[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF08451.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d06A.bssp"
#ERROR : Can't open dsspfile "1s66U.bssp"
#ERROR : Can't open dsspfile "1s66L.bssp"
#ERROR : Can't open dsspfile "1vb6A.bssp"
#ERROR : Can't open dsspfile "1v9zA.bssp"
#ERROR : Can't open dsspfile "1vb6B.bssp"
#ERROR : Can't open dsspfile "2cmnA.bssp"
#ERROR : Can't open dsspfile "1y28A.bssp"
#ERROR : Can't open dsspfile "1v9yA.bssp"
#ERROR : Can't open dsspfile "1xj4B.bssp"
#ERROR : Can't open dsspfile "2vv6A.bssp"
#ERROR : Can't open dsspfile "1drmA.bssp"
#ERROR : Can't open dsspfile "1xj6A.bssp"
#ERROR : Can't open dsspfile "1xj4A.bssp"
#ERROR : Can't open dsspfile "1xj3A.bssp"
#ERROR : Can't open dsspfile "2vv6C.bssp"
#ERROR : Can't open dsspfile "1lt0A.bssp"
#ERROR : Can't open dsspfile "1lsvA.bssp"
#ERROR : Can't open dsspfile "1dp8A.bssp"

## Summary of PDB Search
:139
    4e-11  35%  1d06A  [d.110.3] NITROGEN FIXATION REGULATORY PROTEIN FIXL
    1e-09  29%  1s66U  [d.110.3] HYPOTHETICAL PROTEIN YDDU
    1e-09  29%  1s66L  [d.110.3] HYPOTHETICAL PROTEIN YDDU
    2e-09  30%  1vb6A  [x.x.x] HEME PAS SENSOR PROTEIN
    2e-09  30%  1v9zA  [d.110.3] HEME PAS SENSOR PROTEIN
    1e-06  31%  1vb6B  [x.x.x] HEME PAS SENSOR PROTEIN
    7e-06  30%  2cmnA  [x.x.x] SENSOR PROTEIN FIXL
    2e-05  28%  1y28A  [d.110.3] SENSOR PROTEIN FIXL
    2e-05  33%  1v9yA  [d.110.3] HEME PAS SENSOR PROTEIN
    2e-05  28%  1xj4B  [x.x.x] SENSOR PROTEIN FIXL
    2e-05  28%  2vv6A  [x.x.x] SENSOR PROTEIN FIXL
    2e-05  28%  1drmA  [d.110.3] SENSOR PROTEIN FIXL
    3e-05  29%  1xj6A  [x.x.x] SENSOR PROTEIN FIXL
    3e-05  29%  1xj4A  [x.x.x] SENSOR PROTEIN FIXL
    3e-05  29%  1xj3A  [d.110.3 (1dp6A)] SENSOR PROTEIN FIXL
    3e-05  29%  2vv6C  [x.x.x] SENSOR PROTEIN FIXL
    3e-05  29%  1lt0A  [d.110.3] SENSOR PROTEIN FIXL
    3e-05  29%  1lsvA  [d.110.3] SENSOR PROTEIN FIXL
    3e-05  29%  1dp8A  [d.110.3] FIXL PROTEIN
:139

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAA
1d06A           ----------ILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRY
1s66U           -----------LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHN
1s66L           -----------LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHN
1vb6A           -----------LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHN
1v9zA           -----------LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHN
1vb6B           -----------LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHN
2cmnA           ----------------DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISAY
1y28A           --------------IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
1v9yA           -----------LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAH-------
1xj4B           --------------IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
2vv6A           --------------IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
1drmA           --------------IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
1xj6A           ----------------DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
1xj4A           ----------------DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
1xj3A           ----------------DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
2vv6C           ----------------DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
1lt0A           ----------------DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
1lsvA           ----------------DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
1dp8A           ----------------DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY


                         .         .         *         .         .         .         .:140
query           IDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARDVTxxxxxxxxxxxxxxxxx
1d06A           MATGEKRIIGIDRVVSGQRKDG-----------------------------------------------
1s66U           REGGKARVEGMSRELQLEKKDGSKIWTRFALSKVS-AEGKVY-YLALVRDAS-----------------
1s66L           REGGKARVEGMSRELQLEKKDGSKIWTRFALSKVS-AEGKVY-YLALVRDAS-----------------
1vb6A           REGGKARVEGMSRELQLEKKDGSKIWTRFALSKVS-AEGKVY-YLALVRD-------------------
1v9zA           REGGKARVEGMSRELQLEKKDGSKIWTRFALSKVS-AEGKVY-YLALVRD-------------------
1vb6B           REGGE-GMSRELQLEK---KDGSKIWTRFALSKVS-AEGKVY-YLALVRD-------------------
2cmnA           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
1y28A           RTTSDPHIIGIGAIVTGKRRDG-----------------------------------------------
1v9yA           ---------------------------------------------------------------------
1xj4B           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
2vv6A           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
1drmA           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
1xj6A           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
1xj4A           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
1xj3A           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
2vv6C           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
1lt0A           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
1lsvA           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
1dp8A           RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------