[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF08007.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2v50B.bssp"
#ERROR : Can't open dsspfile "2j8sC.bssp"
#ERROR : Can't open dsspfile "2j8sB.bssp"
#ERROR : Can't open dsspfile "2j8sA.bssp"
#ERROR : Can't open dsspfile "3d9bA.bssp"
#ERROR : Can't open dsspfile "2v50A.bssp"
#ERROR : Can't open dsspfile "2i6wA.bssp"
#ERROR : Can't open dsspfile "2dhhA.bssp"
#ERROR : Can't open dsspfile "2gifB.bssp"
#ERROR : Can't open dsspfile "2gifA.bssp"
#ERROR : Can't open dsspfile "2hqgA.bssp"
#ERROR : Can't open dsspfile "2hqfA.bssp"
#ERROR : Can't open dsspfile "2hqdA.bssp"
#ERROR : Can't open dsspfile "2hqcA.bssp"
#ERROR : Can't open dsspfile "2v50D.bssp"
#ERROR : Can't open dsspfile "2v50E.bssp"
#ERROR : Can't open dsspfile "1iwgA.bssp"
#ERROR : Can't open dsspfile "2rddA.bssp"
#ERROR : Can't open dsspfile "1t9wA.bssp"
#ERROR : Can't open dsspfile "1t9uA.bssp"
#ERROR : Can't open dsspfile "1t9tA.bssp"

## Summary of PDB Search
:1044
      0.0  41%  2v50B  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
      0.0  42%  2j8sC  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  2j8sB  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  2j8sA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  3d9bA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  2v50A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
      0.0  42%  2i6wA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  2dhhA  [x.x.x] ACRB
      0.0  42%  2gifB  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  2gifA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  2hqgA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  2hqfA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  2hqdA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  2hqcA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  42%  2v50D  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
      0.0  41%  2v50E  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
      0.0  42%  1iwgA  [f.35.1 - d.58.44 - d.58.44 - d.225.1 - f.35.1 - d.58.44 -
      0.0  42%  2rddA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  41%  1t9wA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  41%  1t9uA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
      0.0  41%  1t9tA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
:1044

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAQFFLRRPAFAWVLAILTMVAGLVALNSIPVAQYPAVAPPTVILYADYPGATARTVEDRVTAVLEQQMH
2v50B           MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYXXXXXXXXXVQVSYPGASAETVQDTVVQVIEQQMN
2j8sC           MPNFFIDRPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2j8sB           MPNFFIDRPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2j8sA           MPNFFIDRPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
3d9bA           MPNFFIDRPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2v50A           ---FFIDRPIFAWVIALVIMLAGGLSILSLPVNQYXXXXXXXXXVQVSYPGASAETVQDTVVQVIEQQMN
2i6wA           MPNFFIDRPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2dhhA           MPNFFIDRPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2gifB           ---FFIDRPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2gifA           ---FFIDRPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2hqgA           -------RPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2hqfA           -------RPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2hqdA           -------RPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2hqcA           -------RPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2v50D           MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYXXXXXXXXXVQVSYPGASAETVQDTVVQVIEQQMN
2v50E           MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYXXXXXXXXXVQVSYPGASAETVQDTVVQVIEQQMN
1iwgA           -------RPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
2rddA           MPNFFIDRPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
1t9wA           -------RPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
1t9uA           -------RPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
1t9tA           -------RPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN


                         .         .         *         .         .         .         .:140
query           GIPGLLYIDSSSEAGTATVTIGFRQGTDPQLAQVNVRNRVSQAEPLLPEVVRRGGVYVDQASASPFMYVS
2v50B           GIDNLRYISSESNSGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVG
2j8sC           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2j8sB           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2j8sA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
3d9bA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2v50A           GIDNLRYISSESNSGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVG
2i6wA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2dhhA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2gifB           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2gifA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2hqgA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2hqfA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2hqdA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2hqcA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2v50D           GIDNLRYISSESNSGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVG
2v50E           GIDNLRYISSESNSGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVG
1iwgA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
2rddA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
1t9wA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIXXXXXXXXXXXXMPLLPQEVQQQGVSVEKSSSSFLMVVG
1t9uA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIXXXXXXXXXXXXMPLLPQEVQQQGVSVEKSSSSFLMVVG
1t9tA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIXXXXXXXXXXXXMPLLPQEVQQQGVSVEKSSSSFLMVVG


                         +         .         .         .         .         *         .:210
query           LISKTGTMSETALADYAAGTVLPMLRRLPGIGKVEAYSAEYALRVWFNPDQLNAYGLTTADVEAAIRARN
2v50B           VVSTDGSMTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGSQYSMRIWLDPAKLNSYQLTPGDVSSAIQAQN
2j8sC           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2j8sB           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2j8sA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
3d9bA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2v50A           VVSTDGSMTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGSQYSMRIWLDPAKLNSYQLTPGDVSSAIQAQN
2i6wA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2dhhA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2gifB           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2gifA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2hqgA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2hqfA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2hqdA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2hqcA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2v50D           VVSTDGSMTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGSQYSMRIWLDPAKLNSYQLTPGDVSSAIQAQN
2v50E           VVSTDGSMTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGSQYSMRIWLDPAKLNSYQLTPGDVSSAIQAQN
1iwgA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
2rddA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
1t9wA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
1t9uA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
1t9tA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN


                         .         .         .         +         .         .         .:280
query           GSVTPGQLGGAPSKPGQSYQAVVRPPAPLADPEAFGRIVLRSAADGSAVLLRDVARVEMAAADYRYSSTL
2v50B           VQISSGQLGGLPAVKGQQLNATIIGKTRLQTAEQFENILLKVNPDGSQVRLKDVADVGLGGQDYSINAQF
2j8sC           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2j8sB           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2j8sA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
3d9bA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2v50A           VQISSGQLGGLPAVKGQQLNATIIGKTRLQTAEQFENILLKVNPDGSQVRLKDVADVGLGGQDYSINAQF
2i6wA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2dhhA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2gifB           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2gifA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2hqgA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2hqfA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2hqdA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2hqcA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2v50D           VQISSGQLGGLPAVKGQQLNATIIGKTRLQTAEQFENILLK---------LKDVADVGLGGQDYSINAQF
2v50E           VQISSGQLGGLPAVKGQQLNATIIGKTRLQTAEQFENILLKVNPDGSQVRLKDVADVGLGGQDYSINAQF
1iwgA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
2rddA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
1t9wA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
1t9uA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
1t9tA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF


                         .         *         .         .         .         .         +:350
query           NGREAASMGLKLADGANVLATSRTVRDALDEAAKAFPAGVAYDISYDTAHFVQSSISRVLMTLAEATVLV
2v50B           NGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEAILLV
2j8sC           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2j8sB           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2j8sA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
3d9bA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2v50A           NGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEAILLV
2i6wA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2dhhA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2gifB           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2gifA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2hqgA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2hqfA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2hqdA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2hqcA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2v50D           NGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEAILLV
2v50E           NGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEAILLV
1iwgA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
2rddA           NGQPASGLGIKLXXXXXXXXXXXXXE--LAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
1t9wA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
1t9uA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
1t9tA           NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV


                         .         .         .         .         *         .         .:420
query           FLILYLFLGNLRATLIPCIVVPVSLLGTVACLYAFGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMR
2v50B           FLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2j8sC           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2j8sB           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2j8sA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
3d9bA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2v50A           FLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2i6wA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2dhhA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2gifB           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2gifA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2hqgA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2hqfA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2hqdA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDAAIVVVENVERVMA
2hqcA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVADAIVVVENVERVMA
2v50D           FLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2v50E           FLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
1iwgA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
2rddA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
1t9wA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
1t9uA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
1t9tA           FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA


                         .         .         +         .         .         .         .:490
query           EEGVDAFTAASRSMREVSGXXXXXXXXXXXXXXPMAFLGSAVGVIYRHFAMTLAISIAFSLFFALSLAPA
2v50B           EEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMALSVIVALILTPA
2j8sC           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2j8sB           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2j8sA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
3d9bA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2v50A           EEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMALSVIVALILTPA
2i6wA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2dhhA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2gifB           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2gifA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2hqgA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2hqfA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2hqdA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2hqcA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2v50D           EEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMALSVIVALILTPA
2v50E           EEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMALSVIVALILTPA
1iwgA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
2rddA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
1t9wA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
1t9uA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQ-SITIVSAMALSVLVALILTPA
1t9tA           EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQ-SITIVSAMALSVLVALILTPA


                         *         .         .         .         .         +         .:560
query           MCASLLRHGAQPARGPLAWFEHRFTAFTTRYAGWVXXXXXXXXXXXAVYLAMAAVCAVGLWQLPSGFLPE
2v50B           LCATMLKHGEHKG-GFFGWFNRMFLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPD
2j8sC           LCATMLKHG-EGKKGFFGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2j8sB           LCATMLKHG-EGKKGFFGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2j8sA           LCATMLKHG-EGKKGFFGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
3d9bA           LCATMLKHG-EGKKGFFGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2v50A           LCATMLK----PFFG---WFNRMFLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPD
2i6wA           LCATMLKPGF------FGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2dhhA           LCATMLKFG---------WFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2gifB           LCATMLKHG-EGKKGFFGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2gifA           LCATMLKHG-EGKKGFFGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2hqgA           LCATMLKFG---------WFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2hqfA           LCATMLKFG---------WFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2hqdA           LCATMLKFG---------WFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2hqcA           LCATMLKFG---------WFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2v50D           LCATMLK----PFFG---WFNRMFLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPD
2v50E           LCATMLKHGEHKG-GFFGWFNRMFLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPD
1iwgA           LCATMLKFG---------WFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
2rddA           LCATMLKPIAK--KGFFGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
1t9wA           LCATMLKFG---------WFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
1t9uA           LCATMLKFG---------WFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD
1t9tA           LCATMLKFG---------WFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPD


                         .         .         .         *         .         .         .:630
query           EDTGELVIDVELPPGSTQAQTRETIAQLEQWMKQERLPVKTSFALLGWNSGGSGEQRASVFLSLDDWKLR
2v50B           EDQGVLFAQVQTPPGSSAERTQVVVDSMREYLEKEXXXXXXXFTVTGFNFAGRGQSSGMAFIMLKPWEER
2j8sC           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2j8sB           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2j8sA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
3d9bA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2v50A           EDQGVLFAQVQTPPGSSAERTQVVVDSMREYLEKEXXXXXXXFTVTGFNFAGRGQSSGMAFIMLKPWEER
2i6wA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2dhhA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2gifB           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2gifA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2hqgA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2hqfA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2hqdA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2hqcA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2v50D           EDQGVLFAQVQTPPGSSAERTQVVVDSMREYLEKEXXXXXXXFTVTGFNFAGRGQSSGMAFIMLKPWEER
2v50E           EDQGVLFAQVQTPPGSSAERTQVVVDSMREYLEKEXXXXXXXFTVTGFNFAGRGQSSGMAFIMLKPWEER
1iwgA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
2rddA           EDQGVFMTMVQLPAGATQERTQKVLNEVTHYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
1t9wA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
1t9uA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
1t9tA           EDQGVFMTMVQLPAGATQERTQKVLNEVHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR


                         .         +         .         .         .         .         *:700
query           GRENAADVVLARLTKGLEEWPGRGDAQLYPYNGTALPELGSTSGLDMRLVTRLEGGRPSLYAARDKLIER
2v50B           GGENSVFELAKRAQMHFFSFK---DAMVFAFAPPSVLELGNATGFDLFLQDQAGVGHEVLLQARNKFLML
2j8sC           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2j8sB           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2j8sA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
3d9bA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2v50A           GGENSVFELAKRAQMHFFSFK---DAMVFAF---APPSV--LTGFDLFLQDQAGVGHEVLLQARNKFLML
2i6wA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2dhhA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2gifB           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2gifA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2hqgA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2hqfA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2hqdA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2hqcA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
2v50D           GGENSVFELAKRAQMHFFSFK---DAMVFAF---APP---NATGFDLFLQDQAGVGHEVLLQARNKFLML
2v50E           GGENSVFELAKRAQMHFFSFK---DAMVFAF------------APDLFLQDQAGVGHEVLLQARNKFLML
1iwgA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLAE
2rddA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVEF------DFELIDQAGLGHEKLTQARNQLLAE
1t9wA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA
1t9uA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLAE
1t9tA           GEENKVEAITMRATRAFSQIK---DAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLEA


                         .         .         .         .         +         .         .:770
query           AKADPVFAEVRATAGQPVPALDLAIDYRKAESFGVDTEAIHHALAATLGSRYIDELARDGRVRRVILQAD
2v50B           AAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAWGSSYVNDFIDRGRVKRVYLQGR
2j8sC           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2j8sB           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2j8sA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
3d9bA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2v50A           AAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAWGSSYVNDFIDRGRVKRVYLQGR
2i6wA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2dhhA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2gifB           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2gifA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2hqgA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2hqfA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2hqdA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2hqcA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2v50D           AAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAWGSSYVNDFIDRGRVKRVYLQGR
2v50E           AAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAWGSSYVNDFIDRGRVKRVYLQGR
1iwgA           AAKHPMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
2rddA           AAKHPDM--VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
1t9wA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
1t9uA           AAKHPMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
1t9tA           AKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE


                         .         .         *         .         .         .         .:840
query           APFRMQPEDLARLHVRNAQGQMVSLGAFATLEWGNGEATLERYNGLISVRINADVAPGTSTGTAMTRLES
2v50B           PDARMNPDDLSKWYVRNDKGEMVPFNAFATGKWEYGSPKLERYNGVPAMEILGEPAPGLSSGDAMAAVEE
2j8sC           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2j8sB           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2j8sA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
3d9bA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2v50A           PDARMNPDDLSKWYVRNDKGEMVPFNAFATGKWEYGSPKLERYNGVPAMEILGEPAPGLSSGDAMAAVEE
2i6wA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2dhhA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2gifB           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2gifA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2hqgA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2hqfA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2hqdA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2hqcA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2v50D           PDARMNPDDLSKWYVRNDKGEMVPFNAFATGKWEYGSPKLERYNGVPAMEILGEPAPGLSSGDAMAAVEE
2v50E           PDARMNPDDLSKWYVRNDKGEMVPFNAFATGKWEYGSPKLERYNGVPAMEILGEPAPGLSSGDAMAAVEE
1iwgA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
2rddA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
1t9wA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
1t9uA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
1t9tA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ


                         +         .         .         .         .         *         .:910
query           LVRELGPDYEVRWSGRAFEQQQSGTQAPWLFALSMLFIFLCLVALYESWTLPLAVLAIVPAGLVGAASAV
2v50B           IVKQLPKGVGYSWTGLSYEERLSGSQAPALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAT
2j8sC           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2j8sB           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2j8sA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
3d9bA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2v50A           IVKQLPKGVGYSWTGLSYEERLSGSQAPALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAT
2i6wA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2dhhA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2gifB           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2gifA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2hqgA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2hqfA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2hqdA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2hqcA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2v50D           IVKQLPKGVGYSWTGLSYEERLSGSQAPALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAT
2v50E           IVKQLPKGVGYSWTGLSYEERLSGSQAPALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAT
1iwgA           LASKLPTGVGYDW---------SGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
2rddA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
1t9wA           LASKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
1t9uA           LASKLPTGVGYDWTG-SYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
1t9tA           LASKLPTGVGYDWTG-SYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA


                         .         .         .         +         .         .         .:980
query           WLRGLPNDVYFKVGVIVIMGLAAKNAILVVEYAEQLRRNGLEXXXXXXXXXXXXXXPVVMTSLAFILGVV
2v50B           SMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGIVEAAIEACRMRLRPIVMTSLAFILGVV
2j8sC           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2j8sB           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2j8sA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
3d9bA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2v50A           SMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGIVEAAIEACRMRLRPIVMTSLAFILGVV
2i6wA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2dhhA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2gifB           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2gifA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2hqgA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMASLAFILGVM
2hqfA           TFRGLTNDVYFQVGLLTTIGLSAANAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2hqdA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2hqcA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2v50D           SMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGIVEAAIEACRMRLRPIVMTSLAFILGVV
2v50E           SMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGIVEAAIEACRMRLRPIVMTSLAFILGVV
1iwgA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
2rddA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
1t9wA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
1t9uA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM
1t9tA           TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMKEGKGLIEATLDAVRMRLRPILMTSLAFILGVM


                         .         *         .         .         .         .         +:1050
query           PLAISTGPGAGAQRAVGTGVLGGMLGATILGTLVIPLLYAWIAxxxxxxxxxxxxxxxxxxxxx
2v50B           PLAISTGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYVAVS---------------------
2j8sC           PLVISTGAGSGAQ---------------------------------------------------
2j8sB           PLVISTGAGSGAQ---------------------------------------------------
2j8sA           PLVISTGAGSGAQ---------------------------------------------------
3d9bA           PLVISTGAGSGAQ---------------------------------------------------
2v50A           PLAISTGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFY-------------------------
2i6wA           PLVISTGAGSGAQ---------------------------------------------------
2dhhA           PLVISTGAGSGAQ---------------------------------------------------
2gifB           PLVISTGAGSGAQ---------------------------------------------------
2gifA           PLVISTGAGSGAQ---------------------------------------------------
2hqgA           PLVISTGAGSGAQ---------------------------------------------------
2hqfA           PLVISTGAGSGAQ---------------------------------------------------
2hqdA           PLVISTGAGSGAQ---------------------------------------------------
2hqcA           PLVISTGAGSGAQ---------------------------------------------------
2v50D           PLAISTGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFY-------------------------
2v50E           PLAI------GSQHAIGTGVIGGMVTATVLAIFWVPLFYVAVS---------------------
1iwgA           PLVISTGAGSGAQ---------------------------------------------------
2rddA           PLVISTGAGSGAQ---------------------------------------------------
1t9wA           PLVISTGAGSGAQ---------------------------------------------------
1t9uA           PLVISTGAGSGAQ---------------------------------------------------
1t9tA           PLVISTGAGSGAQ---------------------------------------------------