[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF08687.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s2tB.bssp"
#ERROR : Can't open dsspfile "1m1bB.bssp"
#ERROR : Can't open dsspfile "1m1bA.bssp"
#ERROR : Can't open dsspfile "1s2uB.bssp"
#ERROR : Can't open dsspfile "1s2uA.bssp"
#ERROR : Can't open dsspfile "1s2vB.bssp"
#ERROR : Can't open dsspfile "1s2vA.bssp"
#ERROR : Can't open dsspfile "1s2vC.bssp"
#ERROR : Can't open dsspfile "1s2vD.bssp"
#ERROR : Can't open dsspfile "1pymB.bssp"
#ERROR : Can't open dsspfile "1pymA.bssp"
#ERROR : Can't open dsspfile "1s2wA.bssp"
#ERROR : Can't open dsspfile "2hjpA.bssp"
#ERROR : Can't open dsspfile "2hrwA.bssp"
#ERROR : Can't open dsspfile "1zlpB.bssp"
#ERROR : Can't open dsspfile "1zlpA.bssp"
#ERROR : Can't open dsspfile "1xg4A.bssp"
#ERROR : Can't open dsspfile "1xg3C.bssp"
#ERROR : Can't open dsspfile "1xg3B.bssp"
#ERROR : Can't open dsspfile "1xg3A.bssp"
#ERROR : Can't open dsspfile "1xg3D.bssp"
#ERROR : Can't open dsspfile "1oqfA.bssp"
#ERROR : Can't open dsspfile "1mumA.bssp"
#ERROR : Can't open dsspfile "1ujqA.bssp"
#ERROR : Can't open dsspfile "1o5qC.bssp"
#ERROR : Can't open dsspfile "1o5qA.bssp"
#ERROR : Can't open dsspfile "1o5qD.bssp"
#ERROR : Can't open dsspfile "1o5qB.bssp"
#ERROR : Can't open dsspfile "3b8iE.bssp"
#ERROR : Can't open dsspfile "3b8iC.bssp"
#ERROR : Can't open dsspfile "3b8iB.bssp"
#ERROR : Can't open dsspfile "3b8iA.bssp"
#ERROR : Can't open dsspfile "3ih1B.bssp"
#ERROR : Can't open dsspfile "3ih1A.bssp"
#ERROR : Can't open dsspfile "3b8iD.bssp"
#ERROR : Can't open dsspfile "1jylA.bssp"
#ERROR : Can't open dsspfile "3eooJ.bssp"
#ERROR : Can't open dsspfile "3eooI.bssp"
#ERROR : Can't open dsspfile "3eooE.bssp"
#ERROR : Can't open dsspfile "3eooD.bssp"
#ERROR : Can't open dsspfile "3eooC.bssp"
#ERROR : Can't open dsspfile "3eooB.bssp"
#ERROR : Can't open dsspfile "3eooA.bssp"
#ERROR : Can't open dsspfile "1jykA.bssp"
#ERROR : Can't open dsspfile "2ze3A.bssp"
#ERROR : Can't open dsspfile "2ggoA.bssp"
#ERROR : Can't open dsspfile "3fa4L.bssp"
#ERROR : Can't open dsspfile "3fa3L.bssp"
#ERROR : Can't open dsspfile "3fa3I.bssp"
#ERROR : Can't open dsspfile "3fa3B.bssp"
#ERROR : Can't open dsspfile "3fa3A.bssp"
#ERROR : Can't open dsspfile "3fa4I.bssp"
#ERROR : Can't open dsspfile "3fa4H.bssp"
#ERROR : Can't open dsspfile "3fa4F.bssp"
#ERROR : Can't open dsspfile "3fa4D.bssp"
#ERROR : Can't open dsspfile "3fa4C.bssp"
#ERROR : Can't open dsspfile "3fa4B.bssp"
#ERROR : Can't open dsspfile "3fa3J.bssp"
#ERROR : Can't open dsspfile "3fa4K.bssp"
#ERROR : Can't open dsspfile "3fa4J.bssp"
#ERROR : Can't open dsspfile "3fa4E.bssp"
#ERROR : Can't open dsspfile "3fa4A.bssp"
#ERROR : Can't open dsspfile "3fwwA.bssp"
#ERROR : Can't open dsspfile "1wvcA.bssp"
#ERROR : Can't open dsspfile "2v0jA.bssp"
#ERROR : Can't open dsspfile "2v0hA.bssp"
#ERROR : Can't open dsspfile "2oi6B.bssp"
#ERROR : Can't open dsspfile "2oi6A.bssp"
#ERROR : Can't open dsspfile "1hv9B.bssp"
#ERROR : Can't open dsspfile "1hv9A.bssp"
#ERROR : Can't open dsspfile "1fxjA.bssp"
#ERROR : Can't open dsspfile "1fwyB.bssp"
#ERROR : Can't open dsspfile "1fwyA.bssp"
#ERROR : Can't open dsspfile "1dquA.bssp"
#ERROR : Can't open dsspfile "1tzfA.bssp"
#ERROR : Can't open dsspfile "2ux8H.bssp"
#ERROR : Can't open dsspfile "2ux8G.bssp"
#ERROR : Can't open dsspfile "2ux8F.bssp"
#ERROR : Can't open dsspfile "2ux8E.bssp"
#ERROR : Can't open dsspfile "2ux8D.bssp"
#ERROR : Can't open dsspfile "2ux8C.bssp"
#ERROR : Can't open dsspfile "2ux8B.bssp"
#ERROR : Can't open dsspfile "2ux8A.bssp"
#ERROR : Can't open dsspfile "2qiwA.bssp"
#ERROR : Can't open dsspfile "2e3dD.bssp"
#ERROR : Can't open dsspfile "2e3dC.bssp"
#ERROR : Can't open dsspfile "2e3dB.bssp"
#ERROR : Can't open dsspfile "2e3dA.bssp"
#ERROR : Can't open dsspfile "3brkX.bssp"

## Summary of PDB Search
:564
    e-113  68%  1s2tB  [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    e-113  68%  1m1bB  [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    e-113  68%  1m1bA  [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    e-113  68%  1s2uB  [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    e-113  68%  1s2uA  [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    e-112  69%  1s2vB  [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    e-111  69%  1s2vA  [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    e-109  69%  1s2vC  [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    e-109  69%  1s2vD  [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    e-102  69%  1pymB  [c.1.12] PROTEIN (PHOSPHOENOLPYRUVATE MUTASE)
    e-102  69%  1pymA  [c.1.12] PROTEIN (PHOSPHOENOLPYRUVATE MUTASE)
    6e-99  69%  1s2wA  [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    7e-54  40%  2hjpA  [x.x.x] PHOSPHONOPYRUVATE HYDROLASE
    2e-53  41%  2hrwA  [x.x.x] PHOSPHONOPYRUVATE HYDROLASE
    7e-20  28%  1zlpB  [x.x.x] PETAL DEATH PROTEIN
    7e-20  28%  1zlpA  [x.x.x] PETAL DEATH PROTEIN
    1e-19  28%  1xg4A  [x.x.x] PROBABLE METHYLISOCITRATE LYASE
    1e-19  28%  1xg3C  [x.x.x] PROBABLE METHYLISOCITRATE LYASE
    1e-19  28%  1xg3B  [x.x.x] PROBABLE METHYLISOCITRATE LYASE
    1e-19  28%  1xg3A  [x.x.x] PROBABLE METHYLISOCITRATE LYASE
    2e-19  28%  1xg3D  [x.x.x] PROBABLE METHYLISOCITRATE LYASE
    3e-19  28%  1oqfA  [c.1.12] 2-METHYLISOCITRATE LYASE
    3e-19  28%  1mumA  [c.1.12] 2-METHYLISOCITRATE LYASE
    6e-19  29%  1ujqA  [c.1.12] PROBABLE METHYLISOCITRATE LYASE
    6e-19  29%  1o5qC  [c.1.12] PROBABLE METHYLISOCITRATE LYASE
    6e-19  29%  1o5qA  [c.1.12] PROBABLE METHYLISOCITRATE LYASE
    1e-18  29%  1o5qD  [c.1.12] PROBABLE METHYLISOCITRATE LYASE
    1e-18  29%  1o5qB  [c.1.12] PROBABLE METHYLISOCITRATE LYASE
    1e-18  32%  3b8iE  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    1e-18  32%  3b8iC  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    1e-18  32%  3b8iB  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    1e-18  32%  3b8iA  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    5e-18  34%  3ih1B  [x.x.x] METHYLISOCITRATE LYASE
    5e-18  34%  3ih1A  [x.x.x] METHYLISOCITRATE LYASE
    2e-17  32%  3b8iD  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    2e-14  35%  1jylA  [c.68.1] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
    2e-14  24%  3eooJ  [x.x.x] METHYLISOCITRATE LYASE
    2e-14  24%  3eooI  [x.x.x] METHYLISOCITRATE LYASE
    2e-14  24%  3eooE  [x.x.x] METHYLISOCITRATE LYASE
    2e-14  24%  3eooD  [x.x.x] METHYLISOCITRATE LYASE
    2e-14  24%  3eooC  [x.x.x] METHYLISOCITRATE LYASE
    2e-14  24%  3eooB  [x.x.x] METHYLISOCITRATE LYASE
    2e-14  24%  3eooA  [x.x.x] METHYLISOCITRATE LYASE
    3e-14  36%  1jykA  [c.68.1] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
    5e-11  28%  2ze3A  [x.x.x] DFA0005
    1e-09  29%  2ggoA  [x.x.x] 401AA LONG HYPOTHETICAL GLUCOSE-1-PHOSPHATE
    4e-09  24%  3fa4L  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    4e-09  24%  3fa3L  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    4e-09  24%  3fa3I  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    4e-09  24%  3fa3B  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    4e-09  24%  3fa3A  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    2e-08  32%  3fa4I  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    2e-08  32%  3fa4H  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    2e-08  32%  3fa4F  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    2e-08  32%  3fa4D  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    2e-08  32%  3fa4C  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    2e-08  32%  3fa4B  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    2e-08  32%  3fa3J  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    3e-08  32%  3fa4K  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    3e-08  32%  3fa4J  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    3e-08  32%  3fa4E  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    3e-08  32%  3fa4A  [x.x.x] 2,3-DIMETHYLMALATE LYASE
    4e-07  29%  3fwwA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    9e-07  40%  1wvcA  [c.68.1] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE
    2e-06  23%  2v0jA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    2e-06  23%  2v0hA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    3e-05  27%  2oi6B  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    3e-05  27%  2oi6A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    3e-05  27%  1hv9B  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    3e-05  27%  1hv9A  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    3e-05  27%  1fxjA  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    3e-05  27%  1fwyB  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    3e-05  27%  1fwyA  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    3e-05  34%  1dquA  [c.1.12] ISOCITRATE LYASE
    8e-05  42%  1tzfA  [c.68.1] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE
    3e-04  36%  2ux8H  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-04  36%  2ux8G  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-04  36%  2ux8F  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-04  36%  2ux8E  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-04  36%  2ux8D  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-04  36%  2ux8C  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-04  36%  2ux8B  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-04  36%  2ux8A  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-04  31%  2qiwA  [x.x.x] PEP PHOSPHONOMUTASE
    4e-04  38%  2e3dD  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    4e-04  38%  2e3dC  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    4e-04  38%  2e3dB  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    4e-04  38%  2e3dA  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    0.001  35%  3brkX  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE
:564

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxSRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASW
1s2tB           ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
1m1bB           ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
1m1bA           ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
1s2uB           ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRASNEASW
1s2uA           ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRASNEASW
1s2vB           ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
1s2vA           ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
1s2vC           ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
1s2vD           ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
1pymB           ------------KTTQLKQ-LNSKDLEFI-EAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
1pymA           ------------KTTQLKQ-LNSKDLEFI-EAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
1s2wA           ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQL---------W
2hjpA           -----------TKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSM
2hrwA           -----------TKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSM
1zlpB           ---------------------------------DALSAAVVEKTGFHAAFVSGYSVSAMLGLPDFGLLTT
1zlpA           ---------------------------------DALSAAVVEKTGFHAAFVSGYSVSAMLGLPDFGLLTT
1xg4A           -------------------LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1xg3C           -------------------LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1xg3B           -------------------LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1xg3A           -------------------LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1xg3D           -------------------LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1oqfA           -------------------LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1mumA           -------------------LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1ujqA           -------------------LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1o5qC           -------------------LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1o5qA           -------------------LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1o5qD           -------------------LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
1o5qB           -------------------LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
3b8iE           --------------AMFRALLDSSRCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
3b8iC           --------------AMFRALLDSSRCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
3b8iB           --------------AMFRALLDSSRCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
3b8iA           --------------AMFRALLDSSRCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
3ih1B           ---------------RFRALVEANEILQIPGAHDA-AALVARNTGFLALYLSGAAYTASKGLPDLGIVTS
3ih1A           ---------------RFRALVEANEILQIPGAHDA-AALVARNTGFLALYLSGAAYTASKGLPDLGIVTS
3b8iD           --------------AMFRALLDSSRCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
1jylA           ----------------------------------------------------------------------
3eooJ           -----------SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANLGIPDLGISTM
3eooI           -----------SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANLGIPDLGISTM
3eooE           -----------SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANLGIPDLGISTM
3eooD           -----------SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANLGIPDLGISTM
3eooC           -----------SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANLGIPDLGISTM
3eooB           -----------SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANLGIPDLGISTM
3eooA           -----------SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANLGIPDLGISTM
1jykA           ----------------------------------------------------------------------
2ze3A           ------------------------------------SARLLEAAGFTAIGTTSAGIAHARGRTDGQTLTR
2ggoA           ----------------------------------------------------------------------
3fa4L           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa3L           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa3I           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa3B           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa3A           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa4I           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa4H           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa4F           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa4D           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa4C           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa4B           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa3J           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa4K           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa4J           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa4E           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fa4A           --------------------------------YDGLSARVALSAGFDALYMTGAGTAASVGQADLGICTL
3fwwA           ----------------------------------------------------------------------
1wvcA           ----------------------------------------------------------------------
2v0jA           ----------------------------------------------------------------------
2v0hA           ----------------------------------------------------------------------
2oi6B           ----------------------------------------------------------------------
2oi6A           ----------------------------------------------------------------------
1hv9B           ----------------------------------------------------------------------
1hv9A           ----------------------------------------------------------------------
1fxjA           ----------------------------------------------------------------------
1fwyB           ----------------------------------------------------------------------
1fwyA           ----------------------------------------------------------------------
1dquA           -----------------------------------------------------------FHDRKQREERM
1tzfA           ----------------------------------------------------------------------
2ux8H           ----------------------------------------------------------------------
2ux8G           ----------------------------------------------------------------------
2ux8F           ----------------------------------------------------------------------
2ux8E           ----------------------------------------------------------------------
2ux8D           ----------------------------------------------------------------------
2ux8C           ----------------------------------------------------------------------
2ux8B           ----------------------------------------------------------------------
2ux8A           ----------------------------------------------------------------------
2qiwA           ------------------------------------SAGLVEEAGFSGLTIGSHPVADATGSSDNNFADY
2e3dD           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
3brkX           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLAD
1s2tB           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLAD
1m1bB           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLAD
1m1bA           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLAD
1s2uB           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLAD
1s2uA           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLAD
1s2vB           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNS---GRAQPLAD
1s2vA           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTN-------QPLAD
1s2vC           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPK---------QPLAD
1s2vD           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFP----------QPLAD
1pymB           TQVVEVLEF-SDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLAD
1pymA           TQVVEVLEF-SDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLAD
1s2wA           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLF--------GRAQPLAD
2hjpA           STHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPK-------DTQELVR
2hrwA           STHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPK---------QELVR
1zlpB           TEVVETRRITAAAPNLCXXXXXXXXXXXPLNVQRFIRELISAGAKGVFLEDQVWPKKCGHMRGKA--VVP
1zlpA           TEVVETRRITAAAPNLCXXXXXXXXXXXPLNVQRFIRELISAGAKGVFLEDQVWPKKCGHMRGKA--VVP
1xg4A           DDVLTDIRRITDVCSLPLLVDADIGFGSSANVARTVKSMIKAGAAGLHIEDQVGAKRSGH--RPNKAIVS
1xg3C           DDVLTDIRRITDVCSLPLLVDADIGFGSSANVARTVKSMIKAGAAGLHIEDQVGAKRSGH--RPNKAIVS
1xg3B           DDVLTDIRRITDVCSLPLLVDADIGFGSSANVARTVKSMIKAGAAGLHIEDQVGAKRSGH--RPNKAIVS
1xg3A           DDVLTDIRRITDVCSLPLLVDADIGFGSSANVARTVKSMIKAGAAGLHIEDQVGAKRSGH--RPNKAIVS
1xg3D           DDVLTDIRRITDVCSLPLLVDADIGFGSSANVARTVKSMIKAGAAGLHIEDQVGAKRSGH--RPNKAIVS
1oqfA           DDVLTDIRRITDVCSLPLLVDADIGFGSSANVARTVKSMIKAGAAGLHIEDQVGAKRCGH--RPNKAIVS
1mumA           DDVLTDIRRITDVCSLPLLVDADIGFGSSANVARTVKSMIKAGAAGLHIEDQVGAKRCGH--RPNKAIVS
1ujqA           DDVLTDIRRITDVCPLPLLVDADIGFGSSANVARTVKSIAKAGAAALHIEDQV-------------AIVS
1o5qC           DDVLTDIRRITDVCPLPLLVDADIGFGSSANVARTVKSIAKAGAAALHIEDQV-------------AIVS
1o5qA           DDVLTDIRRITDVCPLPLLVDADIGFGSSANVARTVKSIAKAGAAALHIEDQV-------------AIVS
1o5qD           DDVLTDIRRITDVCPLPLLVDADIGFGSSANVARTVKSIAKAGAAALHIEDQV-------------AIVS
1o5qB           DDVLTDIRRITDVCPLPLLVDADIGFGSSANVARTVKSIAKAGAAALHIEDQV-------------AIVS
3b8iE           SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGRKSTDLIC
3b8iC           SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGRKSTDLIC
3b8iB           SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGRKSTDLIC
3b8iA           SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGRKSTDLIC
3ih1B           TEVAERARDLVRATDLPVLVDIDTGFGGVLNXXXXXXXXXXXXXXXQ-IEDQQLPKKCGHLNGKK--LVT
3ih1A           TEVAERARDLVRATDLPVLVDIDTGFGGVLNXXXXXXXXXXXXXXXQ-IEDQQLPKKCGHLNGKK--LVT
3b8iD           SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQ-----FRSTDLIC
1jylA           ----------------------------------------------------------------------
3eooJ           DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGHRPGKE--CVP
3eooI           DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGHRPGKE--CVP
3eooE           DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGHRPGKE--CVP
3eooD           DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGHRPGKE--CVP
3eooC           DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGHRPGKE--CVP
3eooB           DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGHRPGKE--CVP
3eooA           DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGHRPGKE--CVP
1jykA           ----------------------------------------------------------------------
2ze3A           DEMGREVEAIVRAVAIPVNADIEAGYGHAEDVRRTVEHFAALGVAGVNLEDA--------TGLTPTELYD
2ggoA           ----------------------------------------------------------------------
3fa4L           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAG--KILVD
3fa3L           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAG--KILVD
3fa3I           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAG--KILVD
3fa3B           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAG--KILVD
3fa3A           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAG--KILVD
3fa4I           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK--------------
3fa4H           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDKILVDTDTYV---------
3fa4F           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK--------------
3fa4D           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK--------------
3fa4C           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK--------------
3fa4B           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK--------------
3fa3J           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK--------------
3fa4K           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQV-----------------
3fa4J           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQV-----------------
3fa4E           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQV-----------------
3fa4A           NDMRANAEMISNISSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQV-----------------
3fwwA           ----------------------------------------------------------------------
1wvcA           ----------------------------------------------------------------------
2v0jA           ----------------------------------------------------------------------
2v0hA           ----------------------------------------------------------------------
2oi6B           ----------------------------------------------------------------------
2oi6A           ----------------------------------------------------------------------
1hv9B           ----------------------------------------------------------------------
1hv9A           ----------------------------------------------------------------------
1fxjA           ----------------------------------------------------------------------
1fwyB           ----------------------------------------------------------------------
1fwyA           ----------------------------------------------------------------------
1dquA           TTPKDQRHKVANVDYLPIIADADTGHGGLTAVMKLTKLFVERGAAGIHIEDQA-------PGTKGKVLVP
1tzfA           ----------------------------------------------------------------------
2ux8H           ----------------------------------------------------------------------
2ux8G           ----------------------------------------------------------------------
2ux8F           ----------------------------------------------------------------------
2ux8E           ----------------------------------------------------------------------
2ux8D           ----------------------------------------------------------------------
2ux8C           ----------------------------------------------------------------------
2ux8B           ----------------------------------------------------------------------
2ux8A           ----------------------------------------------------------------------
2qiwA           AVV----KKITSAVSIPVSVDVESGYG--LSPADLIAQILEAGAVGINVEDVV-----------------
2e3dD           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
3brkX           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSKADEIVTFAR
1s2tB           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
1m1bB           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
1m1bA           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
1s2uB           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
1s2uA           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
1s2vB           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
1s2vA           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
1s2vC           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
1s2vD           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
1pymB           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAIL-HSKKADPSDIEAF-K
1pymA           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAIL-HSKKADPSDIEAF-K
1s2wA           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
2hjpA           IEEFQGKIXXXXXXXXXXXFVVIARVEALIAGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVK
2hrwA           IEEFQGKIXXXXXXXXXXXFVVIARVEALIAGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVK
1zlpB           AEEHALKIAAAREAIGDSDFFLVARTDAR-APHGLEEGIRRANLYKEAGADATFVEAP-ANVDELKEVSA
1zlpA           AEEHALKIAAAREAIGDSDFFLVARTDAR-APHGLEEGIRRANLYKEAGADATFVEAP-ANVDELKEVSA
1xg4A           KEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPEAITELAMYRQFAD
1xg3C           KEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPEAITELAMYRQFAD
1xg3B           KEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPEAITELAMYRQFAD
1xg3A           KEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPEAITELAMYRQFAD
1xg3D           KEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPEAITELAMYRQFAD
1oqfA           KEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPEAITELAMYRQFAD
1mumA           KEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPEAITELAMYRQFAD
1ujqA           KEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPEAITELSMYRRFAD
1o5qC           KEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPEAITELSMYRRFAD
1o5qA           KEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPEAITELSMYRRFAD
1o5qD           KEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPEAITELSMYRRFAD
1o5qB           KEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPEAITELSMYRRFAD
3b8iE           VEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGICL---------------
3b8iC           VEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGICL---------------
3b8iB           VEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGICL---------------
3b8iA           VEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGICL---------------
3ih1B           TEELVQKIKAIK--EVAPSLYIVARTDAR-GVEGLDEAIERANAYVKAGADAIFPEA-LQSEEEFRLFNS
3ih1A           TEELVQKIKAIK--EVAPSLYIVARTDAR-GVEGLDEAIERANAYVKAGADAIFPEA-LQSEEEFRLFNS
3b8iD           VEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGICL---------------
1jylA           ----------------------------------------------------------------------
3eooJ           AGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGADMIFPEA-MKTLDDYRRFKE
3eooI           AGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGADMIFPEA-MKTLDDYRRFKE
3eooE           AGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGADMIFPEA-MKTLDDYRRFKE
3eooD           AGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGADMIFPEA-MKTLDDYRRFKE
3eooC           AGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGADMIFPEA-MKTLDDYRRFKE
3eooB           AGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGADMIFPEA-MKTLDDYRRFKE
3eooA           AGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGADMIFPEA-MKTLDDYRRFKE
1jykA           ----------------------------------------------------------------------
2ze3A           LDSQLXXXXXXXXXXXXSGVPVFARTDTFLKGHGLAETVRRGQAYADAGADGIFVPLALQSQD---IRAL
2ggoA           ----------------------------------------------------------------------
3fa4L           TDTYXXXXXXXXXXXXGSDIVVIARTDSL-QTHGYEESXXXXXXXXXXXXXXXFLEGITSRARQVIQDLA
3fa3L           TDTYXXXXXXXXXXXXGSDIVVIARTDSL-QTHGYEESXXXXXXXXXXXXXXXFLEGITSRARQVIQDLA
3fa3I           TDTYXXXXXXXXXXXXGSDIVVIARTDSL-QTHGYEESXXXXXXXXXXXXXXXFLEGITSRARQVIQDLA
3fa3B           TDTYXXXXXXXXXXXXGSDIVVIARTDSL-QTHGYEESXXXXXXXXXXXXXXXFLEGITSRARQVIQDLA
3fa3A           TDTYXXXXXXXXXXXXGSDIVVIARTDSL-QTHGYEESXXXXXXXXXXXXXXXFLEGITSRARQVIQDLA
3fa4I           ----------------------------------------------------------------------
3fa4H           ----------------------------------------------------------------------
3fa4F           ----------------------------------------------------------------------
3fa4D           ----------------------------------------------------------------------
3fa4C           ----------------------------------------------------------------------
3fa4B           ----------------------------------------------------------------------
3fa3J           ----------------------------------------------------------------------
3fa4K           ----------------------------------------------------------------------
3fa4J           ----------------------------------------------------------------------
3fa4E           ----------------------------------------------------------------------
3fa4A           ----------------------------------------------------------------------
3fwwA           ----------------------------------------------------------------------
1wvcA           ----------------------------------------------------------------------
2v0jA           ----------------------------------------------------------------------
2v0hA           ----------------------------------------------------------------------
2oi6B           ----------------------------------------------------------------------
2oi6A           ----------------------------------------------------------------------
1hv9B           ----------------------------------------------------------------------
1hv9A           ----------------------------------------------------------------------
1fxjA           ----------------------------------------------------------------------
1fwyB           ----------------------------------------------------------------------
1fwyA           ----------------------------------------------------------------------
1dquA           ISEHINRLVAIR-AQADTDLLAIARTDS------------------------------------------
1tzfA           ----------------------------------------------------------------------
2ux8H           ----------------------------------------------------------------------
2ux8G           ----------------------------------------------------------------------
2ux8F           ----------------------------------------------------------------------
2ux8E           ----------------------------------------------------------------------
2ux8D           ----------------------------------------------------------------------
2ux8C           ----------------------------------------------------------------------
2ux8B           ----------------------------------------------------------------------
2ux8A           ----------------------------------------------------------------------
2qiwA           ----------------------------------------------------------------------
2e3dD           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
3brkX           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAASSMQAVAREIHDSQTLVNVEDRIATVNE
1s2tB           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1m1bB           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1m1bA           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1s2uB           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1s2uA           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1s2vB           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1s2vA           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1s2vC           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1s2vD           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1pymB           AWNNQGPVVIVPTKYYKTPTDHFRD-GVS-VIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1pymA           AWNNQGPVVIVPTKYYKTPTDHFRD-GVS-VIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1s2wA           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
2hjpA           SWPGKVPLVLVPTAYQLTEADIAALSKVGIVIYGNHAIRAAVGAVREVFARIRRDGGIREVDAALPSVKE
2hrwA           SWPGKVPLVLVPTAYQLTEADIAALSKVGIVIYGNHAIRAAVGAVREVFARIRRDGGIREVDAALPSVKE
1zlpB           KTKGRIANMIEGGKTPLHTPEEFKEMGFHLIAHSLTAVYATARALVNIMKILKEKGTTRDDLDQMATFSE
1zlpA           KTKGRIANMIEGGKTPLHTPEEFKEMGFHLIAHSLTAVYATARALVNIMKILKEKGTTRDDLDQMATFSE
1xg4A           --AVQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNE
1xg3C           --AVQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNE
1xg3B           --AVQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNE
1xg3A           --AVQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNE
1xg3D           --AVQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNE
1oqfA           --AVQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNE
1mumA           --AVQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNE
1ujqA           --VAQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNE
1o5qC           --VAQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNE
1o5qA           --VAQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNE
1o5qD           --VAQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNE
1o5qB           --VAQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNE
3b8iE           ----------------------------------------------------------------------
3b8iC           ----------------------------------------------------------------------
3b8iB           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
3ih1B           K--VNAPL-LANTEFGKTPYSAEEFANGFQVIYPVTSLRVAAKAYENV----------------------
3ih1A           K--VNAPL-LANTEFGKTPYSAEEFANGFQVIYPVTSLRVAAKAYENV----------------------
3b8iD           ----------------------------------------------------------------------
1jylA           ----------------------------------------------------------------------
3eooJ           --AVKVPILANLTEFGSTPLDELKGANVDIALY-------------------------------------
3eooI           --AVKVPILANLTEFGSTPLDELKGANVDIALY-------------------------------------
3eooE           --AVKVPILANLTEFGSTPLDELKGANVDIALY-------------------------------------
3eooD           --AVKVPILANLTEFGSTPLDELKGANVDIALY-------------------------------------
3eooC           --AVKVPILANLTEFGSTPLDELKGANVDIALY-------------------------------------
3eooB           --AVKVPILANLTEFGSTPLDELKGANVDIALY-------------------------------------
3eooA           --AVKVPILANLTEFGSTPLDELKGANVDIALY-------------------------------------
1jykA           ----------------------------------------------------------------------
2ze3A           ADALRVPLNVMAFPGSPVPRALL-DAGAARVSFGQSLMLATLGLVQRMAAELHAAE--------------
2ggoA           ----------------------------------------------------------------------
3fa4L           GW----PLLLNMVEHGATPSISAAEAGFRIIIFPFAALGPAVAAMREAMEKL--KRDGIPGLDKEMTPQM
3fa3L           GW----PLLLNMVEHGATPSISAAEAGFRIIIFPFAALGPAVAAMREAMEKL--KRDGIPGLDKEMTPQM
3fa3I           GW----PLLLNMVEHGATPSISAAEAGFRIIIFPFAALGPAVAAMREAMEKL--KRDGIPGLDKEMTPQM
3fa3B           GW----PLLLNMVEHGATPSISAAEAGFRIIIFPFAALGPAVAAMREAMEKL--KRDGIPGLDKEMTPQM
3fa3A           GW----PLLLNMVEHGATPSISAAEAGFRIIIFPFAALGPAVAAMREAMEKL--KRDGIPGLDKEMTPQM
3fa4I           ----------------------------------------------------------------------
3fa4H           ----------------------------------------------------------------------
3fa4F           ----------------------------------------------------------------------
3fa4D           ----------------------------------------------------------------------
3fa4C           ----------------------------------------------------------------------
3fa4B           ----------------------------------------------------------------------
3fa3J           ----------------------------------------------------------------------
3fa4K           ----------------------------------------------------------------------
3fa4J           ----------------------------------------------------------------------
3fa4E           ----------------------------------------------------------------------
3fa4A           ----------------------------------------------------------------------
3fwwA           ----------------------------------------------------------------------
1wvcA           ----------------------------------------------------------------------
2v0jA           ----------------------------------------------------------------------
2v0hA           ----------------------------------------------------------------------
2oi6B           ----------------------------------------------------------------------
2oi6A           ----------------------------------------------------------------------
1hv9B           ----------------------------------------------------------------------
1hv9A           ----------------------------------------------------------------------
1fxjA           ----------------------------------------------------------------------
1fwyB           ----------------------------------------------------------------------
1fwyA           ----------------------------------------------------------------------
1dquA           ----------------------------------------------------------------------
1tzfA           ----------------------------------------------------------------------
2ux8H           ----------------------------------------------------------------------
2ux8G           ----------------------------------------------------------------------
2ux8F           ----------------------------------------------------------------------
2ux8E           ----------------------------------------------------------------------
2ux8D           ----------------------------------------------------------------------
2ux8C           ----------------------------------------------------------------------
2ux8B           ----------------------------------------------------------------------
2ux8A           ----------------------------------------------------------------------
2qiwA           ----------------------------------------------------------------------
2e3dD           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
3brkX           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IFRLQDADEYSAAEKIYLxxxxAPSSAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGI
1s2tB           IFRLQRDDELVQAEDKYL----------------------------------------------------
1m1bB           IFRLQRDDELVQAEDKYL----------------------------------------------------
1m1bA           IFRLQRDDELVQAEDKYL----------------------------------------------------
1s2uB           IFRLQRDDELVQAEDKYL----------------------------------------------------
1s2uA           IFRLQRDDELVQAEDKYL----------------------------------------------------
1s2vB           IFRLQRDDELVQAEDKYL----------------------------------------------------
1s2vA           IFRLQRDDELVQAEDKYL----------------------------------------------------
1s2vC           IFRLQRDDELVQAEDKYL----------------------------------------------------
1s2vD           IFRLQRDDELVQAEDKYL----------------------------------------------------
1pymB           IFRLQRDDELVQAEDKYL----------------------------------------------------
1pymA           IFRLQRDDELVQAEDKYL----------------------------------------------------
1s2wA           IFRL------------------------------------------------------------------
2hjpA           IIELQGDERMRAVEARYL----------------------------------------------------
2hrwA           IIELQGDERMRAVEARYL----------------------------------------------------
1zlpB           FNELISLESWYEME--------------------------------------------------------
1zlpA           FNELISLESWYEME--------------------------------------------------------
1xg4A           LY--ESINYYQYEEKL------------------------------------------------------
1xg3C           LY--ESINYYQYEEKL------------------------------------------------------
1xg3B           LY--ESINYYQYEEKL------------------------------------------------------
1xg3A           LY--ESINYYQYEEKL------------------------------------------------------
1xg3D           LY--ESINYYQYEEK-------------------------------------------------------
1oqfA           LY--ESINYYQYEEKL------------------------------------------------------
1mumA           LY--ESINYYQYEEKL------------------------------------------------------
1ujqA           LY--ESINYYQFEEKL------------------------------------------------------
1o5qC           LY--ESINYYQFEEKL------------------------------------------------------
1o5qA           LY--ESINYYQFEEKL------------------------------------------------------
1o5qD           LY--------------------------------------------------------------------
1o5qB           LY--------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
3b8iC           ----------------------------------------------------------------------
3b8iB           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
3ih1B           ----------------------------------------------------------------------
3ih1A           ----------------------------------------------------------------------
3b8iD           ----------------------------------------------------------------------
1jylA           --------------------------AIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGI
3eooJ           ----------------------------------------------------------------------
3eooI           ----------------------------------------------------------------------
3eooE           ----------------------------------------------------------------------
3eooD           ----------------------------------------------------------------------
3eooC           ----------------------------------------------------------------------
3eooB           ----------------------------------------------------------------------
3eooA           ----------------------------------------------------------------------
1jykA           --------------------------AIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGI
2ze3A           ----------------------------------------------------------------------
2ggoA           --------------------------AFILAAGSGERLEPITHTRPKAFVPILSKPLIEYQIEYLRKCGI
3fa4L           LFRVCGLDE-------------------------------------------------------------
3fa3L           LFRVCGLDE-------------------------------------------------------------
3fa3I           LFRVCGLDE-------------------------------------------------------------
3fa3B           LFRVCGLDE-------------------------------------------------------------
3fa3A           LFRVCGLDE-------------------------------------------------------------
3fa4I           ----------------------------------------------------------------------
3fa4H           ----------------------------------------------------------------------
3fa4F           ----------------------------------------------------------------------
3fa4D           ----------------------------------------------------------------------
3fa4C           ----------------------------------------------------------------------
3fa4B           ----------------------------------------------------------------------
3fa3J           ----------------------------------------------------------------------
3fa4K           ----------------------------------------------------------------------
3fa4J           ----------------------------------------------------------------------
3fa4E           ----------------------------------------------------------------------
3fa4A           ----------------------------------------------------------------------
3fwwA           -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
1wvcA           ------------------------SKAVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGI
2v0jA           -------------------------SAVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGS
2v0hA           -------------------------SAVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGS
2oi6B           -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
2oi6A           -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
1hv9B           -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
1hv9A           -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
1fxjA           -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
1fwyB           -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
1fwyA           -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
1dquA           ----------------------------------------------------------------------
1tzfA           ------------------------SKAVILAGGLGV--------KPKPMVEIGGKPILWHIMKMYSVHGI
2ux8H           --------------------------AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGI
2ux8G           --------------------------AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGI
2ux8F           --------------------------AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGI
2ux8E           --------------------------AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGI
2ux8D           --------------------------AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGI
2ux8C           --------------------------AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGI
2ux8B           --------------------------AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGI
2ux8A           --------------------------AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGI
2qiwA           ----------------------------------------------------------------------
2e3dD           --------------------------AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGI
2e3dC           --------------------------AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGI
2e3dB           --------------------------AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGI
2e3dA           --------------------------AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGI
3brkX           ----------------------ARDAAYVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNALNSGI


                         .         .         .         .         *         .         .:420
query           NDITVVGGYKAEAIDAAGIKLVRNERHAATGELASLACAADSLETDTVVSYGDLMFRSYILRDLLETDAP
1s2tB           ----------------------------------------------------------------------
1m1bB           ----------------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------
1s2uB           ----------------------------------------------------------------------
1s2uA           ----------------------------------------------------------------------
1s2vB           ----------------------------------------------------------------------
1s2vA           ----------------------------------------------------------------------
1s2vC           ----------------------------------------------------------------------
1s2vD           ----------------------------------------------------------------------
1pymB           ----------------------------------------------------------------------
1pymA           ----------------------------------------------------------------------
1s2wA           ----------------------------------------------------------------------
2hjpA           ----------------------------------------------------------------------
2hrwA           ----------------------------------------------------------------------
1zlpB           ----------------------------------------------------------------------
1zlpA           ----------------------------------------------------------------------
1xg4A           ----------------------------------------------------------------------
1xg3C           ----------------------------------------------------------------------
1xg3B           ----------------------------------------------------------------------
1xg3A           ----------------------------------------------------------------------
1xg3D           ----------------------------------------------------------------------
1oqfA           ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------------------
1ujqA           ----------------------------------------------------------------------
1o5qC           ----------------------------------------------------------------------
1o5qA           ----------------------------------------------------------------------
1o5qD           ----------------------------------------------------------------------
1o5qB           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
3b8iC           ----------------------------------------------------------------------
3b8iB           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
3ih1B           ----------------------------------------------------------------------
3ih1A           ----------------------------------------------------------------------
3b8iD           ----------------------------------------------------------------------
1jylA           NDIIIIVGYLKEQFDKYGVRLVFNDKYADYNNFYSLYLVKEELANSYVIDADNYLFKNMFRNDL------
3eooJ           ----------------------------------------------------------------------
3eooI           ----------------------------------------------------------------------
3eooE           ----------------------------------------------------------------------
3eooD           ----------------------------------------------------------------------
3eooC           ----------------------------------------------------------------------
3eooB           ----------------------------------------------------------------------
3eooA           ----------------------------------------------------------------------
1jykA           NDIIIIVGYLKEQFDKYGVRLVFNDKYADYNNFYSLYLVKEELANSYVIDADNYLFKNF--RNDLTRSTY
2ze3A           ----------------------------------------------------------------------
2ggoA           RDITVIVSSKNKEYFEKKLKEISIVTQKDDIKGTGAAILSAKFNDEALIIYGDLFF--------------
3fa4L           ----------------------------------------------------------------------
3fa3L           ----------------------------------------------------------------------
3fa3I           ----------------------------------------------------------------------
3fa3B           ----------------------------------------------------------------------
3fa3A           ----------------------------------------------------------------------
3fa4I           ----------------------------------------------------------------------
3fa4H           ----------------------------------------------------------------------
3fa4F           ----------------------------------------------------------------------
3fa4D           ----------------------------------------------------------------------
3fa4C           ----------------------------------------------------------------------
3fa4B           ----------------------------------------------------------------------
3fa3J           ----------------------------------------------------------------------
3fa4K           ----------------------------------------------------------------------
3fa4J           ----------------------------------------------------------------------
3fa4E           ----------------------------------------------------------------------
3fa4A           ----------------------------------------------------------------------
3fwwA           QHVHLVYGHGGELLKKTSLNWVLQAEQLGTGHAMQQAAPHFADDEDILMLYGDV----------------
1wvcA           KDFIICCGYKGYVI--------------------------------------------------------
2v0jA           ENIHLIYGHGGDLMRTEQVNWVLQTEQLGTAHAVQQAAPFFKDNENIVVLYGDALITKETLEKLIEAKPE
2v0hA           ENIHLIYGHGGDLMRTEQVNWVLQTEQLGTAHAVQQAAPFFKDNENIVVLYGDALITKETLEKLIEAKPE
2oi6B           AHVHLVYGHGGDLLKQANLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV----------------
2oi6A           AHVHLVYGHGGDLLKQANLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV----------------
1hv9B           AHVHLVYGHGGDLLKQANLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV----------------
1hv9A           AHVHLVYGHGGDLLKQANLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV----------------
1fxjA           AHVHLVYGHGGDLLKQANLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV----------------
1fwyB           AHVHLVYGHGGDLLKQANLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV----------------
1fwyA           AHVHLVYGHGGDLLKQANLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV----------------
1dquA           ----------------------------------------------------------------------
1tzfA           KDFIICCGYKGYVI--------------------------------------------------------
2ux8H           EQMIFVTGRGKSALE-------------------------------------------------------
2ux8G           EQMIFVTGRGKSALE-------------------------------------------------------
2ux8F           EQMIFVTGRGKSALE-------------------------------------------------------
2ux8E           EQMIFVTGRGKSALE-------------------------------------------------------
2ux8D           EQMIFVTGRGKSALE-------------------------------------------------------
2ux8C           EQMIFVTGRGKSALE-------------------------------------------------------
2ux8B           EQMIFVTGRGKSALE-------------------------------------------------------
2ux8A           EQMIFVTGRGKSALE-------------------------------------------------------
2qiwA           ----------------------------------------------------------------------
2e3dD           TEIVLV----------------------------------------------------------------
2e3dC           TEIVLV----------------------------------------------------------------
2e3dB           TEIVLV----------------------------------------------------------------
2e3dA           TEIVLV----------------------------------------------------------------
3brkX           RRIGVATQYKAHSL--------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FSVVVDSSESAPSNQSVRDFAWCSAADDRDLFGQKVLLRKISDTPAATDGEPHGRWIGLLNVRGEGRARL
1s2tB           ----------------------------------------------------------------------
1m1bB           ----------------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------
1s2uB           ----------------------------------------------------------------------
1s2uA           ----------------------------------------------------------------------
1s2vB           ----------------------------------------------------------------------
1s2vA           ----------------------------------------------------------------------
1s2vC           ----------------------------------------------------------------------
1s2vD           ----------------------------------------------------------------------
1pymB           ----------------------------------------------------------------------
1pymA           ----------------------------------------------------------------------
1s2wA           ----------------------------------------------------------------------
2hjpA           ----------------------------------------------------------------------
2hrwA           ----------------------------------------------------------------------
1zlpB           ----------------------------------------------------------------------
1zlpA           ----------------------------------------------------------------------
1xg4A           ----------------------------------------------------------------------
1xg3C           ----------------------------------------------------------------------
1xg3B           ----------------------------------------------------------------------
1xg3A           ----------------------------------------------------------------------
1xg3D           ----------------------------------------------------------------------
1oqfA           ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------------------
1ujqA           ----------------------------------------------------------------------
1o5qC           ----------------------------------------------------------------------
1o5qA           ----------------------------------------------------------------------
1o5qD           ----------------------------------------------------------------------
1o5qB           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
3b8iC           ----------------------------------------------------------------------
3b8iB           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
3ih1B           ----------------------------------------------------------------------
3ih1A           ----------------------------------------------------------------------
3b8iD           ----------------------------------------------------------------------
1jylA           ----------------------------------------------------------------------
3eooJ           ----------------------------------------------------------------------
3eooI           ----------------------------------------------------------------------
3eooE           ----------------------------------------------------------------------
3eooD           ----------------------------------------------------------------------
3eooC           ----------------------------------------------------------------------
3eooB           ----------------------------------------------------------------------
3eooA           ----------------------------------------------------------------------
1jykA           FSV-------------------------------------------------------------------
2ze3A           ----------------------------------------------------------------------
2ggoA           ----------------------------------------------------------------------
3fa4L           ----------------------------------------------------------------------
3fa3L           ----------------------------------------------------------------------
3fa3I           ----------------------------------------------------------------------
3fa3B           ----------------------------------------------------------------------
3fa3A           ----------------------------------------------------------------------
3fa4I           ----------------------------------------------------------------------
3fa4H           ----------------------------------------------------------------------
3fa4F           ----------------------------------------------------------------------
3fa4D           ----------------------------------------------------------------------
3fa4C           ----------------------------------------------------------------------
3fa4B           ----------------------------------------------------------------------
3fa3J           ----------------------------------------------------------------------
3fa4K           ----------------------------------------------------------------------
3fa4J           ----------------------------------------------------------------------
3fa4E           ----------------------------------------------------------------------
3fa4A           ----------------------------------------------------------------------
3fwwA           ----------------------------------------------------------------------
1wvcA           ----------------------------------------------------------------------
2v0jA           NGITVNLDNPTGYGRIIRENGNVVAVEQKDANAEQLNIKEVNTGVMVSDGASFKKWLARVNNNAQGEYYL
2v0hA           NGITVNLDNPTGYGRIIRENGNVVAVEQKDANAEQLNIKEVNTGVMVSDGASFKKWLARVNNNAQGEYYL
2oi6B           ----------------------------------------------------------------------
2oi6A           ----------------------------------------------------------------------
1hv9B           ----------------------------------------------------------------------
1hv9A           ----------------------------------------------------------------------
1fxjA           ----------------------------------------------------------------------
1fwyB           ----------------------------------------------------------------------
1fwyA           ----------------------------------------------------------------------
1dquA           ----------------------------------------------------------------------
1tzfA           ----------------------------------------------------------------------
2ux8H           ----------------------------------------------------------------------
2ux8G           ----------------------------------------------------------------------
2ux8F           ----------------------------------------------------------------------
2ux8E           ----------------------------------------------------------------------
2ux8D           ----------------------------------------------------------------------
2ux8C           ----------------------------------------------------------------------
2ux8B           ----------------------------------------------------------------------
2ux8A           ----------------------------------------------------------------------
2qiwA           ----------------------------------------------------------------------
2e3dD           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
3brkX           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           QKLLAELRQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1s2tB           ----------------------------------------------------------------------
1m1bB           ----------------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------
1s2uB           ----------------------------------------------------------------------
1s2uA           ----------------------------------------------------------------------
1s2vB           ----------------------------------------------------------------------
1s2vA           ----------------------------------------------------------------------
1s2vC           ----------------------------------------------------------------------
1s2vD           ----------------------------------------------------------------------
1pymB           ----------------------------------------------------------------------
1pymA           ----------------------------------------------------------------------
1s2wA           ----------------------------------------------------------------------
2hjpA           ----------------------------------------------------------------------
2hrwA           ----------------------------------------------------------------------
1zlpB           ----------------------------------------------------------------------
1zlpA           ----------------------------------------------------------------------
1xg4A           ----------------------------------------------------------------------
1xg3C           ----------------------------------------------------------------------
1xg3B           ----------------------------------------------------------------------
1xg3A           ----------------------------------------------------------------------
1xg3D           ----------------------------------------------------------------------
1oqfA           ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------------------
1ujqA           ----------------------------------------------------------------------
1o5qC           ----------------------------------------------------------------------
1o5qA           ----------------------------------------------------------------------
1o5qD           ----------------------------------------------------------------------
1o5qB           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
3b8iC           ----------------------------------------------------------------------
3b8iB           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
3ih1B           ----------------------------------------------------------------------
3ih1A           ----------------------------------------------------------------------
3b8iD           ----------------------------------------------------------------------
1jylA           ----------------------------------------------------------------------
3eooJ           ----------------------------------------------------------------------
3eooI           ----------------------------------------------------------------------
3eooE           ----------------------------------------------------------------------
3eooD           ----------------------------------------------------------------------
3eooC           ----------------------------------------------------------------------
3eooB           ----------------------------------------------------------------------
3eooA           ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
2ze3A           ----------------------------------------------------------------------
2ggoA           ----------------------------------------------------------------------
3fa4L           ----------------------------------------------------------------------
3fa3L           ----------------------------------------------------------------------
3fa3I           ----------------------------------------------------------------------
3fa3B           ----------------------------------------------------------------------
3fa3A           ----------------------------------------------------------------------
3fa4I           ----------------------------------------------------------------------
3fa4H           ----------------------------------------------------------------------
3fa4F           ----------------------------------------------------------------------
3fa4D           ----------------------------------------------------------------------
3fa4C           ----------------------------------------------------------------------
3fa4B           ----------------------------------------------------------------------
3fa3J           ----------------------------------------------------------------------
3fa4K           ----------------------------------------------------------------------
3fa4J           ----------------------------------------------------------------------
3fa4E           ----------------------------------------------------------------------
3fa4A           ----------------------------------------------------------------------
3fwwA           ----------------------------------------------------------------------
1wvcA           ----------------------------------------------------------------------
2v0jA           TDLIALANQ-------------------------------------------------------------
2v0hA           TDLIALANQ-------------------------------------------------------------
2oi6B           ----------------------------------------------------------------------
2oi6A           ----------------------------------------------------------------------
1hv9B           ----------------------------------------------------------------------
1hv9A           ----------------------------------------------------------------------
1fxjA           ----------------------------------------------------------------------
1fwyB           ----------------------------------------------------------------------
1fwyA           ----------------------------------------------------------------------
1dquA           ----------------------------------------------------------------------
1tzfA           ----------------------------------------------------------------------
2ux8H           ----------------------------------------------------------------------
2ux8G           ----------------------------------------------------------------------
2ux8F           ----------------------------------------------------------------------
2ux8E           ----------------------------------------------------------------------
2ux8D           ----------------------------------------------------------------------
2ux8C           ----------------------------------------------------------------------
2ux8B           ----------------------------------------------------------------------
2ux8A           ----------------------------------------------------------------------
2qiwA           ----------------------------------------------------------------------
2e3dD           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
3brkX           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxx
1s2tB           ----
1m1bB           ----
1m1bA           ----
1s2uB           ----
1s2uA           ----
1s2vB           ----
1s2vA           ----
1s2vC           ----
1s2vD           ----
1pymB           ----
1pymA           ----
1s2wA           ----
2hjpA           ----
2hrwA           ----
1zlpB           ----
1zlpA           ----
1xg4A           ----
1xg3C           ----
1xg3B           ----
1xg3A           ----
1xg3D           ----
1oqfA           ----
1mumA           ----
1ujqA           ----
1o5qC           ----
1o5qA           ----
1o5qD           ----
1o5qB           ----
3b8iE           ----
3b8iC           ----
3b8iB           ----
3b8iA           ----
3ih1B           ----
3ih1A           ----
3b8iD           ----
1jylA           ----
3eooJ           ----
3eooI           ----
3eooE           ----
3eooD           ----
3eooC           ----
3eooB           ----
3eooA           ----
1jykA           ----
2ze3A           ----
2ggoA           ----
3fa4L           ----
3fa3L           ----
3fa3I           ----
3fa3B           ----
3fa3A           ----
3fa4I           ----
3fa4H           ----
3fa4F           ----
3fa4D           ----
3fa4C           ----
3fa4B           ----
3fa3J           ----
3fa4K           ----
3fa4J           ----
3fa4E           ----
3fa4A           ----
3fwwA           ----
1wvcA           ----
2v0jA           ----
2v0hA           ----
2oi6B           ----
2oi6A           ----
1hv9B           ----
1hv9A           ----
1fxjA           ----
1fwyB           ----
1fwyA           ----
1dquA           ----
1tzfA           ----
2ux8H           ----
2ux8G           ----
2ux8F           ----
2ux8E           ----
2ux8D           ----
2ux8C           ----
2ux8B           ----
2ux8A           ----
2qiwA           ----
2e3dD           ----
2e3dC           ----
2e3dB           ----
2e3dA           ----
3brkX           ----