[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF08260.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d31C.bssp"
#ERROR : Can't open dsspfile "2onkC.bssp"
#ERROR : Can't open dsspfile "2r6gG.bssp"
#ERROR : Can't open dsspfile "3fh6G.bssp"

## Summary of PDB Search
:305
    9e-22  31%  3d31C  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, PERMEASE
    3e-20  30%  2onkC  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE
    5e-04  32%  2r6gG  [x.x.x] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    5e-04  32%  3fh6G  [x.x.x] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
:305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSVFYEALRKGVD
3d31C           ----------------------------------------------------------NMIFEQITEDFS
2onkC           ---------------------------------------------------------------------D
2r6gG           ----------------------------------------------------------------------
3fh6G           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TYLAALTEPDAVSAIKLTLTVAAIAVPLNVVFGVAAAWAIAKFDFRGKNLLITLIDLPFSVSPVISGLIY
3d31C           GLVKAAGNRSVISSIFLSXXXXXXXXXXXXXXXXPTGYILARFDFPGKRLVESIIDVPVVVPHTVAGIAL
2onkC           EFLKAASDPAVWKVVLTTYYAALISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIAL
2r6gG           -----------------SVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGM-LIFQMFPAVLSLVA
3fh6G           -----------------SVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGM-LIFQMFPAVLSLVA


                         +         .         .         .         .         *         .:210
query           VLMFGAQGWFGPWLEAHDIKIMFAVPGIVLATIFVTFPFVARELIPLMQAQGSEEEEAAIVLGASGWQTF
3d31C           LTVFGSRGLIGEPLESY-IQFRDALPGIVVAMLFVSMPYLANSAREGFKSVDPRLENAARSLGAPLWKAF
2onkC           LVVFGSSGLIGSF---SPLKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVF
2r6gG           LYLFDRLGEYIPFLNTHGGVIFAYLGGIALHVWTIKGYF---------ETIDSSLEEAAALDGATPWQAF
3fh6G           LYLFDRLGEYIPFLNTHGGVIFAYLGGIALHVWTIKGYF---------ETIDSSLEEAAALDGATPWQAF


                         .         .         .         +         .         .         .:280
query           WHVTLPNIRWGLLYGVILCNARAMGEFGAVSVVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d31C           FFVTLPLSARYLLIGSVMTWARAISEFGAVVILA------------------------------------
2onkC           FTVSLPLSVRHIVAGAIMSWARGISEFGAVVVIA------------------------------------
2r6gG           RLVLLP----------------------------------------------------------------
3fh6G           RLVLLP----------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxx
3d31C           -------------------------
2onkC           -------------------------
2r6gG           -------------------------
3fh6G           -------------------------