[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF08055.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bqhA.bssp"
#ERROR : Can't open dsspfile "3bqeA.bssp"
#ERROR : Can't open dsspfile "3bqfA.bssp"
#ERROR : Can't open dsspfile "3bqgA.bssp"
#ERROR : Can't open dsspfile "2iemA.bssp"
#ERROR : Can't open dsspfile "2gt3A.bssp"
#ERROR : Can't open dsspfile "1ff3B.bssp"
#ERROR : Can't open dsspfile "1ff3A.bssp"
#ERROR : Can't open dsspfile "1nwaA.bssp"
#ERROR : Can't open dsspfile "2j89A.bssp"
#ERROR : Can't open dsspfile "1ff3C.bssp"
#ERROR : Can't open dsspfile "1fvaB.bssp"
#ERROR : Can't open dsspfile "1fvaA.bssp"
#ERROR : Can't open dsspfile "1fvgA.bssp"
#ERROR : Can't open dsspfile "3e0mC.bssp"
#ERROR : Can't open dsspfile "3e0mA.bssp"

## Summary of PDB Search
:243
    1e-35  44%  3bqhA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    1e-35  44%  3bqeA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    2e-34  43%  3bqfA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    3e-33  44%  3bqgA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    9e-33  46%  2iemA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA
    3e-32  46%  2gt3A  [x.x.x] METHIONINE SULFOXIDE REDUCTASE A
    7e-30  46%  1ff3B  [d.58.28] PEPTIDE METHIONINE SULFOXIDE REDUCTASE
    7e-30  46%  1ff3A  [d.58.28] PEPTIDE METHIONINE SULFOXIDE REDUCTASE
    2e-29  45%  1nwaA  [d.58.28] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA
    2e-28  42%  2j89A  [x.x.x] METHIONINE SULFOXIDE REDUCTASE A
    2e-28  45%  1ff3C  [d.58.28] PEPTIDE METHIONINE SULFOXIDE REDUCTASE
    1e-27  42%  1fvaB  [d.58.28] PEPTIDE METHIONINE SULFOXIDE REDUCTASE
    1e-27  42%  1fvaA  [d.58.28] PEPTIDE METHIONINE SULFOXIDE REDUCTASE
    8e-26  43%  1fvgA  [d.58.28] PEPTIDE METHIONINE SULFOXIDE REDUCTASE
    9e-25  35%  3e0mC  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    2e-24  36%  3e0mA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
:243

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHTETAVFAGGCFWG
3bqhA           --------------------------------------------------------NTRTIYLAGGCFWG
3bqeA           --------------------------------------------------------NTRTIYLAGGCFWG
3bqfA           --------------------------------------------------------NTRTIYLAGGSFWG
3bqgA           --------------------------------------------------------NTRTIYLAGG-FWG
2iemA           ----------------------------------------------------------EIAIFAMGCFWG
2gt3A           ----------------------------------------------------------EIAIFAMGCFWG
1ff3B           ----------------------------------------------------------EIAIFAMG-FWG
1ff3A           ----------------------------------------------------------EIAIFAMG-FWG
1nwaA           ----------------------------------------------------------QKAILAGGCFWG
2j89A           ------------------------------------------------------------AQFGAGCFWG
1ff3C           ----------------------------------------------------------EIAIFAMG-FWG
1fvaB           ---------------------------------------------------------TQMAVFGMGCFWG
1fvaA           ---------------------------------------------------------TQMAVFGMGCFWG
1fvgA           ------------------------------------------------------------AVF-GGCFWG
3e0mC           --------------------------------------------------------HMAEIYLAGGCFWG
3e0mA           ---------------------------------------------------------------AGGCFWG


                         .         .         *         .         .         .         .:140
query           VQGVFQHVRGVTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQISYGKLLQIFFSVAHNPTQL
3bqhA           LEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVV-DPTSL
3bqeA           LEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVV-DPTSL
3bqfA           LEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVV-DPTSL
3bqgA           LEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVV-DPTSL
2iemA           VERLFWQLPGVYSTAAGYTGGYTPNPTYREVSSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
2gt3A           VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
1ff3B           VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
1ff3A           VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
1nwaA           LQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGT----HAEAVEIIFDPTVTDYRTLLEFFFQI-HDPTTK
2j89A           VELAFQRVPGVTKTEVGYTQGLLHNPTYEDV-TGTTNHNEVVRVQYDPKECSFDTLIDVLWA-RHDPTTL
1ff3C           VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
1fvaB           AERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVFQPEHISFEELLKVFWE-NHDPTQG
1fvaA           AERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVFQPEHISFEELLKVFWE-NHDPTQG
1fvgA           AERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVFQPEHISFEELLKVFWE-NHDPTQ-
3e0mC           LEEYFSRISGVLETSVGYANGQVETTNYQLLKE--TDHAETVQVIYDEKEVSLREILLYYFRVI-DPLSI
3e0mA           LEEYFSRISGVLETSVGYANGQVETTNYQLLKE--TDHAETVQVIYDEKEVSLREILLYYFRVI-DPLSI


                         +         .         .         .         .         *         .:210
query           NYQGPDHGTQYRSAIFPRSPVQRSIAEAYITQLDTSKAYRAPIVTRVEDYKGFFPAENYHQDFLVKNPSY
3bqhA           NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKR--EQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPN-
3bqeA           NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKR--EQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPN-
3bqfA           NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKR--EQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPN-
3bqgA           NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKR--EQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNY
2iemA           MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP-Y
2gt3A           MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
1ff3B           MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
1ff3A           MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
1nwaA           DRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPN-
2j89A           NRQGNDVGTQYRSGIYYYTPEQEKAAKESLER--QQKLLNRKIVTEILPAKKFYRAEEYHQQYLAKGGRF
1ff3C           MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHK----
1fvaB           MRQGNDHGSQYRSAIYPTS--AEHVGAALKSKEDYQKVLSGLITTDIREGQTFYYAEDYHQQYLSKDP--
1fvaA           MRQGNDHGSQYRSAIYPTS--AEHVGAALKSKEDYQKVLSGLITTDIREGQTFYYAEDYHQQYLSKDP--
1fvgA           GRQGNDHGSQYRSAIYPTS--AEHVGAALKSKEDYQKVLSGLITTDIREGQTFYYAEDYHQQYLSKDP--
3e0mC           NQQGNDRGRQYRTGIYYQD--EADLPAIYTVVQEQERMLGRKIAVEVEQLRHYILAEDYHQDYLRKNPSY
3e0mA           NQQGNDRGRQYRTGIYYQD--EADLPAIYTVVQEQERMLGRKIAVEVEQLRHYILAEDYHQDYLRKNPSY


                         .         .         .         +         .         .         .:280
query           PYIVINDLPKxxxxxxxxxxxxxxxxxxxxxxx
3bqhA           ---------------------------------
3bqeA           ---------------------------------
3bqfA           ---------------------------------
3bqgA           SHIDI----------------------------
2iemA           GYCGIGGI-------------------------
2gt3A           ---------------------------------
1ff3B           ---------------------------------
1ff3A           ---------------------------------
1nwaA           ---------------------------------
2j89A           GFM------------------------------
1ff3C           ---------------------------------
1fvaB           ---------------------------------
1fvaA           ---------------------------------
1fvgA           ---------------------------------
3e0mC           CHIDVTDADK-----------------------
3e0mA           CHIDVTDADK-----------------------