[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF08608.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pt8A.bssp"
#ERROR : Can't open dsspfile "1q6yA.bssp"
#ERROR : Can't open dsspfile "2vjpA.bssp"
#ERROR : Can't open dsspfile "1pt7A.bssp"
#ERROR : Can't open dsspfile "2vjoA.bssp"
#ERROR : Can't open dsspfile "1p5hA.bssp"
#ERROR : Can't open dsspfile "2vjnA.bssp"
#ERROR : Can't open dsspfile "2vjkA.bssp"
#ERROR : Can't open dsspfile "2vjqA.bssp"
#ERROR : Can't open dsspfile "1vgrA.bssp"
#ERROR : Can't open dsspfile "1t3zA.bssp"
#ERROR : Can't open dsspfile "1vgqA.bssp"
#ERROR : Can't open dsspfile "2vjmB.bssp"
#ERROR : Can't open dsspfile "1pqyA.bssp"
#ERROR : Can't open dsspfile "1q7eA.bssp"
#ERROR : Can't open dsspfile "1x74A.bssp"
#ERROR : Can't open dsspfile "1xvuA.bssp"
#ERROR : Can't open dsspfile "2g04A.bssp"
#ERROR : Can't open dsspfile "1xk7A.bssp"
#ERROR : Can't open dsspfile "1xk6A.bssp"
#ERROR : Can't open dsspfile "1xa3A.bssp"

## Summary of PDB Search
:405
    2e-29  33%  1pt8A  [c.123.1] HYPOTHETICAL PROTEIN YFDW
    5e-29  32%  1q6yA  [c.123.1] HYPOTHETICAL PROTEIN YFDW
    6e-29  36%  2vjpA  [x.x.x] FORMYL-COENZYME A TRANSFERASE
    8e-29  33%  1pt7A  [c.123.1] HYPOTHETICAL PROTEIN YFDW
    1e-28  36%  2vjoA  [x.x.x] FORMYL-COENZYME A TRANSFERASE
    2e-28  36%  1p5hA  [c.123.1] FORMYL-COENZYME A TRANSFERASE
    2e-28  36%  2vjnA  [x.x.x] FORMYL-COENZYME A TRANSFERASE
    2e-28  36%  2vjkA  [c.123.1 (1t4cA)] FORMYL-COENZYME A TRANSFERASE
    3e-28  35%  2vjqA  [x.x.x] FORMYL-COENZYME A TRANSFERASE
    7e-28  36%  1vgrA  [c.123.1] FORMYL-COENZYME A TRANSFERASE
    1e-27  36%  1t3zA  [c.123.1] FORMYL-COENZYME A TRANSFERASE
    2e-27  36%  1vgqA  [c.123.1] FORMYL-COENZYME A TRANSFERASE
    4e-27  37%  2vjmB  [c.123.1 (1t4cB)] FORMYL-COENZYME A TRANSFERASE
    6e-21  34%  1pqyA  [c.123.1] HYPOTHETICAL PROTEIN YFDW
    1e-19  33%  1q7eA  [c.123.1] HYPOTHETICAL PROTEIN YFDW
    9e-19  31%  1x74A  [x.x.x] 2-METHYLACYL-COA RACEMASE
    3e-17  22%  1xvuA  [x.x.x] CROTONOBETAINYL-COA:CARNITINE COA-TRANSFERASE
    7e-17  31%  2g04A  [x.x.x] PROBABLE FATTY-ACID-COA RACEMASE FAR
    4e-14  24%  1xk7A  [x.x.x] CROTONOBETAINYL-COA:CARNITINE COA-TRANSFERASE
    4e-14  24%  1xk6A  [x.x.x] CROTONOBETAINYL-COA:CARNITINE COA-TRANSFERASE
    4e-14  24%  1xa3A  [c.123.1] CROTONOBETAINYL-COA:CARNITINE COA-TRANSFERASE
:405

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSAILQGIKVLDLTRVVAGPWATQNLADMGATVYKIEKPGDGDDTRRMGPFLTDGDGNVTNDSAFFLCCN
1pt8A           MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
1q6yA           LSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
2vjpA           ----LDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRG---FLQDKP-NV--DSLYFTMFN
1pt7A           -STPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
2vjoA           ----LDGINVLDFTHVAAGPACTQMMGFLGANVIKIERRGSGDMTRG---WLQDKP-NV--DSLYFTMFN
1p5hA           ----LDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRG---WLQDKP-NV--DSLYFTMFN
2vjnA           ----LDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRG---WLQDKP-NV--DSLYFTMFN
2vjkA           ----LDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRG---WLQDKP-NV--DSLYFTMFN
2vjqA           ----LDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGQ----LQDKPNV--DSLYFTMFN
1vgrA           ----LDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRG---WLQDKP-NV--DSLYFTMFN
1t3zA           ----LDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRG---WLQDKP-NV--DSLYFTMFN
1vgqA           ----LDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRG---WLQDKP-NV--DSLYFTMFN
2vjmB           ----LDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRG---WLQDKP-NV--DSLYFTMFN
1pqyA           LSTPLQGIKVLDFTGVQSGPSCTQ-LAWFGADVIKIERPGVGDVTRHQLRDIPDID-------ALYFTLN
1q7eA           LSTPLQGIKVLDFTGVQSGPSCTQ-LAWFGADVIKIERPGVGDVTRHQLRDIPDID-------ALYFTLN
1x74A           ----LSGLRVVELAGIGPGPHAAMILGDLGADVVRIDRP-------------------ISRDAML-----
1xvuA           ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
2g04A           ----LAGVKVIELGGIGPGPHAGMVLADLGADVVRVRRPG-----------------GLTMPSEDRDLLH
1xk7A           ----LAGLRVVFSGIEIAGPFAGQ-FAEWGAEVIWIENVAWAD-TIRVQPNYPQ-------------LSR
1xk6A           ----LAGLRVVFSGIEIAGPFAGQ-FAEWGAEVIWIENVAWAD-TIRVQPNYPQ-------------LSR
1xa3A           ----LAGLRVVFSGIEIAGPFAGQ-FAEWGAEVIWIENVAWAD-TIRVQPNYPQ-------------LSR


                         .         .         *         .         .         .         .:140
query           RGKQSVTVDISQPEGAELVRQLASHCDVVVENYKAGSLKKYGLDYESIRALRPDIIYCSVTGFGPDGPYA
1pt8A           SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
1q6yA           SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
2vjpA           CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
1pt7A           SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
2vjoA           CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
1p5hA           CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
2vjnA           CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
2vjkA           CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
2vjqA           CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
1vgrA           CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
1t3zA           CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
1vgqA           CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
2vjmB           CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
1pqyA           SNKRSIELNTKTAEGKE-VEKLIREADILVENFHPG-----GFTWEHIQEINPRLIFGSIKGFDECSPYV
1q7eA           SNKRSIELNTKTAEGKE-VEKLIREADILVENF-------HPFTWEHIQEINPRLIFGSIKGFDECSPYV
1x74A           RNRRIVTADLKSDQGLELALKLIAKADVLIEGYRPGVTERLGLGPEECAKVNDRLIYARMTGWGQTGPRS
1xvuA           RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
2g04A           RGKRIVDLDVPQA-----MLELAAKADVLLDCFRPGTCERLGIGPDDCASVNPRLIFARITGWGQDGPLA
1xk7A           RNLHALSLNIFKDEGREAFLKLET-TDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGTYT
1xk6A           RNLHALSLNIFKDEGREAFLKLET-TDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGTYT
1xa3A           RNLHALSLNIFKDEGREAFLKLET-TDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGTYT


                         +         .         .         .         .         *         .:210
query           PRPAYDFILQGMAGLMSTCGQPDGTPGAAPMRTAIPLTDILTGLYASVALMGALYHRQATGEGQFXXXXX
1pt8A           NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
1q6yA           NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
2vjpA           HLKVYENVAQCSGGAAATTGFWDGPPTV----SGAALGDSNSGMHLMIGILAALEIRHKTGRGQ------
1pt7A           NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
2vjoA           HLKVYENVAQCSGGAAATTGFWDGPPTV----SGAALGDSNSGMHLMIGILAALEIRHKTGRGQ------
1p5hA           HLKVYENVAQCSGGAAATTGFWDGPPTV----SGAALGDSNSGMHLMIGILAALEMRHKTGRGQ------
2vjnA           HLKVYENVAQCSGGAAATTGFWDGPPTV----SGAALGDSNSGMHLMIGILAALEIRHKTGRGQ------
2vjkA           HLKVYENVAQCSGGAAATTGFWDGPPTV----SGAALGDSNSGMHLMIGILAALEIRHKTGRGQ------
2vjqA           HLKVYENVAQCSGGAAATTGFWDGPPTV----SGAALGDSNSGMHLMIGILAALEIRHKTGRGQ------
1vgrA           HLKVYENVAQCSGGAAATTGFWDGPPTV----SGAALGESNSGMHLMIGILAALEIRHKTGRGQ------
1t3zA           HLKVYENVAQCSGGAAATTGFWDGPPTV----SGAALGSSNSGMHLMIGILAALEIRHKTGRGQ------
1vgqA           HLKVYENVAQCSGGAAATTGFWDGPPTV----SGAALGASNSGMHLMIGILAALEIRHKTGRGQ------
2vjmB           HLKVYENVAQCSGGAAATTGFWDGPPGAA--------LGSNSGMHLMIGILAALEIRHKTGRGQ------
1pqyA           NVKAYENVXXXXXXXXSTTGFWDGPP--------------------------------------------
1q7eA           NVKAYENVXXXXXXXXSTTGFWDGPP--------------------------------------------
1x74A           QQAGHDINYISLNGILHAIGRGDERP-VPPLNL---VGDFGGGMFLLVGILAALWERQSSGKGQ------
1xvuA           NLPAYNTIAQAFSGYLIQNGDVDQPMPAFPYTAA-----YFSGXXXXXXXXXXXHKVRETGKGESIDIAM
2g04A           STAGHDINYLSQTGALAAFGYAD----RPPMPPLNLVADFGGGMLVLLGIVVALYERERSGVGQ------
1xk7A           NLPAYNTIAQAFSGYLIQNGDVDQPP-------AFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAY
1xk6A           NLPAYNTIAQAFSGYLIQNGDVDQPP-------AFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAY
1xa3A           NLPAYNTIAQAFSGYLIQNGDVDQPP-------AFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAY


                         .         .         .         +         .         .         .:280
query           XXXXXXXNGHLALGYHMTGKVPQRAGNSNPVASPSEVFACLDGHVIIAAGNNGQFAALCRVIGCASLIED
1pt8A           ----------------------------------------------------------CKAIGKPEWITD
1q6yA           ----------------------------------------------------------CKAIGKPEWITD
2vjpA           ----------------------------------------------------------------------
1pt7A           ----------------------------------------------------------CKAIGKPEWITD
2vjoA           ----------------------------------------------------------------------
1p5hA           ----------------------------------------------------------------------
2vjnA           ----------------------------------------------------------------------
2vjkA           ----------------------------------------------------------------------
2vjqA           ----------------------------------------------------------------------
1vgrA           ----------------------------------------------------------------------
1t3zA           ----------------------------------------------------------------------
1vgqA           ----------------------------------------------------------------------
2vjmB           ----------------------------------------------------------------------
1pqyA           ----------------------------------------------------------CKAIGKPEWITD
1q7eA           ----------------------------------------------------------CKAIGKPEWITD
1x74A           ----------------------------------------------------------------------
1xvuA           YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
2g04A           ----------------------------------------------------------------------
1xk7A           EVLRGQY-----FDYFNGGECPRSKGK-DPYYAGCGLYKCADGYIVELVGIT-QIEECFKDIGLAHLLGT
1xk6A           EVLRGQY-----FDYFNGGECPRSKGK-DPYYAGCGLYKCADGYIVELVGIT-QIEECFKDIGLAHLLGT
1xa3A           EVLRGQY-----FDYFNGGECPRSKGK-DPYYAGCGLYKCADGYIVELVGIT-QIEECFKDIGLAHLLGT


                         .         *         .         .         .         .         +:350
query           PRFLQNMDRVRNRPVLRETLGERLLNWRLADLIQALEGAGVPCGPINDIDDVFDDPQVRHRELLVRLPHG
1pt8A           PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
1q6yA           PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
2vjpA           ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
1pt7A           PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
2vjoA           ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
1p5hA           ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
2vjnA           ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
2vjkA           ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
2vjqA           ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
1vgrA           ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
1t3zA           ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
1vgqA           ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
2vjmB           ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
1pqyA           PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLS-KEISLDPSLRQSGSVVEVEQP
1q7eA           PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLS-KEISLDPSLRQSGSVVEVEQP
1x74A           ----------------------------------------------------------------------
1xvuA           PEIPEGTQLIHRGPLVEEKLDAWLATHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
2g04A           ----------------------------------------------------------------------
1xk7A           PEIPEGTQLIHRGPLVEEKLDAWLATHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQQTDG
1xk6A           PEIPEGTQLIHRGPLVEEKLDAWLATHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQQTDG
1xa3A           PEIPEGTQLIHRGPLVEEKLDAWLATHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQQTDG


                         .         .         .         .         *         .         .:420
query           SGVEAPTLRSPLRFSATPVTMTAPPQLGQHTEAALRSELGMSAADVEAFRERGVI
1pt8A           LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
1q6yA           LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
2vjpA           IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
1pt7A           LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
2vjoA           IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
1p5hA           IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
2vjnA           IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
2vjkA           IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
2vjqA           IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
1vgrA           IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
1t3zA           IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
1vgqA           IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
2vjmB           IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
1pqyA           LRGKYLTVGCP-KFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAKQNHAI-
1q7eA           LRGKYLTVGCP-KFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAKQNHAI-
1x74A           -------------------------------------------------------
1xvuA           DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
2g04A           -------------------------------------------------------
1xk7A           RTCKGPNIP---KFKNNPGQIWRGPSHGD--TAAILKNIGYSENDIQELVSKGL-
1xk6A           RTCKGPNIP---KFKNNPGQIWRGPSHGD--TAAILKNIGYSENDIQELVSKGL-
1xa3A           RTCKGPNIP---KFKNNPGQIWRGPSHGD--TAAILKNIGYSENDIQELVSKGL-