Can't open dsspfile "2nv9C.bssp"
#ERROR : Can't open dsspfile "2nv9G.bssp"
#ERROR : Can't open dsspfile "2yxxA.bssp"
#ERROR : Can't open dsspfile "1d7kA.bssp"
#ERROR : Can't open dsspfile "1d7kB.bssp"
#ERROR : Can't open dsspfile "3btnA.bssp"
#ERROR : Can't open dsspfile "3btnB.bssp"

## Summary of PDB Search
:397
    2e-43  34%  2j66A  [x.x.x] BTRK
    2e-29  31%  2p3eB  [x.x.x] DIAMINOPIMELATE DECARBOXYLASE
    3e-27  31%  3c5qA  [x.x.x] DIAMINOPIMELATE DECARBOXYLASE
    5e-27  30%  2qghA  [x.x.x] DIAMINOPIMELATE DECARBOXYLASE
    8e-26  30%  2p3eA  [x.x.x] DIAMINOPIMELATE DECARBOXYLASE
    1e-22  27%  1twiA  [b.49.2 - c.1.6] DIAMINOPIMELATE DECARBOXYLASE
    6e-21  26%  1tufA  [b.49.2 - c.1.6] DIAMINOPIMELATE DECARBOXYLASE
    4e-17  30%  2pljB  [x.x.x] LYSINE/ORNITHINE DECARBOXYLASE
    5e-17  31%  1hkvA  [b.49.2 - c.1.6] DIAMINOPIMELATE DECARBOXYLASE
    3e-16  32%  2o0tA  [x.x.x] DIAMINOPIMELATE DECARBOXYLASE
    4e-16  30%  2plkB  [x.x.x] LYSINE/ORNITHINE DECARBOXYLASE
    4e-16  30%  2pljA  [x.x.x] LYSINE/ORNITHINE DECARBOXYLASE
    7e-16  30%  2plkA  [x.x.x] LYSINE/ORNITHINE DECARBOXYLASE
    2e-15  29%  1hkwB  [b.49.2 - c.1.6] DIAMINOPIMELATE DECARBOXYLASE
    2e-15  29%  1hkwA  [b.49.2 - c.1.6] DIAMINOPIMELATE DECARBOXYLASE
    2e-14  29%  1ko0A  [b.49.2 - c.1.6] DIAMINOPIMELATE DECARBOXYLASE
    2e-14  29%  1knwA  [b.49.2 - c.1.6] DIAMINOPIMELATE DECARBOXYLASE
    7e-14  25%  7odcA  [b.49.2 - c.1.6] PROTEIN (ORNITHINE DECARBOXYLASE)
    2e-13  27%  1njjC  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    2e-13  29%  1szrB  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    3e-13  29%  1szrC  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    3e-13  27%  1f3tD  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    6e-13  28%  1njjB  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    6e-13  28%  1f3tC  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    6e-13  28%  1f3tA  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    8e-13  27%  2nvaB  [x.x.x] ARGININE DECARBOXYLASE, A207R PROTEIN
    8e-13  28%  1njjA  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    1e-12  28%  1f3tB  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    2e-12  27%  2todB  [b.49.2 - c.1.6] PROTEIN (ORNITHINE DECARBOXYLASE)
    2e-12  29%  1szrA  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    2e-12  26%  2nvaE  [x.x.x] ARGININE DECARBOXYLASE, A207R PROTEIN
    2e-12  26%  2nvaD  [x.x.x] ARGININE DECARBOXYLASE, A207R PROTEIN
    2e-12  27%  2nvaG  [x.x.x] ARGININE DECARBOXYLASE, A207R PROTEIN
    2e-12  27%  2nv9D  [x.x.x] A207R PROTEIN, ARGININE DECARBOXYLASE
    2e-12  27%  1njjD  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    4e-12  26%  2nv9E  [x.x.x] A207R PROTEIN, ARGININE DECARBOXYLASE
    4e-12  26%  2nv9A  [x.x.x] A207R PROTEIN, ARGININE DECARBOXYLASE
    5e-12  27%  1qu4A  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    5e-12  27%  2nvaH  [x.x.x] ARGININE DECARBOXYLASE, A207R PROTEIN
    5e-12  27%  2nvaF  [x.x.x] ARGININE DECARBOXYLASE, A207R PROTEIN
    6e-12  26%  2on3A  [x.x.x] ORNITHINE DECARBOXYLASE
    6e-12  27%  2nvaA  [x.x.x] ARGININE DECARBOXYLASE, A207R PROTEIN
    1e-11  27%  1szrD  [b.49.2 - c.1.6] ORNITHINE DECARBOXYLASE
    1e-11  25%  2oo0B  [x.x.x] ORNITHINE DECARBOXYLASE
    1e-11  25%  2oo0A  [x.x.x] ORNITHINE DECARBOXYLASE
    1e-11  27%  2nvaC  [x.x.x] ARGININE DECARBOXYLASE, A207R PROTEIN
    1e-11  26%  2nv9F  [x.x.x] A207R PROTEIN, ARGININE DECARBOXYLASE
    1e-11  26%  2nv9B  [x.x.x] A207R PROTEIN, ARGININE DECARBOXYLASE
    2e-11  26%  2todA  [b.49.2 - c.1.6] PROTEIN (ORNITHINE DECARBOXYLASE)
    2e-11  26%  2nv9H  [x.x.x] A207R PROTEIN, ARGININE DECARBOXYLASE
    3e-11  27%  2nv9C  [x.x.x] A207R PROTEIN, ARGININE DECARBOXYLASE
    1e-09  27%  2nv9G  [x.x.x] A207R PROTEIN, ARGININE DECARBOXYLASE
    2e-09  26%  2yxxA  [x.x.x] DIAMINOPIMELATE DECARBOXYLASE
    2e-09  26%  1d7kA  [b.49.2 - c.1.6] HUMAN ORNITHINE DECARBOXYLASE
    5e-09  25%  1d7kB  [b.49.2 - c.1.6] HUMAN ORNITHINE DECARBOXYLASE
    1e-06  27%  3btnA  [x.x.x] ANTIZYME INHIBITOR 1
    2e-06  30%  3btnB  [x.x.x] ANTIZYME INHIBITOR 1
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxRYIAGRDTREPVCXXXXXXXXXXXXXXXXXXXXPEQCALYYAVKANSDAPVLRALLGVADGFE
2j66A           ----------------------------------------------YLSLKANNNIHLAKLFRQWGLGVE
2p3eB           -----------------------------------------------YAVKANFNPHLVKLLGELGAGAD
3c5qA           -------------------------------------------------------------------GAD
2qghA           -------------------------------------------------------------------GAD
2p3eA           -----------------------------------------------YAVKANFNPHLVKLLGELGAGAD
1twiA           -----------------------------------------------YAYKANANLAITRLLAKLGCGAD
1tufA           ---------------------------------------------------ANANLAITRLLAKLGCGAD
2pljB           ---------------------------------------------LHYALKPLPHPVVVRTLLAEGASFD
1hkvA           ---------------------------------------------VHYAAKAFLCSEVARWISEEGLCLD
2o0tA           ----------------------------------------------------------------------
2plkB           ---------------------------------------------LHYALKPLPHPVVVRTLLAEGASFD
2pljA           ---------------------------------------------LHYALKPLPHPVVVRTLLAEGASFD
2plkA           ---------------------------------------------LHYALKPLPHPVVVRTLLAEGASFD
1hkwB           ---------------------------------------------VHYAAKAFLCSEVARWISEEGLCLD
1hkwA           ---------------------------------------------VHYAAKAFLCSEVARWISEEGLCLD
1ko0A           -----------------------------------------------FAQKACSNIHILRLMREQGVKVD
1knwA           -----------------------------------------------FAQKACSNIHILRLMREQGVKVD
7odcA           ----------------------------------------------FYAVKCNDSRAIVSTLAAIGTGFD
1njjC           -------RFLEGFNTRDALCKKGDPFFVADLGDIVRKHETWKKCTPFYAVKCNDDWRVLGTLAALGTGFD
1szrB           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
1szrC           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
1f3tD           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
1njjB           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
1f3tC           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
1f3tA           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
2nvaB           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
1njjA           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
1f3tB           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
2todB           ----------------------------------------------FYAVACNDDWRVLGTLAALGTGFD
1szrA           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
2nvaE           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2nvaD           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2nvaG           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2nv9D           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
1njjD           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
2nv9E           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2nv9A           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
1qu4A           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
2nvaH           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2nvaF           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2on3A           ----------------------------------------------FYAVKCNDSKAIVKTLAATGTGFD
2nvaA           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
1szrD           ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
2oo0B           ----------------------------------------------FYAVKCNDSKAIVKTLAATGTGFD
2oo0A           ----------------------------------------------FYAVKCNDSKAIVKTLAATGTGFD
2nvaC           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2nv9F           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2nv9B           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2todA           ----------------------------------------------FYAVACNDDWRVLGTLAALGTGFD
2nv9H           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2nv9C           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2nv9G           ----------------------------------------------HYAVKCNNDEVLLKTMCDKNVNFD
2yxxA           -----------------------------------------------FAVKANNN-PVLLKILREEGFGD
1d7kA           ----------------------------------------------FYAV-CNDSKAIVKTLAATGTGFD
1d7kB           ----------------------------------------------FYAV-CNDSKAIVKTLAATGTGFD
3btnA           ----------------------------------------------FYTVKCNSTPAVLEILAALGTGFA
3btnB           ----------------------------------------------FYTVKCNSTPAVLEILAALGTGFA


                         .         .         *         .         .         .         .:140
query           VASFGEIERVRGVDAEVPIAFGGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRA
2j66A           VASAGELALARGFSAE-NIIFSGPGKKRSELEIAVQSGIYCIIAESVEELFYIEELAEKENKTARVAIRI
2p3eB           IVSGGELYLAKGIPPE-RIVYAGVGKTEKELTDAVDSEILMFNVESRQELDVLNEIAGKLGKKARIAIRV
3c5qA           CVSIGEIQRALKAGIKYRIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETIAQSLGIKARISIRI
2qghA           CVSIGEIQRALKAGIKYRIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETIAQSLGIKARISIRI
2p3eA           IVSGGELYLAKGIPPE-RIVYAGVGKTEKELTDAVDSEILMFNVESRQELDVLNEIAGKLGKKARIAIRV
1twiA           VVSGGEIAKLSNVPSK-KIVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETAKELGETANVAFRI
1tufA           VVSGGEIAKLSNVPSK-KIVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETAKELGETANVAFRI
2pljB           LATTGEVELVEGVPADLTI-HTHPIKRDADIRDALAYGCNVFVVDNLNELEKFKAYRD------DVELLV
1hkvA           VCTGGEL--AVALHASFPITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRL
2o0tA           ------------------ITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRL
2plkB           LATTGEVELVEGVPADLTI-HTHPIKRDADIRDALAYGCNVFVVDNLNELEKFKAYR------DDVELLV
2pljA           LATTGEVELVEGVPADLTI-HTHPIKRDADIRDALAYGCNVFVVDNLNELEKFKAYR------DDVELLV
2plkA           LATTGEVELVEGVPADLTI-HTHPIKRDADIRDALAYGCNVFVVDNLNELEKFKAYR------DDVELLV
1hkwB           VCTGGEL--AVALHASFPITLHGNNKSVSELTAAVKAGVGHIVVDST-EIERLDAIAGEAGIVQDVLVRL
1hkwA           VCTGGEL--AVALHASFPITLHGNNKSVSELTAAVKAGVGHIVVDST-EIERLDAIAGEAGIVQDVLVRL
1ko0A           SVSLGEIERAAGYNPQTDIVFTADVIDQATLESELQIPVNAGSVDMLDQLGQVSPGHR-------VWLRV
1knwA           SVSLGEIERAAGYNPQTDIVFTADVIDQATLESELQIPVNAGSVDMLDQLGQVSPGHR-------VWLRV
7odcA           CASKTEIQLVQGLGVPAEVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMK---VARAHPK-AKLVLRI
1njjC           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
1szrB           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFDC---VDELEKVAKTHPK-AKMVLRI
1szrC           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
1f3tD           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
1njjB           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
1f3tC           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFDC---VDELEKVAKTHPK-AKMVLRI
1f3tA           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
2nvaB           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFEL---DKIHTYHPNCKMILIRC
1njjA           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
1f3tB           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFDC---VDELEKVAKTHPK-AKMVLRI
2todB           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
1szrA           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
2nvaE           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
2nvaD           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
2nvaG           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
2nv9D           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
1njjD           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
2nv9E           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
2nv9A           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
1qu4A           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
2nvaH           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
2nvaF           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
2on3A           CASKTEIQLVQGVPPE-RIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMK---VARAHPKAKLVLRIA
2nvaA           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
1szrD           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
2oo0B           CASKTEIQLVQGVPPE-RIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMK---VARAHPK-AKLVLRI
2oo0A           CASKTEIQLVQGVPPE-RIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMK---VARAHPK-AKLVLRI
2nvaC           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
2nv9F           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFEL---DKIHTYHPNCKMILIRC
2nv9B           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
2todA           CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFD-----------------CVDELEKV
2nv9H           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFEL---DKIHTYHPNCKMILIRC
2nv9C           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
2nv9G           CASSSEIKKVIQIGVSPSIIFAHTMKTIDDLIFAKDQGVDIATFDSSFE---LDKIHTYHPNCKMILIRC
2yxxA           VVTKGELAKLAGVPSHT-VVWNGNGKS-RDQEHFLREDVRIVNVDSFEE----EIWRELNPEGVEYFIRV
1d7kA           CASKTEIQLVQGVPPE-RIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMK---VARAHPK-AKLVLRI
1d7kB           CASKTEIQLVQGVPPE-RIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMK---VARAHPK-AKLVLRI
3btnA           CSSKNEMALVQGVSPE-NIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKI----ARNHPNAKVLLHI
3btnB           CSSKNEMALVQGVSPE-NIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKI----ARNHPNAKVLLHI


                         +         .         .         .         .         *         .:210
query           NPAYGLPGATLQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA
2j66A           NPDKSF--TAIKMGGVPRQFGMDESMLDAVMDAVRSLQFTKFIGIHVYTGTQNLNTDSIIESMKYTVDLG
2p3eB           NP---------------SKFGVDIREAQKEYEYASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLY
3c5qA           NP--NIDAKTLSTGLKENKFGVGEKEALEMFLWAKKSAFLEPVSVHFHIGSQLLDLEPIIEASQKVAKIA
2qghA           NP--NIDAKTISTGLKENKFGVGEKEALEMFLWAKKSAFLEPVSVHFHIGSQLLDLEPIIEASQKVAKIA
2p3eA           NP---------------SKFGVDIREAQKEYEYASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLY
1twiA           NPNVNKTHPKISTGLKKNKFGLDSGIAMKAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFV
1tufA           NPNVNKTHPKISTGLKKNKFGLDSGIAMKAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFV
2pljB           RLSF------------SKKFGCEQAL---VIIETAKEWNIRIKGLSFHVGSQTTNPNKYVEAIHRHVMEQ
1hkvA           --TVGVEAHTHEFISTAQKFGLSVASGAAMAAVRRVFDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGL-
2o0tA           --TVGVEAHTHEFISTAQKFGLSVASGAAMAAVRRVFDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGL-
2plkB           RLSF------------SKKFGCEQAL---VIIETAKEWNIRIKGLSFHVGSQTTNPNKYVEAIHRHVMEQ
2pljA           RLSF------------SKKFGCEQAL---VIIETAKEWNIRIKGLSFHVGSQTTNPNKYVEAIHRHVMEQ
2plkA           RLSFKKFGCS-----------PEQAL---VIIETAKEWNIRIKGLSFHVGSQTTNPNKYVEAIHRHVMEQ
1hkwB           T--VGVEAHTHEFISTAHEXXXXXXXXXXXXXXXXXTDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGL-
1hkwA           T--VGVEAHTHEFISTAHEXXXXXXXXXXXXXXXXXTDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGL-
1ko0A           NPGFGHGHSQTNTGGENSKHGIWYTDLPAALDVIQRH-HLQLVGIHMHIGSGVDYA--HLEQVCG--AMV
1knwA           NPGFGHGHSQTNTGGENSKHGIWYTDLPAALDVIQRH-HLQLVGIHMHIGSGVDYA--HLEQVCG--AMV
7odcA           ----------------ATKFGATLKTSRLLLERAKEL-NIDVIGVSFHVGSGCTDPDTFVQAVSDARCVF
1njjC           AKTH--PKAKMVLRISTVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
1szrB           ----------------STKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
1szrC           AKTH--PKAKMVLRISTVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
1f3tD           AKTHPKAKMVLRISTLSVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
1njjB           AKTH--PKAKMVLRISTVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
1f3tC           STDDRL----------SVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
1f3tA           AKTH--PKAKMVLRISTVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
2nvaB           DD----PNATVQLGN---KFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
1njjA           AKTH--PKAKMVLRISTVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
1f3tB           STDL------------SVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
2todB           AKTHPKAKMVLRISTLSVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
1szrA           AKTHPKAKMVLRISTGAK---VEDCRF--ILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
2nvaE           DD----PNATVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2nvaD           DD----PNATVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2nvaG           DD----PNATVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2nv9D           DD----PNAAVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
1njjD           AKTH--PKAKMVLRISTVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
2nv9E           DD----PNAAVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2nv9A           DD----PNAAVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
1qu4A           AKTHPKAKMVLRISTLSVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
2nvaH           DD----PNATVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2nvaF           DD----PNATVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2on3A           TVKF---GATLRTS--------------RLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVF
2nvaA           DD----PNATVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
1szrD           AKTH--PKAKMVLRISTVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
2oo0B           ATDDSKAVCRLSVKFGAT------LRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVF
2oo0A           ATDDSKAVCRLSVKFGAT------LRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVF
2nvaC           DD----PNATVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2nv9F           DD----PNAAVQLGN---KFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2nv9B           DD----PNAAVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2todA           AKTHPKAKMVLRISTLSVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
2nv9H           DD----PNAAVQLGN---KFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2nv9C           DD----PNAAVQLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2nv9G           DD----PNAA-QLG---NKFGANEDEIRHLLEYAKQL-DIEVIGISFHVGSGSRNPEAYYAIKSSKEAFN
2yxxA           NPEVDAKTHPISTGLKKHKFGIP---LEDLDSFERFRSNIR--GLHVHIGSQITRVEPFVEAFSKVVRAS
1d7kA           ATDDSKAVCRLSVKFGAT------LRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVF
1d7kB           ATDDSKAVCRLSVKFGAT------LRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVF
3btnA           --------ATEDMKFGTTLKNCRH------LLECAKELDVQIIGVKFHVSSACKEYQVYVALSDARCVF-
3btnB           --------ATEDMKFGTTLKNCRH------LLECAKELDVQIIGVKFHVSSACKEYQVYVALSDARCVF-


                         .         .         .         +         .         .         .:280
query           KRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVA
2j66A           RNIYERYGIVCECINLGGGFGVPYF--EKALDIGKITRTVSDYVQEARPQTTFIIESGRYLLAQAAVYVT
2p3eB           ESLTQ-KGFDIKYLDIGGGLGIKYK-PE---DKEPAPQDLADLLKDLLENAKIILEPGRSIMGNAGILIT
3c5qA           KSLIAL-GIDLRFFDVGGGIGVSYENEETIKLYD-YAQGILNALQ--GLDLTIICEPGRSIVAESGELIT
2qghA           KSLIAL-GIDLRFFDVGGGIGVSYENEETIKLYD-YAQGILNALQ--GLDLTIICEPGRSIVAESGELIT
2p3eA           ESLTQ-KGFDIKYLDIGGGLGIKYK-PE---DKEPAPQXXXXXXXXXXXXXXXXXEPGRSIMGNAGILIT
1twiA           VELKE-EGIEIEDVNLGGGLGIPYQIPTQKDLADAIINTMLKY-KDKVEMPNLILEPGRSLVATAGYLLG
1tufA           VELKE-EGIEIEDVNLGGGLGIPYQIPTQKDLADAIINTMLKY-KDKVEMPNLILEPGRSLVATAGYLLG
2pljB           VVERGLPALST--LDIGGGFPVNYT--QQVMPIDQFCAPINEALSLLPETVHVLAEPGRFICAPAVTSVA
1hkvA           --LRDVVGAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESPTPKLVVEPGRAIAGPGTITLY
2o0tA           --LRDVVGAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESPTPKLVVEPGRAIAGPGTITLY
2plkB           VVERGLPALST--LDIGGGFPVNY--TQQVMPIDQFCAPINEALSLLPETVHVLAEPGRFICAPAVTSVA
2pljA           VVERGLPALST--LDIGGGFPVNY--TQQVMPIDQFCAPINEALSLLPETVHVLAEPGRFICAPAVTSVA
2plkA           VVERGLPALST--LDIGGGFPVNY--TQQVMPIDQFCAPINEALSLLPETVHVLAEPGRFICAPAVTSVA
1hkwB           --LRDVVGAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESPTPKLVVEPGRAIAGPGTITLY
1hkwA           --LRDVVGAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESPTPKLVVEPGRAIAGPGTITLY
1ko0A           RQVIEF-GQDLQAISAGGGLSVPYQQGEEAVDTEHY-YGLEQIARHLGHPVKLEIEPGRFLVAQSGVLIT
1knwA           RQVIEF-GQDLQAISAGGGLSVPYQQGEEAVDTEHY-YGLEQIARHLGHPVKLEIEPGRFLVAQSGVLIT
7odcA           DMATEV-GFSMHLLDIGGGFP---GSEDTKLKFEEITSVINPALDKYFPSVRIIAEPGRYYVASAFTLAV
1njjC           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
1szrB           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRY-------YVA
1szrC           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRY-------YVA
1f3tD           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
1njjB           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
1f3tC           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
1f3tA           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
2nvaB           EAISVGHKPYI--LDIGGGLHADIDGELSTYMSDYINDAIKDFFPED--TVTIVAEPGRFFAEHYSVLAT
1njjA           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
1f3tB           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
2todB           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
1szrA           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRY-------YVA
2nvaE           EAISVGHKPYI--LDIGGGLHADIDGELSTYMSDYINDAIKDFFPE--DTVTIVAEPGRFFAEHYSVLAT
2nvaD           EAISVGHKPYI--LDIGGGLHADIDGELSTYMSDYINDAIKDFFPE--DTVTIVAEPGRFFAEHYSVLAT
2nvaG           EAISVGHKPYI--LDIGGGLHADIDEGELSTMSD-YINDAIDFFPET---VTIVAEPGRFFAEHYSVLAT
2nv9D           EAISVGHKPYI--LDIGGGL---------HADIDELTMSINDAIKDFFPEVTIVAEPGRFFAEHYSVLAT
1njjD           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRY-------YVA
2nv9E           EAISVGHKPYI--LDIGGGLHADIDEGELSTMSDYINDAIKDFFPE--DTVTIVAEPGRFFAEHYSVLAT
2nv9A           EAISVGHKPYI--LDIGGGLHADIDEGELSTMSDYINDAIKDFFPE--DTVTIVAEPGRFFAEHYSVLAT
1qu4A           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
2nvaH           EAISVGHKPYI--LDIGGGLHADIGELSTMSDY------INDAIKDFFPTVTIVAEPGRFFAEHYSVLAT
2nvaF           EAISVGHKPYI--LDIGGGLHADIGELSTMSDY------INDAIKDFFPTVTIVAEPGRFFAEHYSVLAT
2on3A           DMGAEV-GFSMYLLDIGGGFP---GSEDVKLKFEEITGVINPALDKYFPSVRIIAEPGRYYVASAFTLAV
2nvaA           EAISVGHKPYI--LDIGGGLHADIDLSTYMSDY------INDAIKDFFPTVTIVAEPGRFFAEHYSVLAT
1szrD           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRY-------YVA
2oo0B           DMGAEV-GFSMYLLDIGGGFP---GSEDVKLKFEEITGVINPALDKYFPSVRIIAEPGRYYVASAFTLAV
2oo0A           DMGAEV-GFSMYLLDIGGGFP---GSEDVKLKFEEITGVINPALDKYFPSVRIIAEPGRYYVASAFTLAV
2nvaC           EAISVGHKPYI--LDIGGGLHAD-------IELSTMSDYINDAIKDFFPTVTIVAEPGRFFAEHYSVLAT
2nv9F           EAISVGHKPYI--LDIGGGLHADIGELSTYMS-DYINDAIKDFFPED--TVTIVAEPGRFFAEHYSVLAT
2nv9B           EAISVGHKPYI--LDIGGGLHADIDEGELSTYMSDYIND---AIKDFFPTVTIVAEPGRFFAEHYSVLAT
2todA           DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
2nv9H           EAISVGHKPYI--LDIGGGLHAD-------IELSTMSDYINDAIKDFFPTVTIVAEPGRFFAEHYSVLAT
2nv9C           EAISVGHKPYI--LDIGGGLHADILSTMSDYIND--------AIKDFFPTVTIVAEPGRFFAEHYSVLAT
2nv9G           EAISVGHKPYI--LDIGGGLHADLSTYMSDYIND--------AIKDFFPTVTIVAEPGRFFAEHYSVLAT
2yxxA           ERYXXXXXXXXXXXXXXXXXXX--------LDLSSYREKVVPDLKRFK---RVIVEIGRYIVAPSGYXXX
1d7kA           DMGAEV-GFSMYLLDIGGGFP---GSEDVKLKFEEITGVINPALDKYFPSVRIIAEPGRYYVASAFTLIA
1d7kB           DMGAEV-GFSMYLLDIGGGFP---GSEDVKLKFEEITGVINPALDKYFPSVRIIAEPGRYYVASAFTLAV
3btnA           -DMAGEFGFTMNMLDIGGGFGTEIQLEEVN-------HVISPLLDIYFPGIQIISEPGSYYVSSAFTLAV
3btnB           -DMAGEFGFTMNMLDIGGG---------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELCTPKDVL
2j66A           EVLYRKASKGEVFVIVDGGMHHHAAS---------------------PMEYIPLEKVTIAGPLCTPEDCL
2p3eB           QVQFLKDKGSKHFIIVDAGMNDLIRPSIYNAYH-----------HIIPVETKERKKVVIVGPICETGDFL
3c5qA           QVLYEKKN--KRFVIVDAGMNDFLRPSLYHAKHAIRVITPS-----------EISPCDVVGPVCESSDTF
2qghA           QVLYEKKN--KRFVIVDAGMNDFLRPSLYHAKHAIRVITPS-----------EISPCDVVGPVCESSDTF
2p3eA           QVQFLKDKGSKHFIIVDAGMNDLIRPSIYNAYH--HIIP------------VETKEVVIVGPICETGDFL
1twiA           KVHHIKETPVTKWVMIDAGMNDMMRPAMYEAYHHIINCKVKN----------EKEVVSIAGGLCESSDVF
1tufA           KVHHIKETPVTKWVMIDAGMNDMMRPAMYEAYHHIINCKVKN----------EKEVVSIAGGLCESSDVF
2pljB           SVMGQAEREGQIWYYLDDGIYG-----------SFSGLMFDDARYPLTTIKGELIPSVLSGPTCDSVDVI
1hkvA           EVGTVKTAHRRYVSVDGGMSDNIR-----------TALYGAQYDVRLVSRVSDAPPVRLVGKHCESGDII
2o0tA           EVGTVKTAHRRYVSVDGGMSDNIR-----------TALYGAQYDVRLVSRVSDAPPVRLVGKHCESGDII
2plkB           SVMGQAEREGQIWYYLDDGIY-----------GSFSGLMFDDARYPLTKQGGELIPSVLSGPTCDSVDVI
2pljA           SVMGQAEREGQIWYYLDDGIY-----------GSFSGLMFDDARYPLTKQGGELIPSVLSGPTCDSVDVI
2plkA           SVMGQAEREGQIWYYLDDGIY-----------GSFSGLMFDDARYPLTKQGGELIPSVLSGPTCDSVDVI
1hkwB           EVVDVSATAHRRYVSVDGGSDNIR-----------TALYGAQYDVRLVSRVSDAPPVRLVGKHCESGDII
1hkwA           EVVDVSATAHRRYVSVDGGSDNIR-----------TALYGAQYDVRLVSRVSDAPPVRLVGKHCESGDII
1ko0A           QVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEH-APTVE---TVVAGPLCESGDVF
1knwA           QVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEH-APTVE---TVVAGPLCESGDVF
7odcA           NIIAKKTVWEQTFMYVNDGVYGSFNCILYDHAHVKALLQKR------PKPDEKYYSSSIWGPTCDGLDRI
1njjC           NVIAKKVTQSFMYYVNDGVYGSFNCIL---------------YDHAVVRPLPQREPISVWGPTCDGLDQI
1szrB           SAFTLAVN-----VIAKAVTQSFMYYVNDGVYGSFNCILYDHAVVPLPQREPKLYPSSVWGPTCDGLDQI
1szrC           SAFTLAVN-----VIAKAVTQSFMYYVNDGVYGSFNCILYDH---AVVRPLPQREPISVWGPTCDGLDQI
1f3tD           NVIAKKVTQSFMYYVNDGVYGSFNCIL---------------YDHAVVRPLPQREPISVWGPTCDGLDQI
1njjB           NVIAKKVTQSFMYYVNDGVYGSFNCIL---------------YDHAVVRPLPQREPISVWGPTCDGLDQI
1f3tC           NVIAKKVTQSFMYYVNDGVYGSFNCIL---------------YDHAVVRPLPQREPISVWGPTCDGLDQI
1f3tA           NVIAKKVTQSFMYYVNDGVYGSFNCIL---------------YDHAVVRPLPQREPISVWGPTCDGLDQI
2nvaB           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDV-------PDEEYVPSVLYGCTCDGVDVI
1njjA           NVIAKKVTQSFMYYVNDGVYGSFNCIL---------------YDHAVVRPLPQREPEKLWGPTCDGLDQI
1f3tB           NVIAKKVTQSFMYYVNDGVYGSFNCIL---------------YDHAVVRPLPQREPISVWGPTCDGLDQI
2todB           NVIAKKVTAQSFMYYVNDGVY-----------GSFNCILYDH---AVVRPLPQREPISVWGPTCDGLDQI
1szrA           SAFTLAVN-----VIAKAVTQSFMYYVNDGVYGSFNCILYDH---AVVRPLPQREPISVWGPTCDGLDQI
2nvaE           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
2nvaD           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
2nvaG           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
2nv9D           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
1njjD           SAFTLAVN-----VIAKKVTSNAQSFMYYVNDGVYGSFNCILYDHAVVRPLPQREPISVWGPTCDGLDQI
2nv9E           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
2nv9A           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
1qu4A           NVIAKKVTPAQSF-------------MYYVNDGVYGSFNCILYDHAVVRPLPQREPISVWGPTCDGLDQI
2nvaH           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
2nvaF           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
2on3A           NIIAKKIVLEQTFMYVNDGVYGSFNCILYDHAHVKPLLQKR------PKPDEKYYSSSIWGPTCDGLDRI
2nvaA           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
1szrD           SAFTLAVN------VIAKAVTPAQSFMYYVNDGVYGSFNCILYDHAVVRPLPQREPISVWGPTCDGLDQI
2oo0B           NIIAKKIVLEQTFMYVNDGVYGSFNCILYDHAHVKPLLQKR------PKPDEKYYSSSIWGPTCDGLDRI
2oo0A           NIIAKKIVLEQTFMYVNDGVYGSFNCILYDHAHVKPLLQKR------PKPDEKYYSSSIWGPTCDGLDRI
2nvaC           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
2nv9F           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDV-------PDEEYVPSVLYGCTCDGVDVI
2nv9B           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
2todA           NVIAKKVTPAQSF-------------MYYVNDGVYGSFNCILYDHAVVRPLPQREPISVWGPTCDGLDQI
2nv9H           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDV-------PDEEYVPSVLYGCTCDGVDVI
2nv9C           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
2nv9G           QVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLLRDVPDDE------EYVPSVLYGCTCDGVDVI
2yxxA           XXXXXXXXHNKAFVVVDGGNVLIR-PALYSAYHRIFVLGKQG-----------KERADVVGPLCESGDVI
1d7kA           KKIVLKEQTEQTFMYVNDGVYGSFNCILYDHAHVKPLLQKR------PKPDERYYSSSIWGPTCDGLDRI
1d7kB           NIIAKKSSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKR------PKPDERYYSSSIWGPTCDGLDRI
3btnA           NIIAKK---------VVAFVYYMNDGVYGSFASKLSTIPEVH-----KKPLFTS---SLWGPSCDELDQI
3btnB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIGGQx
2j66A           GKDVHVPALYPGDLVCVLNSGAYGLSFSPVHFLGHPTP---------
2p3eB           ALDREIEEVQRGEYLAVLSAGAYGFAMSSH-----------------
3c5qA           LKDAHLPELEPGDKIAIEKVGAYG-----------------------
2qghA           LKDAHLPELEPGDKIAIEKVGAYG-----------------------
2p3eA           ALDREIEEVQRGEYLAVLSAGAYGFAMSSH-----------------
1twiA           GRDRELDKVEVGDVLAIFDVGAYG-----------------------
1tufA           GRDRELDKVEVGDVLAIFDVGAYG-----------------------
2pljB           AENILLPKLNNGDLVIGRTMGAY------------------------
1hkvA           VRDTWVDDIRPGDLVAVAATGAYCYSLS-------------------
2o0tA           VRDTWVDDIRPGDLVAVAATGAYCYSLS-------------------
2plkB           AENILLPKLNNGDLVIGRTMGAY------------------------
2pljA           AENILLPKLNNGDLVIGRTMGAY------------------------
2plkA           AENILLPKLNNGDLVIGRTMGAY------------------------
1hkwB           VRDTWVDDIRPGDLVAVAATGAYCYSLSSRYNVGRPAVVAVHAG---
1hkwA           VRDTWVDDIRPGDLVAVAATGAYCYSLSSRYNVGRPAVVAVHAG---
1ko0A           TQQEALPEVKAGDYLVLHDTGAYGASMS-SNYNSRPLPEVLFDNGQ-
1knwA           TQQEALPEVKAGDYLVLHDTGAYGASMS-SNYNSRPLPEVLFDNGQ-
7odcA           VERCNLPEMHVGDWMLFENMGAY------------------------
1njjC           VERYYLPEMQVGEWLLFEDMGAY------------------------
1szrB           VERYYLPEMQVGEWLLFEDMGAY------------------------
1szrC           VERYYLPEMQVGEWLLFEDMGAY------------------------
1f3tD           VERYYLPEMQVGEWLLFEDMGAY------------------------
1njjB           VERYYLPEMQVGEWLLFEDMGAY------------------------
1f3tC           VERYYLPEMQVGEWLLFEDMGAY------------------------
1f3tA           VERYYLPEMQVGEWLLFEDMGAY------------------------
2nvaB           NHNVALPELHIGDWVYFPSWGAY------------------------
1njjA           VERYYLPEMQVGEWLLFEDMGAY------------------------
1f3tB           VERYYLPEMQVGEWLLFEDMGAY------------------------
2todB           VERYYLPEMQVGEWLLFEDMGAY------------------------
1szrA           VERYYLPEMQVGEWLLFEDMGAY------------------------
2nvaE           NHNVALPELHIGDWVYFPSWGAY------------------------
2nvaD           NHNVALPELHIGDWVYFPSWGAY------------------------
2nvaG           NHNVALPELHIGDWVYFPSWGAY------------------------
2nv9D           NHNVALPELHIGDWVYFPSWGAY------------------------
1njjD           VERYYLPEMQVGEWLLFEDMGAY------------------------
2nv9E           NHNVALPELHIGDWVYFPSWGAY------------------------
2nv9A           NHNVALPELHIGDWVYFPSWGAY------------------------
1qu4A           VERYYLPEMQVGEWLLFEDMGAY------------------------
2nvaH           NHNVALPELHIGDWVYFPSWGAY------------------------
2nvaF           NHNVALPELHIGDWVYFPSWGAY------------------------
2on3A           VERCDLPEMHVGDWMLFENMGAY------------------------
2nvaA           NHNVALPELHIGDWVYFPSWGAY------------------------
1szrD           VERYYLPEMQVGEWLLFEDMGAY------------------------
2oo0B           VERCDLPEMHVGDWMLFENMGAY------------------------
2oo0A           VERCDLPEMHVGDWMLFENMGAY------------------------
2nvaC           NHNVALPELHIGDWVYFPSWGAY------------------------
2nv9F           NHNVALPELHIGDWVYFPSWGAY------------------------
2nv9B           NHNVALPELHIGDWVYFPSWGAY------------------------
2todA           VERYYLPEMQVGEWLLFEDMGAY------------------------
2nv9H           NHNVALPELHIGDWVYFPSWGAY------------------------
2nv9C           NHNVALPELHIGDWVYFPSWGAY------------------------
2nv9G           NHNVALPELHIGDWVYFPSWGAY------------------------
2yxxA           AYDRELPEVEPGDIIAVENAGAYGYTSNNYNSTTRP-----------
1d7kA           VERCDLPEMHVGDWMLFENMGAY------------------------
1d7kB           VERCDLPEMHVGDWMLFENMGAY------------------------
3btnA           VESCLLPELNVGDWLIFDNMGADSFH---------------------
3btnB           -----------------------------------------------