[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF08099.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f76A.bssp"
#ERROR : Can't open dsspfile "2fqiA.bssp"
#ERROR : Can't open dsspfile "2prlA.bssp"
#ERROR : Can't open dsspfile "3g0xA.bssp"
#ERROR : Can't open dsspfile "2fpvA.bssp"
#ERROR : Can't open dsspfile "3fj6A.bssp"
#ERROR : Can't open dsspfile "1d3hA.bssp"
#ERROR : Can't open dsspfile "1tv5A.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "3i6rA.bssp"
#ERROR : Can't open dsspfile "3i68A.bssp"
#ERROR : Can't open dsspfile "1uuoA.bssp"
#ERROR : Can't open dsspfile "1uumA.bssp"
#ERROR : Can't open dsspfile "2prhA.bssp"
#ERROR : Can't open dsspfile "3i65A.bssp"
#ERROR : Can't open dsspfile "2b4gB.bssp"
#ERROR : Can't open dsspfile "2b4gA.bssp"
#ERROR : Can't open dsspfile "3c61A.bssp"
#ERROR : Can't open dsspfile "3c3nA.bssp"
#ERROR : Can't open dsspfile "2e68B.bssp"
#ERROR : Can't open dsspfile "2e68A.bssp"
#ERROR : Can't open dsspfile "2djxA.bssp"
#ERROR : Can't open dsspfile "2djlA.bssp"
#ERROR : Can't open dsspfile "1ep3A.bssp"
#ERROR : Can't open dsspfile "1ep1A.bssp"
#ERROR : Can't open dsspfile "1h7xB.bssp"
#ERROR : Can't open dsspfile "1h7xA.bssp"
#ERROR : Can't open dsspfile "1gteA.bssp"
#ERROR : Can't open dsspfile "1h7wD.bssp"
#ERROR : Can't open dsspfile "1h7wB.bssp"
#ERROR : Can't open dsspfile "1h7wA.bssp"
#ERROR : Can't open dsspfile "1gthC.bssp"
#ERROR : Can't open dsspfile "1gthB.bssp"
#ERROR : Can't open dsspfile "1gthA.bssp"
#ERROR : Can't open dsspfile "1gteD.bssp"
#ERROR : Can't open dsspfile "1gteC.bssp"
#ERROR : Can't open dsspfile "1gteB.bssp"
#ERROR : Can't open dsspfile "1gt8D.bssp"
#ERROR : Can't open dsspfile "1gt8C.bssp"
#ERROR : Can't open dsspfile "1gt8B.bssp"
#ERROR : Can't open dsspfile "1gt8A.bssp"
#ERROR : Can't open dsspfile "1ep2A.bssp"
#ERROR : Can't open dsspfile "2h6rB.bssp"

## Summary of PDB Search
:358
    3e-87  54%  1f76A  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    3e-58  44%  2fqiA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE, MITOCHONDRIAL
    5e-58  46%  2prlA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE, MITOCHONDRIAL
    5e-58  46%  3g0xA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    5e-58  46%  2fpvA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE, MITOCHONDRIAL
    5e-58  46%  3fj6A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    5e-58  46%  1d3hA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    9e-55  41%  1tv5A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE HOMOLOG,
    1e-54  46%  1d3gA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    5e-54  41%  3i6rA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE HOMOLOG,
    5e-54  41%  3i68A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE HOMOLOG,
    8e-54  47%  1uuoA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    7e-53  46%  1uumA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    2e-52  45%  2prhA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE, MITOCHONDRIAL
    2e-50  41%  3i65A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE HOMOLOG,
    7e-10  30%  2b4gB  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    7e-10  30%  2b4gA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    6e-09  28%  3c61A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-08  26%  3c3nA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-08  26%  2e68B  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-08  26%  2e68A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    3e-08  26%  2djxA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    3e-08  26%  2djlA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-07  29%  1ep3A  [c.1.4] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    1e-07  29%  1ep1A  [c.1.4] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    1e-06  27%  1h7xB  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    1e-06  27%  1h7xA  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    1e-06  26%  1gteA  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1h7wD  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1h7wB  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1h7wA  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1gthC  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1gthB  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1gthA  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1gteD  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1gteC  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1gteB  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1gt8D  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1gt8C  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1gt8B  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    2e-06  28%  1gt8A  [a.1.2 - c.4.1 - c.3.1 - c.1.4 - d.58.1] DIHYDROPYRIMIDINE
    1e-05  28%  1ep2A  [c.1.4] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    8e-04  33%  2h6rB  [x.x.x] TRIOSEPHOSPHATE ISOMERASE
:358

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGLAGCIGNSIADDPRTVMGVR
1f76A           -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNC-GLT
2fqiA           -----------------------------LDPESAHRL-------AVRFTSLGLLPRAFQDSDMLVLGHK
2prlA           -----------------------------------------------------------------VLGHK
3g0xA           -----------------------------------------------------------------VLGHK
2fpvA           -----------------------------------------------------------------VLGHK
3fj6A           -----------------------------------------------------------------VLGHK
1d3hA           -----------------------------------------------------------------VLGHK
1tv5A           ----------------------------------------------------------------------
1d3gA           -----------------------------------------------------------------VLGHK
3i6rA           ----------------------------------------------------------------------
3i68A           ----------------------------------------------------------------------
1uuoA           -----------------------------------------------------------------VLGHK
1uumA           -----------------------------------------------------------------VLGHK
2prhA           -----------------------------------------------------------------VLGHK
3i65A           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
2b4gA           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3c3nA           ----------------------------------------------------------------------
2e68B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
2djxA           ----------------------------------------------------------------------
2djlA           ----------------------------------------------------------------------
1ep3A           ----------------------------------------------------------------------
1ep1A           ----------------------------------------------------------------------
1h7xB           ----------------------------------------------------------------------
1h7xA           ----------------------------------------------------------------------
1gteA           ----------------------------------------------------------------------
1h7wD           ----------------------------------------------------------------------
1h7wB           ----------------------------------------------------------------------
1h7wA           ----------------------------------------------------------------------
1gthC           ----------------------------------------------------------------------
1gthB           ----------------------------------------------------------------------
1gthA           ----------------------------------------------------------------------
1gteD           ----------------------------------------------------------------------
1gteC           ----------------------------------------------------------------------
1gteB           ----------------------------------------------------------------------
1gt8D           ----------------------------------------------------------------------
1gt8C           ----------------------------------------------------------------------
1gt8B           ----------------------------------------------------------------------
1gt8A           ----------------------------------------------------------------------
1ep2A           ----------------------------------------------------------------------
2h6rB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
1f76A           FKNPLGLAAGLDKDGECIDALGA-GFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINR-GFNNLGVDNL
2fqiA           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
2prlA           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
3g0xA           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
2fpvA           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
3fj6A           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
1d3hA           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
1tv5A           FINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKV
1d3gA           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
3i6rA           FINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKV
3i68A           FINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKV
1uuoA           FRNPVGIAAGFDKNGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVX
1uumA           FRNPVGIAAGFDKNGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVX
2prhA           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
3i65A           FINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKV
2b4gB           --------------------------------TLAPRT--GNPEPRYFGLPLGS--INSMGLPNLGVDFY
2b4gA           --------------------------------TLAPRT--GNPEPRYFGLPLGS--INSMGLPNLGVDFY
3c61A           FMNAAGVMCSTTED---LVAMTESASGSLVSKSCTPALREGNPTPRYRALPLGS--INSMGLPNNGFDFY
3c3nA           FMNAAGVLCSTEED---LRCMTASSSGALVSKSCTSAPRDGNPEPRYMAVPLGS--INSMGLPNLGFDFY
2e68B           FMNAAGVLCSTEED---LRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGS--INSMGLPNLGFDFY
2e68A           FMNAAGVLCSTEED---LRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGS--INSMGLPNLGFDFY
2djxA           FMNAAGVLCCTEED---LRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGS--INSMGLPNLGFDFY
2djlA           FMNAAGVLCCTEED---LRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGS--INSMGLPNLGFDFY
1ep3A           ---------GLDLKNPIIPASGCFGFGMVKATTLHPRF--GNPTPRVAET--ASGMLNAIGLQNPGLEVI
1ep1A           ---------GLDLKNPIIPASGCFGFGMVKATTLHPRF--GNPTPRVAET--ASGMLNAIGLQNPGLEVI
1h7xB           ----------------------------------------------------------------------
1h7xA           ----------------------------------------------------------------------
1gteA           ----------------------------------------------------------------------
1h7wD           ----------------------------------------------------------------------
1h7wB           ----------------------------------------------------------------------
1h7wA           ----------------------------------------------------------------------
1gthC           ----------------------------------------------------------------------
1gthB           ----------------------------------------------------------------------
1gthA           ----------------------------------------------------------------------
1gteD           ----------------------------------------------------------------------
1gteC           ----------------------------------------------------------------------
1gteB           ----------------------------------------------------------------------
1gt8D           ----------------------------------------------------------------------
1gt8C           ----------------------------------------------------------------------
1gt8B           ----------------------------------------------------------------------
1gt8A           ----------------------------------------------------------------------
1ep2A           ---------GLDLKNPIIPASGCFGFGMVKATTLHPRF--GNPTPRVAET--ASGMLNAIGLQNPGLEVI
2h6rB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IRNVQASRWKAEGGVLGLNIGKNADTPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASEL
1f76A           VENVKKAHYD---GVLGINIGKNKDTPVEQGKDDYLIC-EKXXXXXXXXXXNISSPNTPGLRTLQYGEAL
2fqiA           EHRLRARQQKEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL
2prlA           EHRLRARQQKEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL
3g0xA           EHRLRARQQKEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL
2fpvA           EHRLRARQQKEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL
3fj6A           EHRLRARQQKEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL
1d3hA           EHRLRARQQKEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL
1tv5A           TENLILFRKRQEEDIVGVSIGKNKDT--VNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKL
1d3gA           EHRLRARQQKEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGL----GKAEL
3i6rA           TENLILFRKRQEEDIVGVSIGKNKDT--VNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKL
3i68A           TENLILFRKRQEEDIVGVSIGKNKDT--VNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKL
1uuoA           XXXXXXXXXTADGLPLGINLGKNKTS--EDAAADYAEGVRTLGPLADYLVVNVSSP--------QGKTEL
1uumA           XXXXXXXXXTADGLPLGINLGKNKTS--EDAAADYAEGVRTLGPLADYLVVNVSS---------QGKTEL
2prhA           EHRLRARQQKEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPGKAELRRL------
3i65A           TENLILFRKRQEEDIVGVSIGKNKDT--VNIVDDLKYCINKIGRYADYIAINVSSPNLKNI-ILSVKEEI
2b4gB           LSYAAQTHDYSRKPLFLSMSGLSVEESVEMVKKLVPITKEK----GTILELNLSCPN------VPGKPQV
2b4gA           LSYAAQTHDYSRKPLFLSMSGLSVEESVEMVKKLVPITKEK----GTILELNLSCPN------VPGKPQV
3c61A           LAYAAEQRKPLFLSMSGLSVRENVEMCKRLAA----VATEK----GVILELNLSCPNVPGKPQV--AYDF
3c3nA           LKYASDSKKPLFLSISGLSVEEN------------VAMVRRLAPVAQLLELNLSCPNVPGKPQV--AYDF
2e68B           LKYASDSKKPLFLSISGLSVEEN------------VAMVRRLAPVAQLLELNLSCPNVPGKPQV--AYDF
2e68A           LKYASDSKKPLFLSISGLSVEEN------------VAMVRRLAPVAQLLELNLSCPNVPGKPQV--AYDF
2djxA           LKYASDSKKPLFLSISGLSVEEN------------VAMVRRLAPVAQLLELNLSCPNVPGKPQV--AYDF
2djlA           LKYASDSKKPLFLSISGLSVEEN------------VAMVRRLAPVAQLLELNLSCPNVPGKPQV--AYDF
1ep3A           M--TEKLPWLNEN-FPELPIIANVAGSEEA---DYVAVCAKIGDAANVIELNISCPNVKHGGQAFGTDPE
1ep1A           M--TEKLPWLNEN-FPELPIIANVAGSEEA---DYVAVCAKIGDAANVIELNISCPNVKHGGQAFGTDPE
1h7xB           ---------------------------------------------ADALELNLSAPHGMGERGMGLACGQ
1h7xA           ---------------------------------------------ADALELNLSAPHGMGERGMGLACGQ
1gteA           ---------------------------------------------ADALELNLSCPHGMGLACGQDPELV
1h7wD           ----------------------------------------------------------------------
1h7wB           ----------------------------------------------------------------------
1h7wA           ----------------------------------------------------------------------
1gthC           ----------------------------------------------------------------------
1gthB           ----------------------------------------------------------------------
1gthA           ----------------------------------------------------------------------
1gteD           ----------------------------------------------------------------------
1gteC           ----------------------------------------------------------------------
1gteB           ----------------------------------------------------------------------
1gt8D           ----------------------------------------------------------------------
1gt8C           ----------------------------------------------------------------------
1gt8B           ----------------------------------------------------------------------
1gt8A           ----------------------------------------------------------------------
1ep2A           M--TEKLPWLNEN-FPELPIIANVAGSEEA---DYVAVCAKIGDAANVIELNISCPNGQAFGT-------
2h6rB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DSLLSTLKAAQQRLADQHKRYVPVALKIAPDLDDDQVRNIGDALVRHKIDGVIATNTTISRDAVKGLPHA
1f76A           DDLLTAIKNKQNDLQAHHK-YVPIAVKIAPDLSEEELIQVADSLVRHNIDGVIATNTTLDRSLVQG-KNC
2fqiA           RRLLT--KVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA--GLQGA
2prlA           RRLLT--KVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA--GLQGA
3g0xA           RRLLT--KVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA--GLQGA
2fpvA           RRLLT--KVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA--GLQGA
3fj6A           RRLLT--KVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA--GLQGA
1d3hA           RRLLT--KVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA--GLQGA
1tv5A           KNIILSVKEEIDNLENTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFEN-
1d3gA           RRLLT--KVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA--GLQGA
3i6rA           KNIILSVKEEIDNLEKNNKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFEN-
3i68A           KNIILSVKEEIDNLEKNNKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFEN-
1uuoA           RHLLS--KVLQERDALKGTRKPAVLVKIAPDLTAQDKEDIASVARELGIDGLIVTNTTVSRPV--GLQGA
1uumA           RHLLS--KVLQERDALKGTRKPAVLVKIAPDLTAQDKEDIASVARELGIDGLIVTNTTVSRPV--GLQGA
2prhA           -----LTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA--GLQGA
3i65A           DNLKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFEN-
2b4gB           GYDFDTTRTYLQKVSEAYG--LPFGVKMPPYFDIAHVNSIGNGLV------IDPANETVVIKPKQGF---
2b4gA           GYDFDTTRTYLQKVSEAYG--LPFGVKMPPYFDIAHVNSIGNGLV------IDPANETVVIKPKQGF---
3c61A           DAMRQCLTAVSEVYPHSFGVKMPAAAEILNEFPQVQINSIGNGLV------IDAETESVVIKPKQGF---
3c3nA           EAMRTYLQQVSLAYG------LPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDIKPK
2e68B           EAMRTYLQQVSLAYG------LPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDIKPK
2e68A           EAMRTYLQQVSLAYG------LPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDIKPK
2djxA           EAMRTYLQQVSLAYG------LPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDIKPK
2djlA           EAMRTYLQQVSLAYG------LPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDIKPK
1ep3A           XXXXXXXXXXXXXXX-------PLYVKLSPNVTD--IVPIAKAVEAAGADGLTMINTLVRFDLKTRQPIA
1ep1A           XXXXXXXXXXXXXXX-------PLYVKLSPNVTD--IVPIAKAVEAAGADGLTMINTLVRFDLKTRQPIA
1h7xB           DPELVRNICRWVRQAVQ----IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1h7xA           DPELVRNICRWVRQAVQ----IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gteA           RNICRWVRQAVQ---------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1h7wD           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1h7wB           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1h7wA           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gthC           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gthB           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gthA           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gteD           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gteC           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gteB           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gt8D           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gt8C           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gt8B           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1gt8A           ---------------------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1ep2A           ----DPEXXXXXXXXXXXXXXXPLYVKLSPNVTD--IVPIAKAVEAAGADGLTMINTLVRFDLKTRQPIA
2h6rB           ------------------------------------------------LETIVCTNNINTSKAVAALSPA


                         .         *         .         .         .         .         +:350
query           EEAGGLSGRPVFEASTRVVRALREVIGDALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTLVR
1f76A           DQTGGLSGRPLQLKSTEIIRRLSLELNGRLPIIGVGGIDSVIAAREKIAAGASLVQIYSGFIFKGPPLIK
2fqiA           SETGGLSGKPLRDLSTQTIREMYALTQGRVPXXXXXXXXXXQDALEKIRAGASLVQLYTALTFWGPPVV-
2prlA           SETGGLSGKPLRDLSTQTIREMYALTQGRVPXXXXXXXXXXQDALEKIRAGASLVQLYTALTFWGPPVV-
3g0xA           SETGGLSGKPLRDLSTQTIREMYALTQGRVPXXXXXXXXXXQDALEKIRAGASLVQLYTALTFWGPPVV-
2fpvA           SETGGLSGKPLRDLSTQTIREMYALTQGRVPXXXXXXXXXXQDALEKIRAGASLVQLYTALTFWGPPVV-
3fj6A           SETGGLSGKPLRDLSTQTIREMYALTQGRVPXXXXXXXXXXQDALEKIRAGASLVQLYTALTFWGPPVV-
1d3hA           SETGGLSGKPLRDLSTQTIREMYALTQGRVPXXXXXXXXXXQDALEKIRAGASLVQLYTALTFWGPPVV-
1tv5A           -KKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNG-----
1d3gA           SETGGLSGKPLRDLSTQTIREMYALTQGRVPXXXXXXXXXXQDALEKIRAGASLVQLYTALTFWGPPVV-
3i6rA           -KKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNG-----
3i68A           -KKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNG-----
1uuoA           SETGGLSGKPLRDLSTQTIREMYALTQGRIPXXXXXXXXXXQDALEKIQAGASLVQLYTALIFLGPPVV-
1uumA           SETGGLSGKPLRDLSTQTIREMYALTQGRIPXXXXXXXXXXQDALEKIQAGASLVQLYTALIFLGPPVV-
2prhA           SETGGLSGKPLRDLSTQTIREMYALTQGRVPXXXXXXXXXXQDALEKIRAGASLVQLYTALTFWGPPVV-
3i65A           -KKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNG-----
2b4gB           ---GGLGGKYVLPTALANVNAFFRRCPDKL-VFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPII--
2b4gA           ---GGLGGKYVLPTALANVNAFFRRCPDKL-VFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPII--
3c61A           ---GGLGGRYVLPTALANVNAFYRRCPGKL-IFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGPAIFE
3c3nA           QGFGGLGGKYILPTALANVNAFYRRCPDKL-VFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGP----
2e68B           QGFGGLGGKYILPTALANVNAFYRRCPDKL-VFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGP----
2e68A           QGFGGLGGKYILPTALANVNAFYRRCPDKL-VFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGP----
2djxA           QGFGGLGGKYILPTALANVNAFYRRCPDKL-VFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGP----
2djlA           QGFGGLGGKYILPTALANVNAFYRRCPDKL-VFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGP----
1ep3A           NITGGLSGPAIKPVALKLIHQVAQDVD--IPIIGMGGVANAQDVLEMYMAGASAVAV-------------
1ep1A           NITGGLSGPAIKPVALKLIHQVAQDVD--IPIIGMGGVANAQDVLEMYMAGASAVAV-------------
1h7xB           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1h7xA           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gteA           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1h7wD           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1h7wB           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1h7wA           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gthC           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gthB           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gthA           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gteD           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gteC           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gteB           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gt8D           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gt8C           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gt8B           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1gt8A           TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1ep2A           NITGGLSGPAIKPVALKLIHQVAQDVD--IPIIGMGGVANAQDVLEMYMAGASAVAV-------------
2h6rB           VEPPELIANP--EVVEGTVRAVKEINKDVKVLCGAG-ISKGEDVKAALDLGAEGVLLASGVV--------


                         .         .         .         .         *         .         .:420
query           ECASALRx
1f76A           E-------
2fqiA           --------
2prlA           --------
3g0xA           --------
2fpvA           --------
3fj6A           --------
1d3hA           --------
1tv5A           --------
1d3gA           --------
3i6rA           --------
3i68A           --------
1uuoA           --------
1uumA           --------
2prhA           --------
3i65A           --------
2b4gB           --------
2b4gA           --------
3c61A           RLTAEL--
3c3nA           --------
2e68B           --------
2e68A           --------
2djxA           --------
2djlA           --------
1ep3A           --------
1ep1A           --------
1h7xB           DYCTGLK-
1h7xA           DYCTGLK-
1gteA           DYCTGLK-
1h7wD           DYCTGLK-
1h7wB           DYCTGLK-
1h7wA           DYCTGLK-
1gthC           DYCTGLK-
1gthB           DYCTGLK-
1gthA           DYCTGLK-
1gteD           DYCTGLK-
1gteC           DYCTGLK-
1gteB           DYCTGLK-
1gt8D           DYCTGLK-
1gt8C           DYCTGLK-
1gt8B           DYCTGLK-
1gt8A           DYCTGLK-
1ep2A           --------
2h6rB           --------