[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF08678.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3f6oB.bssp"
#ERROR : Can't open dsspfile "3f6oA.bssp"
#ERROR : Can't open dsspfile "2oqgC.bssp"
#ERROR : Can't open dsspfile "2oqgB.bssp"
#ERROR : Can't open dsspfile "2oqgA.bssp"
#ERROR : Can't open dsspfile "2p4wB.bssp"
#ERROR : Can't open dsspfile "2p4wA.bssp"
#ERROR : Can't open dsspfile "1xnpB.bssp"
#ERROR : Can't open dsspfile "1xnpA.bssp"
#ERROR : Can't open dsspfile "3f6vA.bssp"
#ERROR : Can't open dsspfile "2jscB.bssp"
#ERROR : Can't open dsspfile "2jscA.bssp"
#ERROR : Can't open dsspfile "2cweA.bssp"

## Summary of PDB Search
:121
    2e-21  47%  3f6oB  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, ARSR FAMILY
    2e-21  47%  3f6oA  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, ARSR FAMILY
    9e-10  30%  2oqgC  [x.x.x] POSSIBLE TRANSCRIPTIONAL REGULATOR, ARSR FAMILY
    9e-10  30%  2oqgB  [x.x.x] POSSIBLE TRANSCRIPTIONAL REGULATOR, ARSR FAMILY
    9e-10  30%  2oqgA  [x.x.x] POSSIBLE TRANSCRIPTIONAL REGULATOR, ARSR FAMILY
    3e-09  43%  2p4wB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN ARSR FAMILY
    3e-09  43%  2p4wA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN ARSR FAMILY
    8e-09  43%  1xnpB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN ARSR FAMILY
    8e-09  43%  1xnpA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN ARSR FAMILY
    2e-08  35%  3f6vA  [x.x.x] POSSIBLE TRANSCRIPTIONAL REGULATOR, ARSR FAMILY
    2e-04  36%  2jscB  [x.x.x] TRANSCRIPTIONAL REGULATOR RV1994C/MT2050
    3e-04  36%  2jscA  [x.x.x] TRANSCRIPTIONAL REGULATOR RV1994C/MT2050
    7e-04  32%  2cweA  [x.x.x] HYPOTHETICAL TRANSCRIPTION REGULATOR PROTEIN,
:121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxSDPHVALDATFQALADTTRRTMLAQLARGPLSVTELARPLAMSLPAVMQHLSVLEQAGLVRTEKVG
3f6oB           ----------LNGIFQALADPTRRAVLGRLSRGPATVSELAKPFDMALPSFMKHIHFLEDSGWIRTHKQG
3f6oA           ----------LNGIFQALADPTRRAVLGRLSRGPATVSELAKPFDMALPSFMKHIHFLEDSGWIRTHKQG
2oqgC           -------YAELASVFAALSDETRWEILTELGRADQSASSLATRLPVSRQAIAKHLNALQACGLVESVKVG
2oqgB           -------YAELASVFAALSDETRWEILTELGRADQSASSLATRLPVSRQAIAKHLNALQACGLVESVKVG
2oqgA           -------YAELASVFAALSDETRWEILTELGRADQSASSLATRLPVSRQAIAKHLNALQACGLVESVKVG
2p4wB           ----------LNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIRVEKIG
2p4wA           ----------LNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIRVEKIG
1xnpB           ----------LNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIRVEKIP
1xnpA           ----------LNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIRVEKIP
3f6vA           ---------------EVAAEPTRRRLVQLLTSGEQTVNNLAAHFPASRSAISQHLRVLTEAGLVTPRKDG
2jscB           ---------ALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEG
2jscA           ---------------RALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEG
2cweA           ----TDPEV-----IKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVRTEMKG


                         .         .         *         .         .         .         .:140
query           RVRTCTMAPKALSEAEQWINARRAEWEGHFDRLGEYLETxxxxxxxxxxxx
3f6oB           RVRTCAIEKEPFTAVEAWLAEQQELWE------------------------
3f6oA           RVRTCAIEKEPFTAVEAWLAEQQELWE------------------------
2oqgC           REIRYRALGAELNKTARTLERIGAEWDRRLAAIKQIAES------------
2oqgB           REIRYRALGAELNKTARTLERIGAEWDRRLAAIKQIAES------------
2oqgA           REIRYRALGAELNKTARTLERIGAEWDRRLAAIKQIAES------------
2p4wB           RPRKYYMIKKGL---------------------------------------
2p4wA           RPRKYYMIKKGL---------------------------------------
1xnpB           RGR------------------------------------------------
1xnpA           RGR------------------------------------------------
3f6vA           RFRYYRLDPQGLAQLRALFD---SFWIDELDRL------------------
2jscB           RQVRYALADSHLARA------------------------------------
2jscA           RQVRYALADSHLARA------------------------------------
2cweA           NL-------------------------------------------------