[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF08803.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1q7bA.bssp"
#ERROR : Can't open dsspfile "1i01E.bssp"
#ERROR : Can't open dsspfile "1q7cA.bssp"
#ERROR : Can't open dsspfile "1q7bB.bssp"
#ERROR : Can't open dsspfile "3gk3D.bssp"
#ERROR : Can't open dsspfile "3gk3B.bssp"
#ERROR : Can't open dsspfile "1i01B.bssp"
#ERROR : Can't open dsspfile "3gk3A.bssp"
#ERROR : Can't open dsspfile "3gk3C.bssp"
#ERROR : Can't open dsspfile "1uznA.bssp"
#ERROR : Can't open dsspfile "1i01A.bssp"
#ERROR : Can't open dsspfile "1gegE.bssp"
#ERROR : Can't open dsspfile "1gegA.bssp"
#ERROR : Can't open dsspfile "3ezlA.bssp"
#ERROR : Can't open dsspfile "1i01G.bssp"
#ERROR : Can't open dsspfile "1i01F.bssp"
#ERROR : Can't open dsspfile "3ftpA.bssp"
#ERROR : Can't open dsspfile "1i01D.bssp"
#ERROR : Can't open dsspfile "1xr3B.bssp"
#ERROR : Can't open dsspfile "2zk7B.bssp"
#ERROR : Can't open dsspfile "1uzlA.bssp"
#ERROR : Can't open dsspfile "2dteA.bssp"
#ERROR : Can't open dsspfile "2p68A.bssp"
#ERROR : Can't open dsspfile "2ntnA.bssp"
#ERROR : Can't open dsspfile "1i01H.bssp"
#ERROR : Can't open dsspfile "3ftpC.bssp"
#ERROR : Can't open dsspfile "2q2qH.bssp"
#ERROR : Can't open dsspfile "2uvdA.bssp"
#ERROR : Can't open dsspfile "2rhrB.bssp"
#ERROR : Can't open dsspfile "2q2wC.bssp"
#ERROR : Can't open dsspfile "1i01C.bssp"
#ERROR : Can't open dsspfile "3ftpD.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "2q2vD.bssp"
#ERROR : Can't open dsspfile "1edoA.bssp"
#ERROR : Can't open dsspfile "1uznB.bssp"
#ERROR : Can't open dsspfile "1w4zB.bssp"
#ERROR : Can't open dsspfile "1uzmA.bssp"
#ERROR : Can't open dsspfile "2q2wD.bssp"
#ERROR : Can't open dsspfile "2q2vC.bssp"
#ERROR : Can't open dsspfile "2q2qF.bssp"
#ERROR : Can't open dsspfile "2ph3A.bssp"
#ERROR : Can't open dsspfile "1x7gB.bssp"
#ERROR : Can't open dsspfile "2q2qC.bssp"
#ERROR : Can't open dsspfile "2p68B.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "1uzlB.bssp"
#ERROR : Can't open dsspfile "2q2wA.bssp"
#ERROR : Can't open dsspfile "2q2qE.bssp"
#ERROR : Can't open dsspfile "2q2qB.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "2yz7A.bssp"
#ERROR : Can't open dsspfile "1x7hB.bssp"
#ERROR : Can't open dsspfile "1w4zA.bssp"
#ERROR : Can't open dsspfile "2rh4B.bssp"
#ERROR : Can't open dsspfile "2rh4A.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "1x7gA.bssp"
#ERROR : Can't open dsspfile "2rhrA.bssp"
#ERROR : Can't open dsspfile "2q2qA.bssp"
#ERROR : Can't open dsspfile "2q2vB.bssp"
#ERROR : Can't open dsspfile "2q2qG.bssp"
#ERROR : Can't open dsspfile "1ae1B.bssp"
#ERROR : Can't open dsspfile "2q2vA.bssp"
#ERROR : Can't open dsspfile "2ntnB.bssp"
#ERROR : Can't open dsspfile "3f9iA.bssp"
#ERROR : Can't open dsspfile "1uzmB.bssp"
#ERROR : Can't open dsspfile "1iy8A.bssp"
#ERROR : Can't open dsspfile "2hq1A.bssp"
#ERROR : Can't open dsspfile "3cxtA.bssp"
#ERROR : Can't open dsspfile "2c07A.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "3f9iB.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"
#ERROR : Can't open dsspfile "3i3oF.bssp"
#ERROR : Can't open dsspfile "3i3oE.bssp"
#ERROR : Can't open dsspfile "3i3oC.bssp"
#ERROR : Can't open dsspfile "3i3oB.bssp"
#ERROR : Can't open dsspfile "3i3oA.bssp"
#ERROR : Can't open dsspfile "2ae2A.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "2ztvC.bssp"
#ERROR : Can't open dsspfile "1ulsB.bssp"
#ERROR : Can't open dsspfile "1ulsA.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "2ztvD.bssp"
#ERROR : Can't open dsspfile "2pd6D.bssp"
#ERROR : Can't open dsspfile "2pd6C.bssp"
#ERROR : Can't open dsspfile "2ztvB.bssp"
#ERROR : Can't open dsspfile "2ztmC.bssp"
#ERROR : Can't open dsspfile "2zk7A.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "2ztlA.bssp"
#ERROR : Can't open dsspfile "3i3oH.bssp"
#ERROR : Can't open dsspfile "2ztmA.bssp"
#ERROR : Can't open dsspfile "2ph3B.bssp"
#ERROR : Can't open dsspfile "1ulsC.bssp"
#ERROR : Can't open dsspfile "3ijrH.bssp"
#ERROR : Can't open dsspfile "3ijrF.bssp"
#ERROR : Can't open dsspfile "3ijrE.bssp"
#ERROR : Can't open dsspfile "3ijrB.bssp"
#ERROR : Can't open dsspfile "3ijrA.bssp"
#ERROR : Can't open dsspfile "3grpA.bssp"
#ERROR : Can't open dsspfile "2b4qA.bssp"
#ERROR : Can't open dsspfile "2pd6B.bssp"
#ERROR : Can't open dsspfile "1xg5C.bssp"
#ERROR : Can't open dsspfile "2pd6A.bssp"
#ERROR : Can't open dsspfile "2nm0A.bssp"
#ERROR : Can't open dsspfile "1x1tA.bssp"
#ERROR : Can't open dsspfile "1zemA.bssp"
#ERROR : Can't open dsspfile "2ztmD.bssp"
#ERROR : Can't open dsspfile "2ztuC.bssp"
#ERROR : Can't open dsspfile "1vl8B.bssp"
#ERROR : Can't open dsspfile "1vl8A.bssp"
#ERROR : Can't open dsspfile "3i3oG.bssp"
#ERROR : Can't open dsspfile "2ztmB.bssp"
#ERROR : Can't open dsspfile "2ztuD.bssp"
#ERROR : Can't open dsspfile "2ztuB.bssp"
#ERROR : Can't open dsspfile "1nffA.bssp"
#ERROR : Can't open dsspfile "2zatA.bssp"
#ERROR : Can't open dsspfile "3d3wA.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "3gafA.bssp"
#ERROR : Can't open dsspfile "3imfB.bssp"
#ERROR : Can't open dsspfile "3gafD.bssp"
#ERROR : Can't open dsspfile "2ztuA.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "3imfA.bssp"
#ERROR : Can't open dsspfile "3gafF.bssp"
#ERROR : Can't open dsspfile "2z1nB.bssp"
#ERROR : Can't open dsspfile "1yxmD.bssp"
#ERROR : Can't open dsspfile "1xkqB.bssp"
#ERROR : Can't open dsspfile "1xkqA.bssp"
#ERROR : Can't open dsspfile "1xhlA.bssp"
#ERROR : Can't open dsspfile "1x1eA.bssp"
#ERROR : Can't open dsspfile "3gafG.bssp"
#ERROR : Can't open dsspfile "3gafC.bssp"
#ERROR : Can't open dsspfile "3gafB.bssp"
#ERROR : Can't open dsspfile "2et6A.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "1cydA.bssp"
#ERROR : Can't open dsspfile "3emkA.bssp"
#ERROR : Can't open dsspfile "2ekqD.bssp"
#ERROR : Can't open dsspfile "3ennA.bssp"
#ERROR : Can't open dsspfile "2z1nA.bssp"
#ERROR : Can't open dsspfile "3gafH.bssp"
#ERROR : Can't open dsspfile "3gafE.bssp"
#ERROR : Can't open dsspfile "3ennB.bssp"
#ERROR : Can't open dsspfile "2c7vA.bssp"
#ERROR : Can't open dsspfile "1pr9A.bssp"
#ERROR : Can't open dsspfile "2c7vB.bssp"
#ERROR : Can't open dsspfile "3emkD.bssp"
#ERROR : Can't open dsspfile "1yxmB.bssp"
#ERROR : Can't open dsspfile "1xg5B.bssp"
#ERROR : Can't open dsspfile "1fmcA.bssp"
#ERROR : Can't open dsspfile "2c7vD.bssp"
#ERROR : Can't open dsspfile "3bmqA.bssp"
#ERROR : Can't open dsspfile "3bmnA.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "1yxmA.bssp"
#ERROR : Can't open dsspfile "1hdcA.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "3i4fD.bssp"
#ERROR : Can't open dsspfile "3grpB.bssp"
#ERROR : Can't open dsspfile "3ennD.bssp"
#ERROR : Can't open dsspfile "3ennC.bssp"
#ERROR : Can't open dsspfile "3imfC.bssp"
#ERROR : Can't open dsspfile "3bmjD.bssp"
#ERROR : Can't open dsspfile "3i4fC.bssp"
#ERROR : Can't open dsspfile "3i4fA.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "3bmfB.bssp"
#ERROR : Can't open dsspfile "3bmeA.bssp"
#ERROR : Can't open dsspfile "3bmeB.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "3emkC.bssp"
#ERROR : Can't open dsspfile "3emkB.bssp"
#ERROR : Can't open dsspfile "3bmnD.bssp"
#ERROR : Can't open dsspfile "3bmfD.bssp"
#ERROR : Can't open dsspfile "3bmfC.bssp"
#ERROR : Can't open dsspfile "1yxmC.bssp"
#ERROR : Can't open dsspfile "3bmnC.bssp"
#ERROR : Can't open dsspfile "3bmiB.bssp"
#ERROR : Can't open dsspfile "2wd7B.bssp"
#ERROR : Can't open dsspfile "2ewmB.bssp"
#ERROR : Can't open dsspfile "2ewmA.bssp"
#ERROR : Can't open dsspfile "3bmoD.bssp"
#ERROR : Can't open dsspfile "3bmoC.bssp"
#ERROR : Can't open dsspfile "2c7vC.bssp"
#ERROR : Can't open dsspfile "3bmdB.bssp"
#ERROR : Can't open dsspfile "2wd7C.bssp"
#ERROR : Can't open dsspfile "2vz0B.bssp"
#ERROR : Can't open dsspfile "3gvcD.bssp"
#ERROR : Can't open dsspfile "3bmoA.bssp"
#ERROR : Can't open dsspfile "3grpC.bssp"
#ERROR : Can't open dsspfile "2ew8B.bssp"
#ERROR : Can't open dsspfile "2ew8A.bssp"
#ERROR : Can't open dsspfile "3bmnB.bssp"
#ERROR : Can't open dsspfile "3bmkC.bssp"
#ERROR : Can't open dsspfile "3bmfA.bssp"
#ERROR : Can't open dsspfile "2vz0A.bssp"
#ERROR : Can't open dsspfile "3bmqC.bssp"
#ERROR : Can't open dsspfile "3gvcC.bssp"
#ERROR : Can't open dsspfile "3gvcB.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "2a4kA.bssp"
#ERROR : Can't open dsspfile "3gvcA.bssp"
#ERROR : Can't open dsspfile "1nfrA.bssp"
#ERROR : Can't open dsspfile "3grpD.bssp"
#ERROR : Can't open dsspfile "1k2wA.bssp"
#ERROR : Can't open dsspfile "3iccA.bssp"
#ERROR : Can't open dsspfile "1g0nB.bssp"
#ERROR : Can't open dsspfile "1ybvA.bssp"
#ERROR : Can't open dsspfile "1g0oC.bssp"
#ERROR : Can't open dsspfile "1g0oA.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "1xq1A.bssp"
#ERROR : Can't open dsspfile "1e6wD.bssp"
#ERROR : Can't open dsspfile "1fdvB.bssp"
#ERROR : Can't open dsspfile "2japC.bssp"
#ERROR : Can't open dsspfile "2japA.bssp"
#ERROR : Can't open dsspfile "1ydeP.bssp"
#ERROR : Can't open dsspfile "1ydeM.bssp"
#ERROR : Can't open dsspfile "1ydeI.bssp"
#ERROR : Can't open dsspfile "1ydeH.bssp"
#ERROR : Can't open dsspfile "1ydeG.bssp"
#ERROR : Can't open dsspfile "1ydeF.bssp"
#ERROR : Can't open dsspfile "1ydeD.bssp"
#ERROR : Can't open dsspfile "1ydeA.bssp"
#ERROR : Can't open dsspfile "1ydeN.bssp"
#ERROR : Can't open dsspfile "1ydeB.bssp"
#ERROR : Can't open dsspfile "1fduC.bssp"
#ERROR : Can't open dsspfile "1e6wC.bssp"
#ERROR : Can't open dsspfile "1e6wA.bssp"
#ERROR : Can't open dsspfile "1e3wA.bssp"
#ERROR : Can't open dsspfile "1bhsA.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "2p8kG.bssp"
#ERROR : Can't open dsspfile "1fdsA.bssp"
#ERROR : Can't open dsspfile "1e6wB.bssp"
#ERROR : Can't open dsspfile "1fdwA.bssp"
#ERROR : Can't open dsspfile "1w0cG.bssp"
#ERROR : Can't open dsspfile "1uayB.bssp"
#ERROR : Can't open dsspfile "1uayA.bssp"
#ERROR : Can't open dsspfile "3gedB.bssp"
#ERROR : Can't open dsspfile "3gedA.bssp"
#ERROR : Can't open dsspfile "1zbqA.bssp"
#ERROR : Can't open dsspfile "1u7tA.bssp"
#ERROR : Can't open dsspfile "1qyxA.bssp"
#ERROR : Can't open dsspfile "1qyvA.bssp"
#ERROR : Can't open dsspfile "1jtvA.bssp"
#ERROR : Can't open dsspfile "1iolA.bssp"
#ERROR : Can't open dsspfile "1fduD.bssp"
#ERROR : Can't open dsspfile "1fduB.bssp"
#ERROR : Can't open dsspfile "1fduA.bssp"
#ERROR : Can't open dsspfile "1e92C.bssp"
#ERROR : Can't open dsspfile "1e7wB.bssp"
#ERROR : Can't open dsspfile "3deyX.bssp"
#ERROR : Can't open dsspfile "2o23B.bssp"
#ERROR : Can't open dsspfile "3g1tA.bssp"
#ERROR : Can't open dsspfile "2dknA.bssp"
#ERROR : Can't open dsspfile "2bfaB.bssp"
#ERROR : Can't open dsspfile "3gz4B.bssp"
#ERROR : Can't open dsspfile "3gz4A.bssp"
#ERROR : Can't open dsspfile "3gegA.bssp"
#ERROR : Can't open dsspfile "2o23A.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "2bf7C.bssp"
#ERROR : Can't open dsspfile "2p8kC.bssp"
#ERROR : Can't open dsspfile "2qhxC.bssp"
#ERROR : Can't open dsspfile "1ja9A.bssp"
#ERROR : Can't open dsspfile "3diiA.bssp"
#ERROR : Can't open dsspfile "2bfoC.bssp"
#ERROR : Can't open dsspfile "1w0cH.bssp"
#ERROR : Can't open dsspfile "2p8kH.bssp"
#ERROR : Can't open dsspfile "3f1lB.bssp"
#ERROR : Can't open dsspfile "3f1lA.bssp"
#ERROR : Can't open dsspfile "1e3sA.bssp"
#ERROR : Can't open dsspfile "2bfoA.bssp"
#ERROR : Can't open dsspfile "3gy0A.bssp"
#ERROR : Can't open dsspfile "1e92D.bssp"
#ERROR : Can't open dsspfile "2bfaD.bssp"
#ERROR : Can't open dsspfile "1w0cE.bssp"
#ERROR : Can't open dsspfile "2qhxA.bssp"
#ERROR : Can't open dsspfile "1gz6A.bssp"
#ERROR : Can't open dsspfile "2fwmX.bssp"
#ERROR : Can't open dsspfile "2bfpB.bssp"
#ERROR : Can't open dsspfile "2bfmC.bssp"
#ERROR : Can't open dsspfile "2bf7A.bssp"
#ERROR : Can't open dsspfile "2qhxD.bssp"
#ERROR : Can't open dsspfile "3dijA.bssp"
#ERROR : Can't open dsspfile "2bfaA.bssp"
#ERROR : Can't open dsspfile "1mxhA.bssp"
#ERROR : Can't open dsspfile "1e92A.bssp"
#ERROR : Can't open dsspfile "2bfaC.bssp"
#ERROR : Can't open dsspfile "2bf7D.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "1w0cC.bssp"
#ERROR : Can't open dsspfile "1gz6C.bssp"
#ERROR : Can't open dsspfile "1gz6B.bssp"
#ERROR : Can't open dsspfile "3f5qA.bssp"
#ERROR : Can't open dsspfile "1e92B.bssp"
#ERROR : Can't open dsspfile "2bfpD.bssp"
#ERROR : Can't open dsspfile "2bf7B.bssp"
#ERROR : Can't open dsspfile "1g6kA.bssp"
#ERROR : Can't open dsspfile "1w6uB.bssp"
#ERROR : Can't open dsspfile "1w0cF.bssp"
#ERROR : Can't open dsspfile "1w0cB.bssp"
#ERROR : Can't open dsspfile "2p8kD.bssp"
#ERROR : Can't open dsspfile "2p8kB.bssp"
#ERROR : Can't open dsspfile "3f5qB.bssp"
#ERROR : Can't open dsspfile "1w6uC.bssp"
#ERROR : Can't open dsspfile "1w6uA.bssp"
#ERROR : Can't open dsspfile "1p33D.bssp"
#ERROR : Can't open dsspfile "2bfmB.bssp"
#ERROR : Can't open dsspfile "1uluB.bssp"
#ERROR : Can't open dsspfile "1rwbA.bssp"
#ERROR : Can't open dsspfile "1fk8A.bssp"
#ERROR : Can't open dsspfile "3f5sB.bssp"
#ERROR : Can't open dsspfile "3f5sA.bssp"
#ERROR : Can't open dsspfile "2p8kA.bssp"
#ERROR : Can't open dsspfile "1p33C.bssp"
#ERROR : Can't open dsspfile "1p33B.bssp"
#ERROR : Can't open dsspfile "2jahC.bssp"
#ERROR : Can't open dsspfile "2jahA.bssp"
#ERROR : Can't open dsspfile "1e7wA.bssp"
#ERROR : Can't open dsspfile "1geeA.bssp"
#ERROR : Can't open dsspfile "1gcoA.bssp"
#ERROR : Can't open dsspfile "3e03C.bssp"
#ERROR : Can't open dsspfile "3e03B.bssp"
#ERROR : Can't open dsspfile "3e03A.bssp"
#ERROR : Can't open dsspfile "1p33A.bssp"
#ERROR : Can't open dsspfile "1yb1B.bssp"
#ERROR : Can't open dsspfile "1mxfA.bssp"
#ERROR : Can't open dsspfile "1w6uD.bssp"
#ERROR : Can't open dsspfile "2ehdB.bssp"
#ERROR : Can't open dsspfile "1zjyA.bssp"
#ERROR : Can't open dsspfile "1w0cA.bssp"
#ERROR : Can't open dsspfile "1nxqA.bssp"
#ERROR : Can't open dsspfile "3e9nA.bssp"
#ERROR : Can't open dsspfile "1uluA.bssp"
#ERROR : Can't open dsspfile "2gdzA.bssp"
#ERROR : Can't open dsspfile "3ek2C.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "3edmA.bssp"
#ERROR : Can't open dsspfile "2yw9H.bssp"
#ERROR : Can't open dsspfile "2ehdA.bssp"
#ERROR : Can't open dsspfile "2bd0A.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "3guyH.bssp"
#ERROR : Can't open dsspfile "3guyG.bssp"
#ERROR : Can't open dsspfile "3guyD.bssp"
#ERROR : Can't open dsspfile "3guyC.bssp"
#ERROR : Can't open dsspfile "1uluD.bssp"
#ERROR : Can't open dsspfile "1fjhA.bssp"
#ERROR : Can't open dsspfile "3e9nC.bssp"
#ERROR : Can't open dsspfile "3ctmA.bssp"
#ERROR : Can't open dsspfile "3bzuD.bssp"
#ERROR : Can't open dsspfile "1zmoA.bssp"
#ERROR : Can't open dsspfile "2yw9B.bssp"
#ERROR : Can't open dsspfile "1uluC.bssp"
#ERROR : Can't open dsspfile "1y5mA.bssp"
#ERROR : Can't open dsspfile "1so8A.bssp"
#ERROR : Can't open dsspfile "3ctmH.bssp"
#ERROR : Can't open dsspfile "3ctmF.bssp"
#ERROR : Can't open dsspfile "1w73A.bssp"
#ERROR : Can't open dsspfile "3guyB.bssp"
#ERROR : Can't open dsspfile "3ctmD.bssp"
#ERROR : Can't open dsspfile "3ctmB.bssp"
#ERROR : Can't open dsspfile "3e9nF.bssp"
#ERROR : Can't open dsspfile "1xu9D.bssp"
#ERROR : Can't open dsspfile "3e9nH.bssp"
#ERROR : Can't open dsspfile "3d5qD.bssp"
#ERROR : Can't open dsspfile "2yw9D.bssp"
#ERROR : Can't open dsspfile "1xu9C.bssp"
#ERROR : Can't open dsspfile "1xu9B.bssp"
#ERROR : Can't open dsspfile "1xu9A.bssp"
#ERROR : Can't open dsspfile "1xu7D.bssp"
#ERROR : Can't open dsspfile "1xu7B.bssp"
#ERROR : Can't open dsspfile "1xu7A.bssp"
#ERROR : Can't open dsspfile "2rbeD.bssp"
#ERROR : Can't open dsspfile "2rbeC.bssp"
#ERROR : Can't open dsspfile "2rbeB.bssp"
#ERROR : Can't open dsspfile "2rbeA.bssp"
#ERROR : Can't open dsspfile "2irwC.bssp"
#ERROR : Can't open dsspfile "2irwA.bssp"
#ERROR : Can't open dsspfile "2iltA.bssp"
#ERROR : Can't open dsspfile "3hfgD.bssp"
#ERROR : Can't open dsspfile "3hfgC.bssp"
#ERROR : Can't open dsspfile "3hfgB.bssp"
#ERROR : Can't open dsspfile "3hfgA.bssp"
#ERROR : Can't open dsspfile "3guyA.bssp"
#ERROR : Can't open dsspfile "3frjA.bssp"
#ERROR : Can't open dsspfile "3ey4C.bssp"
#ERROR : Can't open dsspfile "3ey4A.bssp"
#ERROR : Can't open dsspfile "3e9nE.bssp"
#ERROR : Can't open dsspfile "3d5qC.bssp"
#ERROR : Can't open dsspfile "3d5qB.bssp"
#ERROR : Can't open dsspfile "3d5qA.bssp"
#ERROR : Can't open dsspfile "3d4nD.bssp"
#ERROR : Can't open dsspfile "3d4nC.bssp"
#ERROR : Can't open dsspfile "3d4nB.bssp"
#ERROR : Can't open dsspfile "3d4nA.bssp"
#ERROR : Can't open dsspfile "3d3eB.bssp"
#ERROR : Can't open dsspfile "3d3eA.bssp"
#ERROR : Can't open dsspfile "3czrA.bssp"
#ERROR : Can't open dsspfile "3ch6E.bssp"
#ERROR : Can't open dsspfile "3ch6D.bssp"
#ERROR : Can't open dsspfile "3ch6B.bssp"
#ERROR : Can't open dsspfile "3ch6A.bssp"
#ERROR : Can't open dsspfile "3bzuC.bssp"
#ERROR : Can't open dsspfile "3bzuB.bssp"
#ERROR : Can't open dsspfile "3bzuA.bssp"
#ERROR : Can't open dsspfile "3byzA.bssp"
#ERROR : Can't open dsspfile "2belD.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"
#ERROR : Can't open dsspfile "2belB.bssp"
#ERROR : Can't open dsspfile "2belA.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "2yw9A.bssp"
#ERROR : Can't open dsspfile "3e9nD.bssp"
#ERROR : Can't open dsspfile "2yw9E.bssp"
#ERROR : Can't open dsspfile "2dknB.bssp"
#ERROR : Can't open dsspfile "2yw9C.bssp"
#ERROR : Can't open dsspfile "2yw9F.bssp"
#ERROR : Can't open dsspfile "3ek2D.bssp"
#ERROR : Can't open dsspfile "1w73C.bssp"
#ERROR : Can't open dsspfile "1n5dA.bssp"
#ERROR : Can't open dsspfile "3ek2B.bssp"
#ERROR : Can't open dsspfile "3ek2A.bssp"
#ERROR : Can't open dsspfile "3e9nB.bssp"
#ERROR : Can't open dsspfile "1w73D.bssp"
#ERROR : Can't open dsspfile "2hrbA.bssp"
#ERROR : Can't open dsspfile "3f1kA.bssp"
#ERROR : Can't open dsspfile "1wmaA.bssp"
#ERROR : Can't open dsspfile "3bhmA.bssp"
#ERROR : Can't open dsspfile "1w73B.bssp"
#ERROR : Can't open dsspfile "2pfgA.bssp"
#ERROR : Can't open dsspfile "2b37B.bssp"
#ERROR : Can't open dsspfile "2a4kB.bssp"
#ERROR : Can't open dsspfile "2jjyB.bssp"
#ERROR : Can't open dsspfile "3iahA.bssp"
#ERROR : Can't open dsspfile "1mg5A.bssp"
#ERROR : Can't open dsspfile "1i30A.bssp"
#ERROR : Can't open dsspfile "1lxcA.bssp"
#ERROR : Can't open dsspfile "2b35B.bssp"
#ERROR : Can't open dsspfile "2b35F.bssp"
#ERROR : Can't open dsspfile "2b36B.bssp"
#ERROR : Can't open dsspfile "2nwqC.bssp"
#ERROR : Can't open dsspfile "2nwqB.bssp"
#ERROR : Can't open dsspfile "2nwqA.bssp"
#ERROR : Can't open dsspfile "2jjyA.bssp"
#ERROR : Can't open dsspfile "1qsgG.bssp"
#ERROR : Can't open dsspfile "1qsgA.bssp"
#ERROR : Can't open dsspfile "1qg6A.bssp"
#ERROR : Can't open dsspfile "2jjyC.bssp"
#ERROR : Can't open dsspfile "3fneC.bssp"
#ERROR : Can't open dsspfile "3e9qB.bssp"
#ERROR : Can't open dsspfile "3e9qA.bssp"
#ERROR : Can't open dsspfile "1dfiA.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "2b35C.bssp"
#ERROR : Can't open dsspfile "2h7iA.bssp"
#ERROR : Can't open dsspfile "3fnfD.bssp"
#ERROR : Can't open dsspfile "3fnfC.bssp"
#ERROR : Can't open dsspfile "3fnfB.bssp"
#ERROR : Can't open dsspfile "3fneD.bssp"
#ERROR : Can't open dsspfile "3fneB.bssp"
#ERROR : Can't open dsspfile "1enyA.bssp"
#ERROR : Can't open dsspfile "2b37C.bssp"
#ERROR : Can't open dsspfile "2b35E.bssp"
#ERROR : Can't open dsspfile "2b35D.bssp"
#ERROR : Can't open dsspfile "2b35A.bssp"
#ERROR : Can't open dsspfile "2aqiA.bssp"
#ERROR : Can't open dsspfile "2aqhA.bssp"
#ERROR : Can't open dsspfile "2aq8A.bssp"
#ERROR : Can't open dsspfile "1xseA.bssp"
#ERROR : Can't open dsspfile "2jjyD.bssp"
#ERROR : Can't open dsspfile "3g49A.bssp"
#ERROR : Can't open dsspfile "3dwfC.bssp"
#ERROR : Can't open dsspfile "3dwfB.bssp"
#ERROR : Can't open dsspfile "3dwfA.bssp"
#ERROR : Can't open dsspfile "2p91B.bssp"
#ERROR : Can't open dsspfile "2fhsB.bssp"
#ERROR : Can't open dsspfile "2nv6A.bssp"
#ERROR : Can't open dsspfile "2aqkA.bssp"
#ERROR : Can't open dsspfile "2p91A.bssp"
#ERROR : Can't open dsspfile "3grkA.bssp"
#ERROR : Can't open dsspfile "1lx6A.bssp"

## Summary of PDB Search
:238
    5e-29  35%  1q7bA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-28  36%  1i01E  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-28  35%  1q7cA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-28  36%  1q7bB  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-28  37%  3gk3D  [x.x.x] ACETOACETYL-COA REDUCTASE
    1e-27  37%  3gk3B  [x.x.x] ACETOACETYL-COA REDUCTASE
    2e-27  36%  1i01B  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    4e-27  36%  3gk3A  [x.x.x] ACETOACETYL-COA REDUCTASE
    2e-26  36%  3gk3C  [x.x.x] ACETOACETYL-COA REDUCTASE
    3e-26  32%  1uznA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    4e-26  36%  1i01A  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    6e-26  36%  1gegE  [c.2.1] ACETOIN REDUCTASE
    6e-26  36%  1gegA  [c.2.1] ACETOIN REDUCTASE
    8e-26  32%  3ezlA  [x.x.x] ACETOACETYL-COA REDUCTASE
    1e-25  36%  1i01G  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-25  36%  1i01F  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-25  31%  3ftpA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-25  37%  1i01D  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    2e-25  37%  1xr3B  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    3e-25  34%  2zk7B  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    3e-25  33%  1uzlA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-25  34%  2dteA  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    4e-25  36%  2p68A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    5e-25  36%  2ntnA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    5e-25  37%  1i01H  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    5e-25  31%  3ftpC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    7e-25  33%  2q2qH  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    9e-25  32%  2uvdA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    1e-24  36%  2rhrB  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    1e-24  33%  2q2wC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-24  35%  1i01C  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-24  34%  3ftpD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-24  36%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    2e-24  32%  2q2vD  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-24  37%  1edoA  [c.2.1] BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
    3e-24  34%  1uznB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-24  36%  1w4zB  [c.2.1] KETOACYL REDUCTASE
    3e-24  34%  1uzmA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-24  33%  2q2wD  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    3e-24  33%  2q2vC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    3e-24  34%  2q2qF  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    4e-24  33%  2ph3A  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    6e-24  37%  1x7gB  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    6e-24  34%  2q2qC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    6e-24  37%  2p68B  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    6e-24  37%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    1e-23  34%  1uzlB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-23  33%  2q2wA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-23  32%  2q2qE  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-23  33%  2q2qB  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-23  38%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    1e-23  35%  2yz7A  [x.x.x] D-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-23  38%  1x7hB  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    1e-23  38%  1w4zA  [c.2.1] KETOACYL REDUCTASE
    1e-23  38%  2rh4B  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    1e-23  38%  2rh4A  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    1e-23  38%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    1e-23  37%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    2e-23  38%  1x7gA  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    2e-23  38%  2rhrA  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-23  33%  2q2qA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-23  33%  2q2vB  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-23  33%  2q2qG  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    3e-23  33%  1ae1B  [c.2.1] TROPINONE REDUCTASE-I
    5e-23  33%  2q2vA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    8e-23  37%  2ntnB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-22  33%  3f9iA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-22  36%  1uzmB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-22  33%  1iy8A  [c.2.1] LEVODIONE REDUCTASE
    1e-22  35%  2hq1A  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-22  32%  3cxtA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    1e-22  31%  2c07A  [x.x.x] 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
    2e-22  33%  1o5iA  [c.2.1] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    2e-22  30%  3f9iB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-22  32%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    7e-22  36%  3i3oF  [x.x.x] SHORT CHAIN DEHYDROGENASE
    7e-22  36%  3i3oE  [x.x.x] SHORT CHAIN DEHYDROGENASE
    7e-22  36%  3i3oC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    7e-22  36%  3i3oB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    7e-22  36%  3i3oA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    9e-22  31%  2ae2A  [c.2.1] PROTEIN (TROPINONE REDUCTASE-II)
    1e-21  33%  1ae1A  [c.2.1] TROPINONE REDUCTASE-I
    2e-21  35%  2ztvC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-21  36%  1ulsB  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    2e-21  36%  1ulsA  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    6e-21  34%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    8e-21  35%  2ztvD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    8e-21  35%  2pd6D  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    8e-21  35%  2pd6C  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    1e-20  36%  2ztvB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-20  35%  2ztmC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-20  34%  2zk7A  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    2e-20  30%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    2e-20  36%  2ztlA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-20  34%  3i3oH  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-20  35%  2ztmA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    5e-20  32%  2ph3B  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    7e-20  36%  1ulsC  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    7e-20  35%  3ijrH  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    7e-20  35%  3ijrF  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    7e-20  35%  3ijrE  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    7e-20  35%  3ijrB  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    7e-20  35%  3ijrA  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    7e-20  36%  3grpA  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    7e-20  34%  2b4qA  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    9e-20  35%  2pd6B  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    1e-19  36%  1xg5C  [c.2.1] ARPG836
    1e-19  35%  2pd6A  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    1e-19  31%  2nm0A  [x.x.x] PROBABLE 3-OXACYL-(ACYL-CARRIER-PROTEIN)
    2e-19  38%  1x1tA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-19  34%  1zemA  [x.x.x] XYLITOL DEHYDROGENASE
    3e-19  37%  2ztmD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    6e-19  35%  2ztuC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    6e-19  30%  1vl8B  [c.2.1] GLUCONATE 5-DEHYDROGENASE
    6e-19  30%  1vl8A  [c.2.1] GLUCONATE 5-DEHYDROGENASE
    6e-19  36%  3i3oG  [x.x.x] SHORT CHAIN DEHYDROGENASE
    7e-19  36%  2ztmB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    9e-19  37%  2ztuD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    9e-19  37%  2ztuB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    9e-19  32%  1nffA  [c.2.1] PUTATIVE OXIDOREDUCTASE RV2002
    1e-18  30%  2zatA  [x.x.x] DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 4
    1e-18  32%  3d3wA  [x.x.x] L-XYLULOSE REDUCTASE
    2e-18  34%  1spxA  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    2e-18  29%  3gafA  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-18  37%  3imfB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-18  30%  3gafD  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-18  38%  2ztuA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    3e-18  38%  1xg5A  [c.2.1] ARPG836
    3e-18  36%  3imfA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-18  30%  3gafF  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    5e-18  30%  2z1nB  [x.x.x] DEHYDROGENASE
    6e-18  29%  1yxmD  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    6e-18  35%  1xkqB  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5D234)
    6e-18  35%  1xkqA  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5D234)
    6e-18  35%  1xhlA  [c.2.1] SHORT-CHAIN DEHYDROGENASE/REDUCTASE FAMILY
    6e-18  31%  1x1eA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    6e-18  29%  3gafG  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    6e-18  29%  3gafC  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    6e-18  29%  3gafB  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    6e-18  34%  2et6A  [x.x.x] (3R)-HYDROXYACYL-COA DEHYDROGENASE
    6e-18  31%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    6e-18  32%  1cydA  [c.2.1] CARBONYL REDUCTASE
    8e-18  29%  3emkA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    8e-18  32%  2ekqD  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    1e-17  29%  3ennA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-17  30%  2z1nA  [x.x.x] DEHYDROGENASE
    1e-17  30%  3gafH  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-17  29%  3gafE  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-17  29%  3ennB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-17  31%  2c7vA  [x.x.x] PTERIDINE REDUCTASE
    2e-17  32%  1pr9A  [c.2.1] L-XYLULOSE REDUCTASE
    2e-17  31%  2c7vB  [x.x.x] PTERIDINE REDUCTASE
    2e-17  29%  3emkD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    3e-17  30%  1yxmB  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    3e-17  37%  1xg5B  [c.2.1] ARPG836
    3e-17  27%  1fmcA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-17  31%  2c7vD  [x.x.x] PTERIDINE REDUCTASE
    3e-17  31%  3bmqA  [x.x.x] PTERIDINE REDUCTASE
    3e-17  30%  3bmnA  [x.x.x] PTERIDINE REDUCTASE
    3e-17  27%  1ahhA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    4e-17  29%  1yxmA  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    4e-17  33%  1hdcA  [c.2.1] 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE
    5e-17  34%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    7e-17  32%  3i4fD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    7e-17  38%  3grpB  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    7e-17  29%  3ennD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    7e-17  29%  3ennC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    9e-17  36%  3imfC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    9e-17  31%  3bmjD  [x.x.x] PTERIDINE REDUCTASE
    1e-16  33%  3i4fC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-16  33%  3i4fA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-16  31%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    2e-16  31%  3bmfB  [x.x.x] PTERIDINE REDUCTASE
    2e-16  31%  3bmeA  [x.x.x] PTERIDINE REDUCTASE
    3e-16  32%  3bmeB  [x.x.x] PTERIDINE REDUCTASE
    3e-16  32%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    3e-16  32%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    3e-16  32%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    3e-16  29%  3emkC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    3e-16  29%  3emkB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    4e-16  31%  3bmnD  [x.x.x] PTERIDINE REDUCTASE
    4e-16  31%  3bmfD  [x.x.x] PTERIDINE REDUCTASE
    6e-16  31%  3bmfC  [x.x.x] PTERIDINE REDUCTASE
    7e-16  32%  1yxmC  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    1e-15  31%  3bmnC  [x.x.x] PTERIDINE REDUCTASE
    1e-15  31%  3bmiB  [x.x.x] PTERIDINE REDUCTASE
    1e-15  32%  2wd7B  [x.x.x] PTERIDINE REDUCTASE
    1e-15  32%  2ewmB  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    1e-15  32%  2ewmA  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    2e-15  31%  3bmoD  [x.x.x] PTERIDINE REDUCTASE
    2e-15  32%  3bmoC  [x.x.x] PTERIDINE REDUCTASE
    2e-15  31%  2c7vC  [x.x.x] PTERIDINE REDUCTASE
    2e-15  32%  3bmdB  [x.x.x] PTERIDINE REDUCTASE
    3e-15  31%  2wd7C  [x.x.x] PTERIDINE REDUCTASE
    3e-15  32%  2vz0B  [x.x.x] PTERIDINE REDUCTASE
    4e-15  31%  3gvcD  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    4e-15  31%  3bmoA  [x.x.x] PTERIDINE REDUCTASE
    5e-15  42%  3grpC  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    5e-15  32%  2ew8B  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    5e-15  32%  2ew8A  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    5e-15  33%  3bmnB  [x.x.x] PTERIDINE REDUCTASE
    5e-15  31%  3bmkC  [x.x.x] PTERIDINE REDUCTASE
    5e-15  32%  3bmfA  [x.x.x] PTERIDINE REDUCTASE
    6e-15  31%  2vz0A  [x.x.x] PTERIDINE REDUCTASE
    6e-15  30%  3bmqC  [x.x.x] PTERIDINE REDUCTASE
    8e-15  30%  3gvcC  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    8e-15  30%  3gvcB  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    8e-15  32%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    8e-15  30%  2a4kA  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    1e-14  30%  3gvcA  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    1e-14  33%  1nfrA  [c.2.1] PUTATIVE OXIDOREDUCTASE RV2002
    2e-14  39%  3grpD  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    2e-14  28%  1k2wA  [c.2.1] SORBITOL DEHYDROGENASE
    7e-14  32%  3iccA  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL CARRIER PROTEIN)
    9e-14  25%  1g0nB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-13  27%  1ybvA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-13  27%  1g0oC  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-13  27%  1g0oA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-13  27%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-13  27%  1dohA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-13  31%  1bdbA  [x.x.x] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    2e-13  37%  1xq1A  [c.2.1] PUTATIVE TROPINONE REDUCATSE
    2e-13  33%  1e6wD  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    6e-13  31%  1fdvB  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    8e-13  29%  2japC  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    8e-13  29%  2japA  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    1e-12  30%  1ydeP  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-12  30%  1ydeM  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-12  30%  1ydeI  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-12  30%  1ydeH  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-12  30%  1ydeG  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-12  30%  1ydeF  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-12  30%  1ydeD  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-12  30%  1ydeA  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-12  31%  1ydeN  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-12  31%  1ydeB  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-12  31%  1fduC  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    1e-12  33%  1e6wC  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-12  31%  1e6wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-12  31%  1e3wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-12  31%  1bhsA  [c.2.1 (1dhtA)] 17BETA-HYDROXYSTEROID DEHYDROGENASE
    1e-12  31%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    2e-12  36%  2p8kG  [x.x.x] PTERIDINE REDUCTASE 1
    2e-12  33%  1fdsA  [x.x.x] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    2e-12  32%  1e6wB  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    2e-12  32%  1fdwA  [x.x.x] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    3e-12  35%  1w0cG  [c.2.1] PTERIDINE REDUCTASE
    3e-12  33%  1uayB  [c.2.1] TYPE II 3-HYDROXYACYL-COA DEHYDROGENASE
    3e-12  34%  1uayA  [c.2.1] TYPE II 3-HYDROXYACYL-COA DEHYDROGENASE
    3e-12  29%  3gedB  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    3e-12  29%  3gedA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    4e-12  30%  1zbqA  [x.x.x] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4
    4e-12  34%  1u7tA  [c.2.1] 3-HYDROXYACYL-COA DEHYDROGENASE TYPE II
    4e-12  31%  1qyxA  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 1
    4e-12  31%  1qyvA  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 1
    4e-12  31%  1jtvA  [c.2.1] 17 BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    4e-12  31%  1iolA  [x.x.x] ESTROGENIC 17-BETA HYDROXYSTEROID DEHYDROGENASE
    4e-12  31%  1fduD  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    4e-12  31%  1fduB  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    4e-12  31%  1fduA  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    4e-12  36%  1e92C  [c.2.1] PTERIDINE REDUCTASE 1
    4e-12  36%  1e7wB  [c.2.1] PTERIDINE REDUCTASE
    4e-12  31%  3deyX  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 1
    5e-12  34%  2o23B  [x.x.x] HADH2 PROTEIN
    7e-12  33%  3g1tA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    7e-12  29%  2dknA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-12  34%  2bfaB  [x.x.x] PTERIDINE REDUCTASE 1
    9e-12  37%  3gz4B  [x.x.x] HYPOTHETICAL OXIDOREDUCTASE YCIK
    9e-12  37%  3gz4A  [x.x.x] HYPOTHETICAL OXIDOREDUCTASE YCIK
    9e-12  29%  3gegA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    1e-11  35%  2o23A  [x.x.x] HADH2 PROTEIN
    1e-11  28%  1h5qA  [c.2.1] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    1e-11  35%  2bf7C  [x.x.x] PTERIDINE REDUCTASE 1
    1e-11  36%  2p8kC  [x.x.x] PTERIDINE REDUCTASE 1
    2e-11  35%  2qhxC  [x.x.x] PTERIDINE REDUCTASE 1
    2e-11  29%  1ja9A  [c.2.1] 1,3,6,8-TETRAHYDROXYNAPHTHALENE REDUCTASE
    2e-11  29%  3diiA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    2e-11  36%  2bfoC  [x.x.x] PTERIDINE REDUCTASE 1
    2e-11  36%  1w0cH  [c.2.1] PTERIDINE REDUCTASE
    2e-11  36%  2p8kH  [x.x.x] PTERIDINE REDUCTASE 1
    2e-11  36%  3f1lB  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    2e-11  36%  3f1lA  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    2e-11  32%  1e3sA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    2e-11  34%  2bfoA  [x.x.x] PTERIDINE REDUCTASE 1
    3e-11  37%  3gy0A  [x.x.x] DEHYDROGENASE
    3e-11  36%  1e92D  [c.2.1] PTERIDINE REDUCTASE 1
    3e-11  37%  2bfaD  [x.x.x] PTERIDINE REDUCTASE 1
    4e-11  34%  1w0cE  [c.2.1] PTERIDINE REDUCTASE
    4e-11  34%  2qhxA  [x.x.x] PTERIDINE REDUCTASE 1
    4e-11  35%  1gz6A  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    4e-11  31%  2fwmX  [x.x.x] 2,3-DIHYDRO-2,3-DIHYDROXYBENZOATE DEHYDROGENASE
    4e-11  35%  2bfpB  [x.x.x] PTERIDINE REDUCTASE 1
    4e-11  36%  2bfmC  [x.x.x] PTERIDINE REDUCTASE 1
    4e-11  35%  2bf7A  [x.x.x] PTERIDINE REDUCTASE 1
    6e-11  36%  2qhxD  [x.x.x] PTERIDINE REDUCTASE 1
    6e-11  29%  3dijA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    6e-11  35%  2bfaA  [x.x.x] PTERIDINE REDUCTASE 1
    7e-11  37%  1mxhA  [c.2.1] PTERIDINE REDUCTASE 2
    7e-11  34%  1e92A  [c.2.1] PTERIDINE REDUCTASE 1
    7e-11  36%  2bfaC  [x.x.x] PTERIDINE REDUCTASE 1
    7e-11  36%  2bf7D  [x.x.x] PTERIDINE REDUCTASE 1
    9e-11  29%  1yb1A  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    9e-11  36%  1w0cC  [c.2.1] PTERIDINE REDUCTASE
    9e-11  33%  1gz6C  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    9e-11  33%  1gz6B  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    1e-10  38%  3f5qA  [x.x.x] DEHYGROGENASE
    1e-10  33%  1e92B  [c.2.1] PTERIDINE REDUCTASE 1
    1e-10  35%  2bfpD  [x.x.x] PTERIDINE REDUCTASE 1
    1e-10  34%  2bf7B  [x.x.x] PTERIDINE REDUCTASE 1
    2e-10  32%  1g6kA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    2e-10  31%  1w6uB  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    2e-10  34%  1w0cF  [c.2.1] PTERIDINE REDUCTASE
    2e-10  34%  1w0cB  [c.2.1] PTERIDINE REDUCTASE
    2e-10  34%  2p8kD  [x.x.x] PTERIDINE REDUCTASE 1
    2e-10  34%  2p8kB  [x.x.x] PTERIDINE REDUCTASE 1
    2e-10  39%  3f5qB  [x.x.x] DEHYGROGENASE
    3e-10  31%  1w6uC  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    3e-10  31%  1w6uA  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    3e-10  33%  1p33D  [c.2.1] PTERIDINE REDUCTASE 1
    3e-10  34%  2bfmB  [x.x.x] PTERIDINE REDUCTASE 1
    4e-10  32%  1uluB  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    4e-10  31%  1rwbA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    4e-10  32%  1fk8A  [c.2.1] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    4e-10  39%  3f5sB  [x.x.x] DEHYDROGENASE
    4e-10  39%  3f5sA  [x.x.x] DEHYDROGENASE
    5e-10  34%  2p8kA  [x.x.x] PTERIDINE REDUCTASE 1
    5e-10  33%  1p33C  [c.2.1] PTERIDINE REDUCTASE 1
    5e-10  33%  1p33B  [c.2.1] PTERIDINE REDUCTASE 1
    5e-10  31%  2jahC  [x.x.x] CLAVULANIC ACID DEHYDROGENASE
    5e-10  31%  2jahA  [x.x.x] CLAVULANIC ACID DEHYDROGENASE
    5e-10  34%  1e7wA  [c.2.1] PTERIDINE REDUCTASE
    6e-10  31%  1geeA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    6e-10  31%  1gcoA  [c.2.1] GLUCOSE DEHYDROGENASE
    6e-10  34%  3e03C  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-10  34%  3e03B  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-10  34%  3e03A  [x.x.x] SHORT CHAIN DEHYDROGENASE
    8e-10  33%  1p33A  [c.2.1] PTERIDINE REDUCTASE 1
    1e-09  28%  1yb1B  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    1e-09  37%  1mxfA  [c.2.1] PTERIDINE REDUCTASE 2
    2e-09  31%  1w6uD  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    2e-09  28%  2ehdB  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    3e-09  26%  1zjyA  [x.x.x] R-SPECIFIC ALCOHOL DEHYDROGENASE
    3e-09  33%  1w0cA  [c.2.1] PTERIDINE REDUCTASE
    3e-09  26%  1nxqA  [c.2.1] R-ALCOHOL DEHYDROGENASE
    3e-09  32%  3e9nA  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    5e-09  33%  1uluA  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    5e-09  33%  2gdzA  [x.x.x] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN
    5e-09  26%  3ek2C  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    5e-09  32%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    5e-09  32%  3edmA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    7e-09  31%  2yw9H  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    7e-09  28%  2ehdA  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    7e-09  28%  2bd0A  [x.x.x] SEPIAPTERIN REDUCTASE
    9e-09  30%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    1e-08  25%  3guyH  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    1e-08  25%  3guyG  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    1e-08  25%  3guyD  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    1e-08  25%  3guyC  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    2e-08  33%  1uluD  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    2e-08  31%  1fjhA  [c.2.1] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    2e-08  32%  3e9nC  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    3e-08  22%  3ctmA  [x.x.x] CARBONYL REDUCTASE
    3e-08  31%  3bzuD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-08  26%  1zmoA  [x.x.x] HALOHYDRIN DEHALOGENASE
    3e-08  29%  2yw9B  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    3e-08  33%  1uluC  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    4e-08  29%  1y5mA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    4e-08  37%  1so8A  [c.2.1] 3-HYDROXYACYL-COA DEHYDROGENASE TYPE II
    4e-08  27%  3ctmH  [x.x.x] CARBONYL REDUCTASE
    4e-08  27%  3ctmF  [x.x.x] CARBONYL REDUCTASE
    6e-08  31%  1w73A  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    6e-08  26%  3guyB  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    6e-08  27%  3ctmD  [x.x.x] CARBONYL REDUCTASE
    6e-08  27%  3ctmB  [x.x.x] CARBONYL REDUCTASE
    7e-08  32%  3e9nF  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    1e-07  29%  1xu9D  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-07  34%  3e9nH  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    1e-07  29%  3d5qD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  31%  2yw9D  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    1e-07  32%  1xu9C  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-07  32%  1xu9B  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-07  32%  1xu9A  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-07  32%  1xu7D  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-07  32%  1xu7B  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-07  32%  1xu7A  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-07  32%  2rbeD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  2rbeC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  2rbeB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  2rbeA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  2irwC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  2irwA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  2iltA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3hfgD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3hfgC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3hfgB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3hfgA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  25%  3guyA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    1e-07  32%  3frjA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-07  32%  3ey4C  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-07  32%  3ey4A  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-07  34%  3e9nE  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    1e-07  32%  3d5qC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3d5qB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3d5qA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3d4nD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3d4nC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3d4nB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3d4nA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3d3eB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3d3eA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3czrA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3ch6E  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3ch6D  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3ch6B  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3ch6A  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3bzuC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3bzuB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3bzuA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  3byzA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  2belD  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  2belB  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  32%  2belA  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-07  41%  1a4uA  [c.2.1] ALCOHOL DEHYDROGENASE
    2e-07  31%  2yw9A  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-07  32%  3e9nD  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    2e-07  30%  2yw9E  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-07  29%  2dknB  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-07  31%  2yw9C  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    4e-07  30%  2yw9F  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    4e-07  25%  3ek2D  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    5e-07  31%  1w73C  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    5e-07  38%  1n5dA  [c.2.1] CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID
    6e-07  25%  3ek2B  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    6e-07  26%  3ek2A  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    8e-07  31%  3e9nB  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    2e-06  30%  1w73D  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    3e-06  37%  2hrbA  [x.x.x] CARBONYL REDUCTASE [NADPH] 3
    3e-06  33%  3f1kA  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    4e-06  37%  1wmaA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    4e-06  37%  3bhmA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    5e-06  32%  1w73B  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    7e-06  38%  2pfgA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    7e-06  29%  2b37B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    7e-06  41%  2a4kB  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    9e-06  22%  2jjyB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    9e-06  31%  3iahA  [x.x.x] SHORT CHAIN DEHYDROGENASE YCIK
    2e-05  34%  1mg5A  [c.2.1] ALCOHOL DEHYDROGENASE
    3e-05  25%  1i30A  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-05  27%  1lxcA  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-05  30%  2b35B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-05  29%  2b35F  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-05  30%  2b36B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    8e-05  31%  2nwqC  [x.x.x] PROBABLE SHORT-CHAIN DEHYDROGENASE
    8e-05  31%  2nwqB  [x.x.x] PROBABLE SHORT-CHAIN DEHYDROGENASE
    8e-05  31%  2nwqA  [x.x.x] PROBABLE SHORT-CHAIN DEHYDROGENASE
    8e-05  22%  2jjyA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-04  24%  1qsgG  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-04  24%  1qsgA  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-04  24%  1qg6A  [c.2.1] PROTEIN (ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE)
    1e-04  21%  2jjyC  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-04  29%  3fneC  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  39%  3e9qB  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    1e-04  39%  3e9qA  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    1e-04  25%  1dfiA  [c.2.1] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    1e-04  24%  1c14A  [c.2.1] ENOYL REDUCTASE
    1e-04  30%  2b35C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  2h7iA  [c.2.1 (1bvrA)] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  3fnfD  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  3fnfC  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  3fnfB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  3fneD  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  3fneB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  1enyA  [x.x.x] ENOYL-ACYL CARRIER PROTEIN (ACP) REDUCTASE
    1e-04  29%  2b37C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  2b35E  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  2b35D  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  2b35A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  2aqiA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  2aqhA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-04  29%  2aq8A  [x.x.x] ENOYL-ACYL-CARRIER-PROTEIN REDUCTASE
    2e-04  29%  1xseA  [c.2.1] 11BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    2e-04  21%  2jjyD  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-04  29%  3g49A  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    2e-04  29%  3dwfC  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    2e-04  29%  3dwfB  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    2e-04  29%  3dwfA  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    2e-04  30%  2p91B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-04  26%  2fhsB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE, NADH-
    3e-04  29%  2nv6A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH
    3e-04  29%  2aqkA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-04  31%  2p91A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    7e-04  34%  3grkA  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    9e-04  25%  1lx6A  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
:238

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAERRTALVTGATKGIGLALSKHLQQLGWSVIGVARHAIEGFPGQLLTADLADIQQTDAVLAQVVAASRI
1q7bA           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
1i01E           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
1q7cA           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
1q7bB           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
3gk3D           ---KRVAFVTGGMGGLGAAISRRLHDAGMAV--AVSHSVSGRDFKAYAVDVADFESCERCAEKVLADGKV
3gk3B           ---KRVAFVTGGMGGLGAAISRRLHDAGMAVVSHSDHVSTGRDFKAYAVDVADFESCERCAEKVLADGKV
1i01B           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
3gk3A           ---KRVAFVTGGMGGLGAAISRRLHDAGMAVAWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADGKV
3gk3C           ---KRVAFVTGGMGGLGAAISRRLHDAGMAVAWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADGKV
1uznA           ----RSVLVTGGNRGIGLAIAQRLAADGHKV--AVTHRGSGAPKGLFGVEV-DVTDSDAVDRAFTAVEEV
1i01A           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
1gegE           ---KKVALVTGAGQGIGKAIALRLVKDGFAVAAVASEINQA--GGHAVAVKVDVSDRDQVFAAVEQARKF
1gegA           ---KKVALVTGAGQGIGKAIALRLVKDGFAVAAVASEINQA--GGHAVAVKVDVSDRDQVFAAVEQARKF
3ezlA           ---QRIAYVTGGMGGIGTSICQRLHKDGFRVVALEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAVGEI
1i01G           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
1i01F           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
3ftpA           --DKQVAIVTGASRGIGRAIALELARRGAMVXXXXXXXXXGLEGRGAVLNVNDATAVDALVESTLKEGAL
1i01D           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
1xr3B           --DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
2zk7B           ----KVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEGSI
1uzlA           ----RSVLVTGGNRGIGLAIAQRLAADGHKV--AVTHRGSGAPKGLFGVE-CDVTDSDAVDRAFTAVEEV
2dteA           ----KVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEGSI
2p68A           ----KVSLVTGSTRGIGRAIAEKLASAGSTVI------ITGTSGERAKAVAEEIANKYGVKAHGVEMNLI
2ntnA           ----RSVLVTGGNRGIGLAIAQRLAADGHKV--AVTHRGSGAPKGLFGVEV-DVTDSDAVDRAFTAVEEV
1i01H           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
3ftpC           --DKQVAIVTGASRGIGRAIALELARRGAMVXXXXXXXXXGLEGRGAVLNVNDATAVDALVESTLKEGAL
2q2qH           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2uvdA           MLKGKVALVTGASRGIGRAIAIDLAKQGANVVGNEQKANEGSDAIAVRADVANAEDVTNMVKQTVDVGQV
2rhrB           --DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
2q2wC           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
1i01C           --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISDYLGANGKGLMLNVTSIESVLEKIRAEGEV
3ftpD           --DKQVAIVTGASRGIGRAIALELARRGAMVXXXXXXXXXGLEGRGAVLNVNDATAVDALVESTLKEGAL
3csdB           --DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
2q2vD           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
1edoA           -------VVTGASRGIGKAIALSLGKAGCKVVNYARSAIEAYGGQAITGDVSKEADVEAMMKTAIDAGTI
1uznB           ----RSVLVTGGNRGIGLAIAQRLAADGHKV--AVTHRGSGAPKGLFGVEV-DVTDSDAVDRAFTAVEEV
1w4zB           --DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
1uzmA           ----RSVLVTGGNRGIGLAIAQRLAADGHKV--AVTHRGSGAPKGLFGVEV-DVTDSDAVDRAFTAVEEV
2q2wD           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2q2vC           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2q2qF           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2ph3A           ----RKALITGASRGIGRAIALRLAEDGFALAXXXXXXXXGSPXXXXXXXXXXXXXXXXXXXHQAAEGGL
1x7gB           --DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
2q2qC           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2p68B           ----KVSLVTGSTRGIGRAIAEKLASAGSTVI------ITGTSGERAKAVAEEIANKYGVKAHGVEMNLI
2d1yC           -----------------------------------------------------------------ALGRV
1uzlB           ----RSVLVTGGNRGIGLAIAQRLAADGHKV--AVTHRGSGAPKGLFGVE-CDVTDSDAVDRAFTAVEEV
2q2wA           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2q2qE           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2q2qB           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2d1yD           -----------------------------------------------------------------ALGRV
2yz7A           MLKGKKAVVTGSTSGIGLAMATELAKAGADVIERERSTLEGVKAYYLNADLSDAQATRDFIAKAAEAGGL
1x7hB           --DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
1w4zA           --DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
2rh4B           --DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
2rh4A           --DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
2d1yB           -----------------------------------------------------------------ALGRV
2d1yA           -----------------------------------------------------------------ALGRV
1x7gA           ------ALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
2rhrA           ------ALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
2q2qA           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2q2vB           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2q2qG           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
1ae1B           -----TALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKEGLNVEGSVCDLLSRTERDKLMQTVVFDGKL
2q2vA           ----KTALVTGSTSGIGLGIAQVLARAGANIVEIARHGVKAVHHP---ADLSDVAQIEALFALAEREGGV
2ntnB           ----RSVLVTGGNRGIGLAIAQRLAADGHKV--AVTHRGSGAPKGLFGVEV-DVTDSDAVDRAFTAVEEV
3f9iA           ----KTSLITGASSGIGSAIARLLHKLGSKVIGSNEEKLKSLGNALYTIEVCNLANKEECSNLISKTSNL
1uzmB           ----RSVLVTGGNRGIGLAIAQRLAADGHKV--AVTHRGSGAPKGLFGVEV-DVTDSDAVDRAFTAVEEV
1iy8A           ----RVVLITGGGSGLGRATAVRLAAEGLSLVDVSSEGLEASKAAVLVADVSDEAQVEAVTATTERFGRI
2hq1A           ----KTAIVTGSSRGLGKAIAWKLGNMGANIVSPASTSLDATAEEFKAAGIGDVKNPEDVENMVKTAGRI
3cxtA           ----KIALVTGASYGIGFAIASAYAKAGATIVGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESVGII
2c07A           --ENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSGYESSGYAGDVSKKEEISEVINKILTEHKV
1o5iA           -------LVLAASRGIGRAVADVLSQEGAEVTICARNELKRSGHRYVVCDLR--KDLDLLFEKV---KEV
3f9iB           ----KTSLITGASSGIGSAIARLLHKLGSKVIGSNEEKLKSLGNALYTIEVCNLANKEECSNLISKTSNL
3cxrA           ----KIALVTGASYGIGFAIASAYAKAGATIVGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESVGII
3i3oF           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
3i3oE           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
3i3oC           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
3i3oB           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
3i3oA           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
2ae2A           -----TALVTGGSRGIGYGIVEELASLGASVYTCSRNQKEGFKVEASVCDLSSRSERQELMNTVANHGKL
1ae1A           -----TALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKEGLNVEGSVCDLLSRTERDKLMQTVVFDGKL
2ztvC           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
1ulsB           ----KAVLITGAAHGIGRATLELFAKEGARLVGPLREAAEAV-GAHPVVDVADPASVERGFAEALALGRL
1ulsA           ----KAVLITGAAHGIGRATLELFAKEGARLVGPLREAAEAV-GAHPVVDVADPASVERGFAEALALGRL
2cfcA           ----RVAIVTGASSGNGLAIATRFLARGDRVAALARTHWHAYADKVLRADVADEGDVNAAIAATMEQGAI
2ztvD           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
2pd6D           ------ALVTGAGSGIGRAVSVRLAGEGATVAAAAQETVRLLNHAAFQADVSEARAARCLLEQVQACSRP
2pd6C           ------ALVTGAGSGIGRAVSVRLAGEGATVAAAAQETVRLLNHAAFQADVSEARAARCLLEQVQACSRP
2ztvB           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
2ztmC           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
2zk7A           ----KVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEGSI
2ae1A           -----TALVTGGSRGIGYGIVEELASLGASVYTCSRNQKEGFKVEASVCDLSSRSERQELMNTVANHGKL
2ztlA           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
3i3oH           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
2ztmA           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
2ph3B           ----RKALITGASRGIGRAIALRLAEDGFALAXXXXXXXXGSPXXXXXXXXXXXXXXXXXXXHQAAEGGL
1ulsC           ----KAVLITGAAHGIGRATLELFAKEGARLVGPLREAAEAV-GAHPVVDVADPASVERGFAEALALGRL
3ijrH           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
3ijrF           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
3ijrE           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
3ijrB           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
3ijrA           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
3grpA           ---------------------------------------------VFSANLSD-RKSIKQLAEVAEREMI
2b4qA           ----RIALVTGGSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAYGDCQAIPADLSSEAGAARL
2pd6B           ------ALVTGAGSGIGRAVSVRLAGEGATVAAAAQETVRLLGNHAFQADVSEARAARCLLEQVQACSRP
1xg5C           ----RLALVTGASGGIGAAVARALVQQGLKVVGCARTVIEGYPGTLIPY-RCDLSNEEDILSMFSAISGV
2pd6A           ------ALVTGAGSGIGRAVSVRLAGEGATVAAAAQETVRLLNHAAFQADVSEARAARCLLEQVQACSRP
2nm0A           ----RSVLVTGGNRGIGLAIARAFADAGDKVAITYRSGEEGFLA--VKCDITDTEQVEQAYKEIEETGPV
1x1tA           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
1zemA           ----KVCLVTGAGGNIGLATALRLAEEGTAILDMNREALEKAEASVARSYVCDVTSEEAVIGTVDSVVRI
2ztmD           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
2ztuC           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
1vl8B           ----RVALVTGGSRGLGFGIAQGLAEAGCSVVVASRNLEEGVETMAFRCDVSNYXXXXXXXXXXXXXGKL
1vl8A           ----RVALVTGGSRGLGFGIAQGLAEAGCSVVVASRNLEEGVETMAFRCDVSNYXXXXXXXXXXXXXGKL
3i3oG           ----KNVLITGGDSGIGRAVSIAFAKEGANIAGDANETKEGVKCVLLPGDLSDEQHCKDIVQETVRQGSL
2ztmB           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
2ztuD           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
2ztuB           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
1nffA           ----KVALVSGGARGMG---ASHVRAMVAEGAKVVFGDILDEEGKAMAAELADAQWKAAVDTAVTAFGGL
2zatA           --ENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKTLQG-EGLSVTGTVCHVGKAELVAMAVNLHGGV
3d3wA           ----RRVLVTGAGKGIGRGTVQALHATGARVVAVSRSLVRECPGEPVCVDLGDWEATERALGSV---GPV
1spxA           ----KVAIITGSSNGIGRATAVLFAREGAKVTITGRHALEETRQQILAAGVSE-QNVNSVVADVTTDAKL
3gafA           ----------------------------------------------LECNVTDEQHREAVIAALDQFGKI
3imfB           -----------------------------------------FPGQILTVQ--DVRNTDDIIEQIDEKGRI
3gafD           ----------------------------------------------LECNVTDEQHREAVIAALDQFGKI
2ztuA           -------------------------------------------------DGADLSKGEAVRGLVDNAGRI
1xg5A           ----RLALVTGASGGIGAAVARALVQQGLKVVGCARTVIEGYPGTLIPY-RCDLSNEEDILSMFSAISGV
3imfA           -----------------------------------------FPGQILTVQ--DVRNTDDIIEQIDEKGRI
3gafF           ----------------------------------------------LECNVTDEQHREAVIAALDQFGKI
2z1nB           ----KLAVVTAGSSGLGFASALELARNGARLLLFSRNRVSGAQVDIVAGDIREPGDIDRLFEKARDLGGA
1yxmD           LLQGQVAIVTGGATGIGKAIVKELLELGSNVV-IASRKLERLKSAALQANLARVEVNNLVKSTLDTFGKI
1xkqB           ----KTVIITGSSNGIGRTTAILFAQEGANVTGRSSERLEETRQIILKSGVSE-KQVNSVVADVTTEDKI
1xkqA           ----KTVIITGSSNGIGRTTAILFAQEGANVTGRSSERLEETRQIILKSGVSE-KQVNSVVADVTTEDKI
1xhlA           ----KSVIITGSSNGIGRSAAVIFAKEGAQVTITGRNEDRGVPAEKINAVVADVTQDDIINTTLAKFGKI
1x1eA           ----RKALVTGGSRGIGRAIAEALVARGYRVAIASRNAAQSLGAVPLPTDLEKDDPKGLVKRALEXXXXX
3gafG           ----------------------------------------------LECNVTDEQHREAVIAALDQFGKI
3gafC           ----------------------------------------------LECNVTDEQHREAVIAALDQFGKI
3gafB           ----------------------------------------------LECNVTDEQHREAVIAALDQFGKI
2et6A           ----KVVIITGAGGGLGKYYSLEFAKLGAKVVVNDLKAADVVVDEIVVADYNNVLDGDKIVETAVKNGTV
2ekpA           ----RKALVTGGSRGIGRAIAEALVARGYRVAIASRNAAQSLGAVPLPTDLEKDDPKGLVKRALEXXXXX
1cydA           ------ALVTGAGKGIGRDTVKALHASGAKVVAVTRSLAKECPGEPVCVDLGDWDATEKALGGI---GPV
3emkA           ----RKALVTGATGGLGEAIARALHAQG-AIVGLXXXXXXXXXGERIFVFPANLSDREAVKALGQKAEEV
2ekqD           ----RKALVTGGSRGIGRAIAEALVARGYRVAIASRNAAQSLGAVPLPTDLEKDDPKGLVKRALEXXXXX
3ennA           ----RKALVTGATGGLGEAIARALHAQG-AIVGLXXXXXXXXXGERIFVFPANLSDREAVKALGQKAEEV
2z1nA           ----KLAVVTAGSSGLGFASALELARNGARLLLFSRNRVSGAQVDIVAGDIREPGDIDRLFEKARDLGGA
3gafH           ----------------------------------------------LECNVTDEQHREAVIAALDQFGKI
3gafE           ----------------------------------------------LECNVTDEQHREAVIAALDQFGKI
3ennB           ----RKALVTGATGGLGEAIARALHAQG-AIVGLXXXXXXXXXGERIFVFPANLSDREAVKALGQKAEEV
2c7vA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSAVVQADLTNSNVLPASCEEIIAFGRC
1pr9A           ----RRVLVTGAGKGIGRGTVQALHATGARVVAVSRSLVRECPGEPVCVDLGDWEATERALGSV---GPV
2c7vB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSAVVQADLTNSNVLPASCEEIIAFGRC
3emkD           ----RKALVTGATGGLGEAIARALHAQG-AIVGLXXXXXXXXXGERIFVFPANLSDREAVKALGQKAEEV
1yxmB           LLQGQVAIVTGGATGIGKAIVKELLELGSNVV-IASRKLERLKSAALQANLPPTKQARVIPIQLDTFGKI
1xg5B           ----RLALVTGASGGIGAAVARALVQQGLKVVGCARTVIEGYPGTLIPY-RCDLSNEEDILSMFSAISGV
1fmcA           -------------------------------------------------DITSEQELSALADFAISKGKV
2c7vD           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSAVVQADLTNSNVLPASCEEIIAFGRC
3bmqA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3bmnA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
1ahhA           -------------------------------------------------DITSEQELSALADFAISKGKV
1yxmA           LLQGQVAIVTGGATGIGKAIVKELLELGSNVV-IASRKLERLKSAALQANLPPTKQARVIPIQLDTFGKI
1hdcA           -------------------------------------------------DAARYQHLDVTIEEVVAYARV
2b4qB           ----RIALVTGGSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAYGDCQAIPADLSSEAGAARL
3i4fD           ----RHALITAGTKGLGKQVTEKLLAKGYSVT-VTYHAMETMKEQFVQADVTKKEDLHKIVEEAMSHGKI
3grpB           ---------------------------------------------VFSANLSD-RKSIKQLAEVAEREMI
3ennD           ----RKALVTGATGGLGEAIARALHAQG-AIVGLXXXXXXXXXGERIFVFPANLSDREAVKALGQKAEEV
3ennC           ----RKALVTGATGGLGEAIARALHAQG-AIVGLXXXXXXXXXGERIFVFPANLSDREAVKALGQKAEEV
3imfC           -----------------------------------------FPGQILTVQ--DVRNTDDIIEQIDEKGRI
3bmjD           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3i4fC           ----RHALITAGTKGLGKQVTEKLLAKGYSVT-VTYHAMETMKEQFVQADVTKKEDLHKIVEEAMSHGKI
3i4fA           ----RHALITAGTKGLGKQVTEKLLAKGYSVT-VTYHAMETMKEQFVQADVTKKEDLHKIVEEAMSHGKI
3bmoB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3bmfB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3bmeA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSAVVQADLTNSNVLPASCEEIIAFGRC
3bmeB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSAVVQADLTNSNVLPASCEEIIAFGRC
2ag5C           --------------------------------------LEKYPGQTRVLDVTKKKQIDQFANEV---ERL
2ag5B           --------------------------------------LEKYPGQTRVLDVTKKKQIDQFANEV---ERL
2ag5A           --------------------------------------LEKYPGQTRVLDVTKKKQIDQFANEV---ERL
3emkC           ----RKALVTGATGGLGEAIARALHAQG-AIVGLXXXXXXXXXGERIFVFPANLSDREAVKALGQKAEEV
3emkB           ----RKALVTGATGGLGEAIARALHAQG-AIVGLELKELAAELGERIFVFPANLSDREAVKALGQKAEEV
3bmnD           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3bmfD           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3bmfC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
1yxmC           LLQGQVAIVTGGATGIGKAIVKELLELGSNVV-IASRKLERLKS---AADELQANLKQARVIPIQCNIRN
3bmnC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3bmiB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
2wd7B           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSAVVQADLTNSNVLPASCEEIIAFGRC
2ewmB           ----KLAVITGGANGIGRAIAERFAVEGADIAIAAEAAIRNLGRRVLTVDVSQPGDVEAFGKQVISTGRC
2ewmA           ----KLAVITGGANGIGRAIAERFAVEGADIAIAAEAAIRNLGRRVLTVDVSQPGDVEAFGKQVISTGRC
3bmoD           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3bmoC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
2c7vC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSAVVQADLTNSNVLPASCEEIIAFGRC
3bmdB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
2wd7C           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSAVVQADLTNSNVLPASCEEIIAFGRC
2vz0B           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3gvcD           -------------------------------------------------DVSDEQQIIAMVDACVAAGGV
3bmoA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3grpC           ----------------------------------------------------------------------
2ew8B           ----KLAVITGGANGIGRAIAERFAVEGADIAIAAEAAIRNLGRRVLTVDVSQPGDVEAFGKQVISTGRC
2ew8A           ----KLAVITGGANGIGRAIAERFAVEGADIAIAAEAAIRNLGRRVLTVDVSQPGDVEAFGKQVISTGRC
3bmnB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3bmkC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3bmfA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
2vz0A           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3bmqC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAATAVVCQADLTNSNVLPASCEEIIAFGRC
3gvcC           -------------------------------------------------DVSDEQQIIAMVDACVAAGGV
3gvcB           -------------------------------------------------DVSDEQQIIAMVDACVAAGGV
3bmeC           ------AVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSAVVQADLTNSNVLPASCEEIIAFGRC
2a4kA           ----KTILVTGAASGIGRAALDLFAREGASLVAVDREEXXXXXXXXXXXDVSDPKXXXXXXXXXXXXGRL
3gvcA           -------------------------------------------------DVSDEQQIIAMVDACVAAGGV
1nfrA           ----------------------------------------------------------AVDTAVTAFGGL
3grpD           ---------------------------------------------VFSANLSD-RKSIKQLAEVAEREMI
1k2wA           ----KTALITGSARGIGRAFAEAYVREG-ARVAIADINLEAXXXXXXXLDVTDQASIDRCVAELLDRGSI
3iccA           ----KVALVTGASRGIGRAIAKRLANDGALVYGNRKEEAEGGSAFSIGANLESLHGVEALYSSLTGSTKF
1g0nB           --EGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAASDAACVKANVGVVEDIVRMGKL
1ybvA           --EGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAASDAACVKANVGVVEDIVRMGKL
1g0oC           --EGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAASDAACVKANVGVVEDIVRMGKL
1g0oA           --EGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAASDAACVKANVGVVEDIVRMGKL
1dohB           --EGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAASDAACVKANVGVVEDIVRMGKL
1dohA           --EGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAASDAACVKANVGVVEDIVRMGKL
1bdbA           -------LITGGASGLGRALVDRFVAEGAKVAVLDKSALETDHGDNVLGIVGDVRQKQAASRCVARFGKI
1xq1A           ----KTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYEGFQGSVCDASLRPEREKLMQTVSSMFGGKL
1e6wD           ------AVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGLGGNCIFAP-ANVTSEKEVQAALTLAKRI
1fdvB           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
2japC           ---------------------------------------------VLELDVADRQGVDAAVASTVEAGGL
2japA           ---------------------------------------------VLELDVADRQGVDAAVASTVEAGGL
1ydeP           --------------------------------------------------LCDVTQEDDVKTLVSETGRL
1ydeM           --------------------------------------------------LCDVTQEDDVKTLVSETGRL
1ydeI           --------------------------------------------------LCDVTQEDDVKTLVSETGRL
1ydeH           --------------------------------------------------LCDVTQEDDVKTLVSETGRL
1ydeG           --------------------------------------------------LCDVTQEDDVKTLVSETGRL
1ydeF           --------------------------------------------------LCDVTQEDDVKTLVSETGRL
1ydeD           --------------------------------------------------LCDVTQEDDVKTLVSETGRL
1ydeA           --------------------------------------------------LCDVTQEDDVKTLVSETGRL
1ydeN           --------------------------------------------------LCDVTQEDDVKTLVSETGRL
1ydeB           --------------------------------------------------LCDVTQEDDVKTLVSETGRL
1fduC           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1e6wC           ------AVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGLGGNCIFAP-ANVTSEKEVQAALTLAKRI
1e6wA           ------AVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGLGGNCIFAP-ANVTSEKEVQAALTLAKRI
1e3wA           ------AVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGLGGNCIFAP-ANVTSEKEVQAALTLAKRI
1bhsA           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1a27A           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
2p8kG           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
1fdsA           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1e6wB           ------AVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGLGGNCIFAP-ANVTSEKEVQAALTLAKRI
1fdwA           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1w0cG           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
1uayB           ----------------------------------------------------------------------
1uayA           ----------------------------------------------------------------------
3gedB           --------------------------------------------------------------------RI
3gedA           --------------------------------------------------------------------RI
1zbqA           -------------------------------------------GGKAVANYDSVEEGEKVVKTALDAGRI
1u7tA           --------------------------------------------------------------------RV
1qyxA           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1qyvA           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1jtvA           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1iolA           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1fduD           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1fduB           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1fduA           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
1e92C           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
1e7wB           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVTLAELVAAGRC
3deyX           ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
2o23B           --------------------------------------------------------------------RV
3g1tA           LLQNRIILVTGASDGIGREAALTYARYGATVIRVAQHIADEFTLDLLTCTAEECRQ----VADRIAAHRL
2dknA           -------------------LKELLARAGHTVIGIDRGQADSTPGGRETAVAAVLDRCGGVLDGLVCCAGV
2bfaB           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
3gz4B           ----RIILVTGASDGIGREAAMTYARYGATVIQVASHINEETGRQLLTCTSEDCQQ----LAQRIAVNRL
3gz4A           ----RIILVTGASDGIGREAAMTYARYGATVIQVASHINEETGRQLLTCTSEDCQQ----LAQRIAVNRL
3gegA           --------------------------------------------------------------------RI
2o23A           --------------------------------------------------------------------RV
1h5qA           ----KTIIVTGGNRGIGLAFTRXXXXXXXXXXXIYRSAADAVEGVKTKAYQCDVSNTDIVIQQIDALGPI
2bf7C           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
2p8kC           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPSACAELVAAGRC
2qhxC           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
1ja9A           ----------------------------------------GAQGVAIQADISKPSEVVALFDKAVSHGGL
3diiA           --------------------------------------------------------------------RI
2bfoC           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVTLAELVAAGRC
1w0cH           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
2p8kH           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
3f1lB           ----RIILVTGASDGIGREAAMTYARYGATVIQVASHINEETGRQLLTCTSENCQQ----LAQRIAVNRL
3f1lA           ----RIILVTGASDGIGREAAMTYARYGATVIQVASHINEETGRQLLTCTSENCQQ----LAQRIAVNRL
1e3sA           ------AVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGLGGNCIFAP-ANVTSEKEVQAALTLAKRI
2bfoA           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVACAELVAAGRC
3gy0A           ----RIILVTGASDGIGREAAMTYARYGATVIQVASHINEETGRQLLTCTSENCQQ----LAQVVNYPRL
1e92D           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
2bfaD           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
1w0cE           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
2qhxA           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
1gz6A           --------------------------------------------------------------------RI
2fwmX           --------VTGAGKGIGYATALAFVEAGAKVTGFDQFTQEQYPFATEXXXXXXXXXXXXXCQRLLAETRL
2bfpB           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
2bfmC           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAAPVTAELVAAGRC
2bf7A           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
2qhxD           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
3dijA           --------------------------------------------------------------------RI
2bfaA           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
1mxhA           ------AVITGGARRIGHSIAVRLHQQGFRVVVHYRHS-EG-AAQRLVAELNAARAGSAVLCKFRAFGRC
1e92A           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
2bfaC           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPAPVAELVAAGRC
2bf7D           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPPVTAELVAAGRC
1yb1A           -------LITGAGHGIGRLTAYEFAKLKSKLVDINKHGLEGAKVHTFVVDCSNREDIYSSAKKVKAEGDV
1w0cC           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVSCAELVAAGRC
1gz6C           --------------------------------------------------------------------RI
1gz6B           --------------------------------------------------------------------RI
3f5qA           ----RIILVTGASDGIGREAAMTYARYGATVIQVASHINEETGRQLLTCTSEDCQQ----LAQRIAVNRL
1e92B           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPSACAELVAAGRC
2bfpD           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVACAELVAAGRC
2bf7B           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPSACAELVAAGRC
1g6kA           --------------------------------------------------------------------KL
1w6uB           -----------------------------------------------------VQNTVSELIKVAGHPNI
1w0cF           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPSACAELVAAGRC
1w0cB           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVSCAELVAAGRC
2p8kD           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVACAELVAAGRC
2p8kB           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVGAAELVAAGRC
3f5qB           ----RIILVTGASDGIGREAAMTYARYGATVIQVASHINEETGRQLLTCTSEDCQQ----LAQRIAVNRL
1w6uC           -----------------------------------------------------VQNTVSELIKVAGHPNI
1w6uA           -----------------------------------------------------VQNTVSELIKVAGHPNI
1p33D           ------ALVTGAAKRLGSSIAEALHAEGYTVC-LHYHRXXXXPNSAITADLSNVATASSVPVTLFSRGRC
2bfmB           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVACAELVAAGRC
1uluB           ------------------------------------------------ADVTQDEELDALFAGVKEAGGL
1rwbA           --------------------------------------------------------------------KL
1fk8A           -------VISGCATGIGAATRKVLEAAGHQIVGIDIRDAE------VIADLSTAEGRKQAIADVLASKGM
3f5sB           ----RIILVTGASDGIGREAAMTYARYGATVIQVASHINEETGRQLLTCTSENCQQ----LAQVVNYPRL
3f5sA           ----RIILVTGASDGIGREAAMTYARYGATVIQVASHINEETGRQLLTCTSENCQQ----LAQVVNYPRL
2p8kA           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVACAELVAAGRC
1p33C           ------ALVTGAAKRLGSSIAEALHAEGYTVC-LHYHRXXXXPNSAITADLSNVATASSVPVTLFSRGRC
1p33B           ------ALVTGAAKRLGSSIAEALHAEGYTVC-LHYHRXXXXPNSAITADLSNVATASSVPVTLFSRGRC
2jahC           ---------------------------------------------VLELDVADRQGVDAAVASTVEAGGL
2jahA           ---------------------------------------------VLELDVADRQGVDAAVASTVEAGGL
1e7wA           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVSCAELVAAGRC
1geeA           --------------------------------------------------------------------KL
1gcoA           --------------------------------------------------------------------KL
3e03C           ----KTLFITGASRGIGLAIALRAARDGXXXXXXXXXXXXXLPGTIHSXXXCDIREEDQVRAAVAATGGI
3e03B           ----KTLFITGASRGIGLAIALRAARDGXXXXXXXXXXXXXLPGTIHSXXXCDIREEDQVRAAVAATGGI
3e03A           ----KTLFITGASRGIGLAIALRAARDGXXXXXXXXXXXXXLPGTIHSXXXCDIREEDQVRAAVAATGGI
1p33A           ------ALVTGAAKRLGSSIAEALHAEGYTVC-LHYHRXXXXPNSAITADLSNVATASSVPVTLFSRGRC
1yb1B           -------LITGAGHGIGRLTAYEFAKLKSKLVDINKHGLEGAKVHTFVVDCSNREDIYSSAKKVKAEGDV
1mxfA           ------AVITGGARRIGHSIAVRLHQQGFRVVVHYRHS-EG-AAQRLVAELNAARAGSAVLCKFRAFGRC
1w6uD           -----------------------------------------------------VQNTVSELIKVAGHPNI
2ehdB           -------LITGASRGIGEATARLLHAKGYRVGLMARDEXXXXXXXXXXXXXXDVREEGAVAAMEEAFGEL
1zjyA           ---------------------------------------------------------------------V
1w0cA           ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVSCAELVAAGRC
1nxqA           ---------------------------------------------------------------------V
3e9nA           ----KIAVVTGATGGMGIEIVKDLSR-DHIVYALGRN-----PEHL--AALAEIEGVEPIESDIVKE---
1uluA           ------------------------------------------------ADVTQDEELDALFAGVKEAGGL
2gdzA           MVNGKVALVTGAAQGIGRAFXXXXXXXDWNLAGVQCKAAEQFEPQFIQCDVADQQQLRDTFRKVVHFGRL
3ek2C           --------------GIAKACKREGAELAFTYVGITEFAAEFGSELVFPCDVADDAQIDALFASLKTHDSL
3edmB           ----RTIVVAGAGRDIGRACAIRFAQEGANVVXXXXXXIEGRSALAIKADLTNXXXXXXXXXXXXDKGEI
3edmA           ----RTIVVAGAGRDIGRACAIRFAQEGANVVXXXXXXIEGRSALAIKADLTNXXXXXXXXXXXXDKGEI
2yw9H           ----KKALVMGVTRSLGFAIAAKLKEAG-AEVALSYQAERLRPXXXFRADVTQDEELDALFAGVKEAGGL
2ehdA           -------LITGASRGIGEATARLLHAKGYRVGLMARDEXXXXXXXXXXXXXXDVREEGAVAAMEEAFGEL
2bd0A           -------LITGAGKGIGRAIARHHPDFEPVLVLSSRTAAEGALTDTITADISDMADVRRLTTHIVERGHI
2bgkA           --------------------------------------------------------------------KL
3guyH           -------VITGASSGLGAELAKYLTGRSESKLSTVTNCLSNNVGYR-ARDLASHQEVEQLFEQLDSIP--
3guyG           -------VITGASSGLGAELAKYLTGRSESKLSTVTNCLSNNVGYR-ARDLASHQEVEQLFEQLDSIP--
3guyD           -------VITGASSGLGAELAKYLTGRSESKLSTVTNCLSNNVGYR-ARDLASHQEVEQLFEQLDSIP--
3guyC           -------VITGASSGLGAELAKYLTGRSESKLSTVTNCLSNNVGYR-ARDLASHQEVEQLFEQLDSIP--
1uluD           ------------------------------------------------ADVTQDEELDALFAGVKEAGGL
1fjhA           -------VISGCATGIGAATRKVLEAAGHQIVGIDIRDAE------VIADLSTAEGRKQAIADVLASKGM
3e9nC           ----KIAVVTGATGGMGIEIVKDLSR-DHIVYALGRN-----PEHL--AALAEIEGVEPIESDIVKE---
3ctmA           ----KVASVTGSSGGIGWAVAEAYAQAGADVIWYNSHPADGVHSKAYKCNISDPKSVEETISQQEKFGTI
3bzuD           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQL
1zmoA           ------ALVTHARHFAGPAAVEALTQDGYTVVAAERQRFESEPGTIALAEQKPERLVDATLQHGEA---I
2yw9B           ----KKALVMGVTRSLGFAIAAKLKEAG-AEVALSYQAERLRPXXXFRADVTQDEELDALFAGVKEAGGL
1uluC           ------------------------------------------------ADVTQDEELDALFAGVKEAGGL
1y5mA           MLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTAREGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQL
1so8A           --------------------------------------------------------------------RV
3ctmH           ----KVASVTGSSGGIGWAVAEAYAQAGADVIWYNSHPADGVHSKAYKCNISDPKSVEETISQQEKFGTI
3ctmF           ----KVASVTGSSGGIGWAVAEAYAQAGADVIWYNSHPADGVHSKAYKCNISDPKSVEETISQQEKFGTI
1w73A           ----------------------------------------------------DVQNTVSELIKVAGHPNI
3guyB           -------VITGASSGLGAELAKYLTGRSESKLSTVTNCLSNNVGYR-ARDLASHQEVEQLFEQLSIPS--
3ctmD           ----KVASVTGSSGGIGWAVAEAYAQAGADVIWYNSHPADGVHSKAYKCNISDPKSVEETISQQEKFGTI
3ctmB           ----KVASVTGSSGGIGWAVAEAYAQAGADVIWYNSHPADGVHSKAYKCNISDPKSVEETISQQEKFGTI
3e9nF           ----KIAVVTGATGGMGIEIVKDLSR---------DHIVYALGRPEHLAALAEIEGVEPIESDIVKE---
1xu9D           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3e9nH           ----KIAVVTGATGGMGIEIVKDLSR-DHIVYALGRN-----PEHL--AALAEIEGVEPIESDIVKE---
3d5qD           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2yw9D           ----KKALVMGVTRSLGFAIAAKLKEAG-AEVALSYQAERLRPXXXFRADVTQDEELDALFAGVKEAGGL
1xu9C           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
1xu9B           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
1xu9A           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
1xu7D           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
1xu7B           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
1xu7A           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2rbeD           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2rbeC           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2rbeB           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2rbeA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2irwC           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2irwA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2iltA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3hfgD           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3hfgC           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3hfgB           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3hfgA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3guyA           -------VITGASSGLGAELAKYLTGRSESKLSTVTNCLSNNVGYR-ARDLASHQEVEQLFEQLDSIP--
3frjA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3ey4C           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3ey4A           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3e9nE           ----KIAVVTGATGGMGIEIVKDLSR-DHIVYALGRN-----PEHL--AALAEIEGVEPIESDIVKE---
3d5qC           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3d5qB           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3d5qA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3d4nD           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3d4nC           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3d4nB           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3d4nA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3d3eB           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3d3eA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3czrA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3ch6E           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3ch6D           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3ch6B           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3ch6A           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3bzuC           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3bzuB           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3bzuA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
3byzA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2belD           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2belC           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2belB           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
2belA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
1a4uA           ---------------------------------------------------------------------V
2yw9A           ----KKALVMGVTRSLGFAIAAKLKEAG-AEVALSYQAERLRPXXXFRADVTQDEELDALFAGVKEAGGL
3e9nD           ----KIAVVTGATGGMGIEIVKDLSR-DHIVYALGRN-----PEHL--AALAEIEGVEPIESDIVKE---
2yw9E           ----KKALVMGVTRSLGFAIAAKLKEAG-AEVALSYQAERLRPXXXFRADVTQDEELDALFAGVKEAGGL
2dknB           -------------------LKELLARAGHTVIGIDRGQADSTPGGRETAVAAVLDRCGGVLDGLVCCAGV
2yw9C           ----KKALVMGVTRSLGFAIAAKLKEAG-AEVALSYQAERLRPXXXFRADVTQDEELDALFAGVKEAGGL
2yw9F           ----KKALVMGVTRSLGFAIAAKLKEAG-AEVALSYQAERLRPXXXFRADVTQDEELDALFAGVKEAGGL
3ek2D           --------------GIAKACKREGAELAFTYVGITEFAAEFGSELVFPCDVADDAQIDALFASLKTHDSL
1w73C           ----------------------------------------------------DVQNTVSELIKVAGHPNI
1n5dA           ----RVALVTGANKGIGFAIVRDLRQFAGDVVLTARDVAEGLSPRFHQLDIIDLQSIRALCDFLKEYGGL
3ek2B           --------------GIAKACKREGAELAFTYVGITEFAAEFGSELVFPCDVADDAQIDALFASLKTHDSL
3ek2A           --------------GIAKACKREGAELAFTYVGITEFAAEFGSELVFPCDVADDAQIDALFASLKTHDSL
3e9nB           ----KIAVVTGATGGMGIEIVKDLSR-DHIVYALGRN-----PEHL--AALAEIEGVEPIESDIVKE---
1w73D           ----------------------------------------------------DVQNTVSELIKVAGHPNI
2hrbA           ----RVALVTGANRGIGLAIARELRQFSGDVVLTARDVARGQAAQLQAEGLSPFHQLDIDDLQSIRALRL
3f1kA           ----RIILVTGASDGIGREAATY-ARYGATVIQVASHINEWFILDLLTCTSENCQQ----LAQRIAVNRL
1wmaA           ------ALVTGGNKGIGLAIVRDLCRLSGDVVLTARDVTRGQAAQLQAEGLSPFHQLDIDDLQSIRALRL
3bhmA           ------ALVTGGNKGIGLAIVRDLCRLSGDVVLTARDVTRGQAAQLQAEGLSPFHQLDIDDLQSIRALRL
1w73B           ----------------------------------------------------DVQNTVSELIKVAGHPNI
2pfgA           ------ALVTGGNKGIGLAIVRDLCRLSGDVVLTARDVTRGQAAQLQAEGLSPFHQLDIDDLQSIRALRL
2b37B           -----------------------------------------------------------VTEAIGAGNKL
2a4kB           ----------------------------------------------------------------------
2jjyB           -----TGLLSNKSIAYGIAKAMHREELAFTYVGQFKDRVEKLPAAVLPCDVISDQEIKDLFVELGKVDGL
3iahA           LLQNRIILVTGASDGIGREAALTYARYGATVIRVAQHIAQWFTLDLLTCTAEECRQ----VADRIAAPRL
1mg5A           -----------------------------------------------------IAETTKLLKTIFAQLKV
1i30A           --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
1lxcA           --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
2b35B           -----------------------------------------------------------VTEAIGAGNKL
2b35F           -----------------------------------------------------------VTEAIGAGNKL
2b36B           -----------------------------------------------------------VTEAIGAGNKL
2nwqC           -----TLFITGATSGFGEACARRFAEAGWSLVGRREERLQALAGELLTLXXXXXXXXXXXXNLPEEFATL
2nwqB           -----TLFITGATSGFGEACARRFAEAGWSLVGRREERLQALAGELLTLXXXXXXXXXXXXNLPEEFATL
2nwqA           -----TLFITGATSGFGEACARRFAEAGWSLVGRREERLQALAGELLTLXXXXXXXXXXXXNLPEEFATL
2jjyA           -----TGLLSNKSIAYGIAKAMHREELAFTYVGQFKDRVEKLPAAVLPCDVISDQEIKDLFVELGKVDGL
1qsgG           --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
1qsgA           --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
1qg6A           --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
2jjyC           -----TGLLSNKSIAYGIAKAMHREELAFTYVGQFKDRVEKLPAAVLPCDVISDQEIKDLFVELGKVDGL
3fneC           -----------------------------------------------------------VTEAIGAGNKL
3e9qB           ----RIILVTGASDGIGREAATY-ARYGATVIQVASHINEWFILDLLTCTSENCQQ----LAQVVNYPRL
3e9qA           ----RIILVTGASDGIGREAATY-ARYGATVIQVASHINEWFILDLLTCTSENCQQ----LAQVVNYPRL
1dfiA           --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
1c14A           --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
2b35C           -----------------------------------------------------------VTEAIGAGNKL
2h7iA           -----------------------------------------------------------VTEAIGAGNKL
3fnfD           -----------------------------------------------------------VTEAIGAGNKL
3fnfC           -----------------------------------------------------------VTEAIGAGNKL
3fnfB           -----------------------------------------------------------VTEAIGAGNKL
3fneD           -----------------------------------------------------------VTEAIGAGNKL
3fneB           -----------------------------------------------------------VTEAIGAGNKL
1enyA           -----------------------------------------------------------VTEAIGAGNKL
2b37C           -----------------------------------------------------------VTEAIGAGNKL
2b35E           -----------------------------------------------------------VTEAIGAGNKL
2b35D           -----------------------------------------------------------VTEAIGAGNKL
2b35A           -----------------------------------------------------------VTEAIGAGNKL
2aqiA           -----------------------------------------------------------VTEAIGAGNKL
2aqhA           -----------------------------------------------------------VTEAIGAGNKL
2aq8A           -----------------------------------------------------------VTEAIGAGNKL
1xseA           MLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSK------EALQKVVARCLELGAASAHYIAGSME
2jjyD           -----TGLLSNKSIAYGIAKAMHREELAFTYVGQFKDRVEKLPAAVLPCDVISDQEIKDLFVELGKVDGL
3g49A           MLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSK------EALQKVVARCLELGAASAHYIAGSME
3dwfC           MLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSK------EALQKVVARCLELGAASAHYIAGSME
3dwfB           MLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSK------EALQKVVARCLELGAASAHYIAGSME
3dwfA           MLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSK------EALQKVVARCLELGAASAHYIAGSME
2p91B           ----------------------------------------------------------------------
2fhsB           --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
2nv6A           -----------------------------------------------------------VTEAIGAGNKL
2aqkA           -----------------------------------------------------------VTEAIGAGNKL
2p91A           ----------------------------------------------------------------------
3grkA           ----------------------------------------------------------------------
1lx6A           --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF


                         .         .         *         .         .         .         .:140
query           DAVINNAGIALPQKLESLDLPSLQTVFDLNVRAAVQVTQACLPSLKQSPAGRIVNVCSRAIHGARDRTSY
1q7bA           DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVTMGNGGQANY
1i01E           DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVV-----GQANY
1q7cA           DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVTMGNGGQANF
1q7bB           DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVTMGNGGQANY
3gk3D           DVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSNGSRGAFGQANY
3gk3B           DVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSNGSRGAFGQANY
1i01B           DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTG---QANY
3gk3A           DVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSNGSRGAFGQANY
3gk3C           DVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSNGSRGAFGQANY
1uznA           EVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSSGLWGIGNQANY
1i01A           DILVNNANLLMRMKDEEWN-----DIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVV-------GTM
1gegE           DVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKEGHGGKIINACSQAGHGNPELAVY
1gegA           DVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKEGHGGKIINACSQAGHGNPELAVY
3ezlA           DVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSNGQKGQFGQTNY
1i01G           DILVNNADNLLMRMKDE----EWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITI------------GY
1i01F           DILVNNAGNLLMRMKDE----EWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVV----------
3ftpA           NVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVSAGNPGQVNY
1i01D           DILVNNDNLLMRMKDEEWN-----DIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVV-------ANY
1xr3B           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
2zk7B           SVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSQASIITKNASAY
1uzlA           EVLVSNAGLSADMTEEKFE-----KVINANLTGAFRVAQRASRSMQRNKFGRMIFIGS--VSGSWGQANY
2dteA           SVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSQASIITKNASAY
2p68A           DILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVFTGNVGQVNY
2ntnA           EVLVSNAGLMTEEKFEK--------VINANLTGAFRVAQRASRSMQRNKFGRMIFIASV-------QANY
1i01H           DILVNNADNLLMRMKDE----EWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITI------GA----NY
3ftpC           NVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVSAGNPGQVNY
2q2qH           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2uvdA           DILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVVTGNPGQANY
2rhrB           DVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
2q2wC           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
1i01C           DILVNNDNLLMRMKDEEWN-----DIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVV-------ANY
3ftpD           NVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVSAGNPGQVNY
3csdB           DVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
2q2vD           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
1edoA           DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
1uznB           EVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSSGLWGIGNQANY
1w4zB           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
1uzmA           EVLVSNAGLSARMTEEKFE-----KVINANLTGAFRVAQRASRSMQRNKFGRMIFIGS--VSG--NQANY
2q2wD           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2vC           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2qF           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2ph3A           DTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVILGNPGQANY
1x7gB           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
2q2qC           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2p68B           DILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVFTGNVGQVNY
2d1yC           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASQGLFAEQENAAY
1uzlB           EVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSSGSWGIGNQANY
2q2wA           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2qE           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2qB           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2d1yD           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASQGLFAEQENAAY
2yz7A           DILVNNAGIQHTAPIEEFPVDKWNAIIALNLSAVFHGTAAALPIMQKQGWGRIINIASHGLVASVNKSAY
1x7hB           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
1w4zA           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
2rh4B           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
2rh4A           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
2d1yB           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASQGLFAEQENAAY
2d1yA           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASQGLFAEQENAAY
1x7gA           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
2rhrA           DVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
2q2qA           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2vB           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2qG           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
1ae1B           NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSY
2q2vA           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2ntnB           EVLVSNAGLMTEEKFEK--------VINANLTGAFRVAQRASRSMQRNKFGRMIFIASV-------QANY
3f9iA           DILVCNAG-------------DFDKVIDINLKANFILNREAIKKMIQKRYGRIINISS-IVGGNPGQANY
1uzmB           EVLVSNAG------LSAMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFI------GSVSQANY
1iy8A           DGFFNNAGIEGKQNTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASGGIRGIGNQSGY
2hq1A           DILVNNAW---------------DDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSQA--------NY
3cxtA           DILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSY
2c07A           DILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVLTGNVGQANY
1o5iA           DILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGRIVAITSSVISPIENLYTS
3f9iB           DILVCNAGIT-----------DFDKVIDINLKANFILNREAIKKMIQKRYGRXXXXXXXXXXXXPGQANY
3cxrA           DILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSY
3i3oF           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
3i3oE           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
3i3oC           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
3i3oB           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
3i3oA           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
2ae2A           NILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISS--VSGALAEAVY
1ae1A           NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSY
2ztvC           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1ulsB           DGVVHYAGITR-DNFHWKPLEDWELVLRVNLTGSFLVAKAASEAREKNP-GSIVLTASRVYLGNLGQANY
1ulsA           DGVVHYAGITR-DNFHWKPLEDWELVLRVNLTGSFLVAKAASEAREKNP-GSIVLTASRVYLGNLGQANY
2cfcA           DVLVNNAGITGNSELHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVALVAFPGRSAY
2ztvD           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2pd6D           PSVVVSAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKGNVGQTNY
2pd6C           PSVVVSAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKGNVGQTNY
2ztvB           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2ztmC           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2zk7A           SVLVNNASMG-----------EWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISS-----VKNASAY
2ae1A           NILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISS--VSGALAEAVY
2ztlA           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
3i3oH           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
2ztmA           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2ph3B           DTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITS-VVGILGNPANY
1ulsC           DGVVHYAGITR-DNFHWKPLEDWELVLRVNLTGSFLVAKAASEAREKNP-GSIVLTASRVYLGNLGQANY
3ijrH           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
3ijrF           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
3ijrE           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
3ijrB           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
3ijrA           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
3grpA           DILVNNAGITVRMQDQDWD-----DVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIG------QTNY
2b4qA           DILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASARVINIGSVAGISAMGEQAY
2pd6B           PSVVVSAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKGNVGQTNY
1xg5C           DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGHIININSMSGHRVLPLSFY
2pd6A           PSVVVSAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKGNVGQTNY
2nm0A           EVLIANAGVTKDQLMSEEDFTS---VVETNLTGTFRVVKRANRAMLRAKKGRXXXXXXXXXXXXXXQANY
1x1tA           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1zemA           DFLFNNAGFAPVQDYPSDDFARVLTI---NVTGAFHVLKAVSRQMITQNYGRIVNTASMAVKGPPNMAAY
2ztmD           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2ztuC           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1vl8B           DTVVNAAGINRRHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDNPSIINIGSLTVEEVTNISAY
1vl8A           DTVVNAAGINRRHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDNPSIINIGSLTVEEVTNISAY
3i3oG           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDV--IINTASIAYEGNETLIDY
2ztmB           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2ztuD           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2ztuB           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1nffA           HVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSEGLAGTVACHGY
2zatA           DILVSNAAV---NPFFGNIIDATEEVWDVNVKATVLMTKAVVPEMKRXXXXXXXXXXXXAYHPFPNLGPY
3d3wA           DXXXXXXXXXXXQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLARGVPGAIVNVSSQSQRAVTNHSVY
1spxA           DILVNNAG----QSIESYD-----ATLNLNLRSVIALTKKAVPHL-SSTKGEIVNISSIALHATPDFPYY
3gafA           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
3imfB           DILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYIEKGIKGNIINVATYAWDAGPGVIHS
3gafD           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
2ztuA           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1xg5A           DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGHIININSMSGHRVLPLSFY
3imfA           DILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYIEKGIKGNIINVATYAWDAGPGVIHS
3gafF           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
2z1nB           DILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSTLLRPWQDLALS
1yxmD           NFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHS
1xkqB           DVLVNNAGAAIPDAFQGIDI--YHKTLKLNLQAVIEMTKKVKPHLVASK-GEIVNVSSIVAQAQPDFLYY
1xkqA           DVLVNNAGAAIPDAFQGIDI--YHKTLKLNLQAVIEMTKKVKPHLVASK-GEIVNVSSIVAQAQPDFLYY
1xhlA           DILVNNAGANLADGTANTDQPVYQKTFKLNFQAVIEMTQKTKEHLIKTK-GEIVNVSS-IVAGPQAHSGY
1x1eA           XXXXXXXXXNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLSVTTFTAGGPVPIPAY
3gafG           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
3gafC           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
3gafB           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
2et6A           HVIINNAGILRDASMKKMTEKDYKLVIDVHLNGAFAVTKAAWPYFQKQKYGRIVNTSSPALYGNFGQANY
2ekpA           XXXXXXXXXNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLSVTTFTAGGPVPIPAY
1cydA           DLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQVARDMINRGVPGSIVNVSSMVAHVTPNLITY
3emkA           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTPMMXXXXXXXXXXTSIVGVTGNPGQANY
2ekqD           XXXXXXXXXNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLSVTTFTAGGPVPIPAY
3ennA           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTPMMXXXXXXXXXXTSIVGVTGNPGQANY
2z1nA           DILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSTLLRPWQDLALS
3gafH           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
3gafE           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
3ennB           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTPMMXXXXXXXXXXTSIVGVTGNPGQANY
2c7vA           DVLVNNASAFYPTPLVQGKTVETQVLIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
1pr9A           DXXXXXXXXXXXQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLARGVPGAIVNVSSQCSQRATNHSVY
2c7vB           DVLVNNASAFYPTPLVQNGKTVETQVAELNAIAPFLLTMSFAQRQKTSSNLSIVNLCDAMVDQPMAFSLY
3emkD           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTPMMXXXXXXXXXXTSIVGVTGNPGQANY
1yxmB           NFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHS
1xg5B           DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGHIININSMSGHRVLPLSFY
1fmcA           DILVNNAGGGGPKPFD-MPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNNMTSY
2c7vD           DVLVNNASAFYPTPLVQGDHTQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
3bmqA           DVLVNNASAFYPTPLVQGKTVETQVLIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
3bmnA           DVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLY
1ahhA           DILVNNAGGGGPKPFD-MPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNNMTSY
1yxmA           NFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHS
1hdcA           DGLVNNAGISTGMFLETESVERFRKVVEINLTGVFIGMKTVIPAMKDAGGGSIVNISSAALMGLALTSSY
2b4qB           DILVNNAGTS--------PVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASARVINIGSVAGISAMGEQAY
3i4fD           DFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGFQGADSAPGRSAF
3grpB           DILVNNAGVRMQDQ-------DWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIG------QTNY
3ennD           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTPMMXXXXXXXXXXTSIVGVTGNPGQANY
3ennC           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTPMMXXXXXXXXXXTSIVGVTGNPGQANY
3imfC           DILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYIEKGIKGNIINVATYAWDAGPGVIHS
3bmjD           DVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSF--AQRQSNLS-IVNLCDAMVDQPMAFSLY
3i4fC           DFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGFQGADSAPGRSAF
3i4fA           DFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGFQGADSAPGRSAF
3bmoB           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTM----SFAQRQNLSIVNLCDAMVDQPMAFSLY
3bmfB           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTM----SFAQRQNLSIVNLCDAMVDQPMAFSLY
3bmeA           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTMSF--AQRQSNLS-IVNLCDAMVDQPMAFSLY
3bmeB           DVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTM----SFAQRQNLSIVNLCDAMVDQPCMAFSY
2ag5C           DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
2ag5B           DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
2ag5A           DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
3emkC           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTPMMXXXXXXXXXXTSIVGVTGNPGQANY
3emkB           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTPMMXXXXXXXXXXTSIVGVTGNPGQANY
3bmnD           DVLVNNASAFYPTPLVQGKTVETQVLIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPCMAFSY
3bmfD           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTMSF--AQRQSNLS-IVNLCDAMVDQPMAFSLY
3bmfC           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTM----SFAQRQNLSIVNLCDAMVDQPMAFSLY
1yxmC           EEEVNNSTLDTFGKINFLVNNGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNII---VPGFPLAVHS
3bmnC           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTMSFAQRQKSSNLS-IVNLCDAMVDQPCMAFSY
3bmiB           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTMSF--AQRQSSNLSIVNLCDAMVDQPCMAFSY
2wd7B           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTM----SFAQRQNLSIVNLCDAMVDQPCMAFSY
2ewmB           DILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWKIEAYTHY
2ewmA           DILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWKIEAYTHY
3bmoD           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTMSFAQRQKGSNLS-IVNLCDAMVDQPCMAFSY
3bmoC           DVLVNNASAFYPTPLVQGKTVETQVLIGTNAIAPFLLTMSFAQRQKSSNLS-IVNLCDAMVDQPCMAFSY
2c7vC           DVLVNNASAFYPTPLVQGGKTVETQVAELNAIAPFLLTMSFAQRQKGTNPNSIVNLCDAMVDQPMAFSLY
3bmdB           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTM----SFAQRQNLSIVNLCDAMVDQPCMAFSY
2wd7C           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTMSF--AQRQSNLS-IVNLCDAMVDQPCMAFSY
2vz0B           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTM----SFAQRQNLSIVNLCDAMVDQPCMAFSY
3gvcD           DKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTAY
3bmoA           DVLVNNASAFYPTPLVQGKTVETQVLIGTNAIAPFLLTMSFAQRQKGTTSSNIVNLCDAMVDQPCMAFSY
3grpC           -------------------------VLAVNLTAASTLTRELIHSMMRRRYGRIINITSI-------QTNY
2ew8B           DILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWKIEAYTHY
2ew8A           DILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWKIEAYTHY
3bmnB           DVLVNNASAFYPT-------PLVQNGKTVETQVAELITNAIAPFLRQKSNLSIVNLCDAMVDQPCMAFSY
3bmkC           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTMSFAQRQKNLS---IVNLCDAMVDQPCMAFSY
3bmfA           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTMSF--AQRQSNLS-IVNLCDAMVDQPCMAFSY
2vz0A           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTMSF--AQRQSNLS-IVNLCDAMVDQPCMAFSY
3bmqC           DVLVNNASAFYPTPLVQGGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSY
3gvcC           DKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTAY
3gvcB           DKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTAY
3bmeC           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTM----SFAQRQNLSIVNLCDAMVDQPMAFSLY
2a4kA           HGVAHFAGVAH----SALPLEAWEKVLRVNLTGSFLVARKAGEVLEEG--GSLVLTGSVAGLGAFGLAHY
3gvcA           DKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTAY
1nfrA           HVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKP-KEAGRGSIINISSEGLAGTVACHGY
3grpD           DILVNNAGID----------QDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSI-------QTNY
1k2wA           DILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMAGGRGGKIINMASQA--GRRGEALY
3iccA           DILINNAGIGPGAFIEETTEQFFDRV-SVNAKAPFFIIQQALSRLRDN--SRIINISSAATRSLPDFIAY
1g0nB           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1ybvA           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1g0oC           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1g0oA           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1dohB           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1dohA           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1bdbA           DTLIPNAGIDLPE--ESLDA-AFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLY
1xq1A           DILINNLG--------ALDYTAEDFSFHINLESAYHLSQLAHPLLKASGCGNIIFMSG---------SIY
1e6wD           DVAVNCAGIAVAKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPGVIINTASAAFEGQVGQAAY
1fdvB           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
2japC           DILVNNAGIMLLGPVEDADTTDWTRMIDTNLLGLMYMTRAALPHLLRS-KGTVVQMSSIAGRNVRNAAVY
2japA           DILVNNAGIMLLGPVEDADTTDWTRMIDTNLLGLMYMTRAALPHLLRS-KGTVVQMSSIAGRNVRNAAVY
1ydeP           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
1ydeM           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
1ydeI           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
1ydeH           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
1ydeG           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
1ydeF           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
1ydeD           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
1ydeA           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
1ydeN           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
1ydeB           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
1fduC           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1e6wC           DVAVNCAGIAVAKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPGVIINTASAAFEGQVGQAAY
1e6wA           DVAVNCAGIAVAKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPGVIINTASAAFEGQVGQAAY
1e3wA           DVAVNCAGIAVAKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPGVIINTASAAFEGQVGQAAY
1bhsA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1a27A           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
2p8kG           DVLVNNASSFYPTPLLRNDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1fdsA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1e6wB           DVAVNCAGIAVAKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPGVIINTASAAFEGQVGQAAY
1fdwA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1w0cG           DVLVNNASSFYPTPLLRNDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1uayB           -AVVSAAGVGLAEKILGKEGPSFRRVLEVNLLGTFNVLRLAAWAMRENPPGVIVNTASAAFEGQIGQAAY
1uayA           -AVVSAAGVGLAEKILGKEGPSFRRVLEVNLLGTFNVLRLAAWAMRENPPGVIVNTASAAFEGQIGQAAY
3gedB           DVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKN-KGRIINIASRAFQSEPDSEAY
3gedA           DVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKN-KGRIINIASRAFQSEPDSEAY
1zbqA           DVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASIYGNFGQANY
1u7tA           DVAVNCAGIAVASKTYNLKLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPGVIINTASAAFEGQVGQAAY
1qyxA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1qyvA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1jtvA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1iolA           DVLVCNXXXXXXXXXXXXXXDAVASVLEVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1fduD           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1fduB           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1fduA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1e92C           DVLVNNASSFYPTPLLRNDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1e7wB           DVLVNNASSFYPTPLLRGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
3deyX           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
2o23B           DVAVNCAGIAVASKTYNLKLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPGVIINTASAAFEGQVGQAAY
3g1tA           DGVLHNAGLLGEIGPMSEQDPQIQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
2dknA           GVTAANSGLVLDGLAEALSRGQQPAAVIVGSIAATQPGAAELPMVEAMLAGDEARAIELAEQQGQTHLAY
2bfaB           DVLVNNASSFYPTPLLRGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
3gz4B           DGVLHNAGLLGDVCPMSEQDPQVQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
3gz4A           DGVLHNAGLLGDVCPMSEQDPQVQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
3gegA           DVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKN-KGRIINIASRAFQSEPDSEAY
2o23A           DVAVNCAGIAVASKTYNLKLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPGVIINTASAAFEGQVGQAAY
1h5qA           SGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLLQKQQKGSIVVTXXXXXXXXXXQVFY
2bf7C           DVLVNNASSFYPTPLLEAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2p8kC           DVLVNNASSFYPTPLLRNDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2qhxC           DVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1ja9A           DFVMSNSGMEVWCDELEVTQELFDKVFNLNTRGQFFVAQQGLKHCRRG--GRIILTSSIAMTGIPNHALY
3diiA           DVLVNNA-CGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNK-GRIINIASRAFQSEPDSEAY
2bfoC           DVLVNNASSFYPTPLLR-DREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1w0cH           DVLVNNASSFYPTPLLRREAMETATLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2p8kH           DVLVNNASSFYPTPLNDGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
3f1lB           DGVLHNAGLLGDVCPMSEQNPQVQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
3f1lA           DGVLHNAGLLGDVCPMSEQNPQVQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
1e3sA           DVAVNCAGIAVAKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPGVIINTASAAFEGQVGQAAY
2bfoA           DVLVNNASSFYPTPLLRGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
3gy0A           DGVLHNAGLLGDVCPMSEQNPQVQDVMQINVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
1e92D           DVLVNNASSFYPTPLLRREAMETATLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2bfaD           DVLVNNASSFYPTPLLR-DREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1w0cE           DVLVNNASSFYPTPLRNGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2qhxA           DVLVNNASSFYPTPLEAMETATAD-LFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1gz6A           DVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHKKQN-YGRIITASASGIYGNFGQANY
2fwmX           DALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRGMSAY
2bfpB           DVLVNNASSFYPTPLLG-DREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2bfmC           DVLVNNASSFYPTPLLRREAMETATLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2bf7A           DVLVNNASSFYPTPLLG-DREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2qhxD           DVLVNNASSFYPTPLLR-DREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
3dijA           DVLVNNA-CGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNK-GRIINIASRAFQSEPDSEAY
2bfaA           DVLVNNASSFYPTPLLR-DREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1mxhA           DVLVNNASAYYPTPLLPPIDAQVAELFGSNAVAPLFLIRAF--ARRQSRNLSVVNLCDAMTDPLPGFCVY
1e92A           DVLVNNASSFYPTPLNDGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2bfaC           DVLVNNASSFYPTPLLRREAMETATLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2bf7D           DVLVNNASSFYPTPLLRREAMETATLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1yb1A           SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAY
1w0cC           DVLVNNASSFYPTPLLRNDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1gz6C           DVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHKKQN-YGRIITASASGIYGNFGQANY
1gz6B           DVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHKKQN-YGRIITASASGIYGNFGQANY
3f5qA           DGVLHNAGLLGDVCPMSEQDPQVQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
1e92B           DVLVNNASSFYPTPLLRREAMETATLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2bfpD           DVLVNNASSFYPTPLLRREAMETATLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2bf7B           DVLVNNASSFYPTPLEAMETATAD-LFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1g6kA           DVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGTVINMSS--VHEKIPWVHY
1w6uB           --VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLAQKGAAFLSITTIYAETGSGFVVPS
1w0cF           DVLVNNASSFYPTPLNDGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1w0cB           DVLVNNASSFYPTPLLRGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2p8kD           DVLVNNASSFYPTPLLRREAMETATLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
2p8kB           DVLVNNASSFYPTPLLRGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
3f5qB           DGVLHNAGLLGDVCPMSEQDPQVQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
1w6uC           --VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLAQKGAAFLSITTIYAETGSGFVVPS
1w6uA           --VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLAQKGAAFLSITTIYAETGSGFVVPS
1p33D           DVLVNNASSFYPTPLLRKDKESLEVLFGSNAIAPYFLIKAFAQRVADTRAEQIVNVDAMTSQPLLGYTMY
2bfmB           DVLVNNASSFYPTPLEAMETATAD-LFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1uluB           DYLVHAIAFA-PREAEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
1rwbA           DVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGTVINMSS--VHEKIPWVHY
1fk8A           DGLVLCAGLGPQTKV-------LGNVVSVNYFGATELMDAFLPALKKGQPXXXXXXXXXXXHLAFDKNAY
3f5sB           DGVLHNAGLLGDVCPMSEQNPQVQDVMQINVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
3f5sA           DGVLHNAGLLGDVCPMSEQNPQVQDVMQINVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
2p8kA           DVLVNNASSFYPTPLRNGDREAMETLFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1p33C           DVLVNNASSFYPRKKESLEVAAAD-LFGSNAIAPYFLIKAFAQRVADTRAEQIVNVDAMTSQPLLGYTMY
1p33B           DVLVNNASSFYPRKKESLEVAAAD-LFGSNAIAPYFLIKAFAQRVADTRAEQIVNVDAMTSQPLLGYTMY
2jahC           DILVNNAGILLGP-VEDADTTDW-TRIDTNLLGLY--TRAALPHLLRSK-GTVVQSSIAGRVNVRNAAVY
2jahA           DILVNNAGILLGP-VEDADTTDW-TRIDTNLLGLY--TRAALPHLLRSK-GTVVQSSIAGRVNVRNAAVY
1e7wA           DVLVNNASSFYPTPLEAMETATAD-LFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1geeA           DVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGTVINMSS--VHEKIPWVHY
1gcoA           DVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGTVINMSS--VHEKIPWVHY
3e03C           DILVNNASAIWLRG--TLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPHILTLANPAWWGA--HTGY
3e03B           DILVNNASAIWLRG--TLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPHILTLANPAWWGA--HTGY
3e03A           DILVNNASAIWLRG--TLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPHILTLANPAWWGA--HTGY
1p33A           DVLVNNASSFYPTPLESLEVAAAD-LFGSNAIAPYFLIKAFAQRVADTRAEQIVNVDAMTSQPLLGYTMY
1yb1B           SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAHV-SVPFLLAY
1mxfA           DVLVNNASAYYPTPLLPKPIDAVAELFGSNAVAPLFLIRAFARRQNLS----VVNLCDATDLPLPGFCVY
1w6uD           --VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLAQKGAAFLSITTIYAETGSGFVVPS
2ehdB           SALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSLAKNPFKGGAAY
1zjyA           STLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGAIINMSSEGFVGDPSLGAY
1w0cA           DVLVNNASSFYPTPLLRNDVGDREAMFGSNAIAPYFLIKAFAHRVAGTPAKHIINMVDAMTNQPLGYTIY
1nxqA           STLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGAIINMSSEGFVGDPSLGAY
3e9nA           --VLEEGGVDKLKNLDHVDVAEWHAHLDLNVIVPAELSRQLLPALRAA-SGCVIYI---------NNTIY
1uluA           DYLVHAIAFA-PREAEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
2gdzA           DILVNNAGVNNEKNWEK--------TLQINLVSVISGTYLGLDYMSKQNGGEIINMSSLALMPVAQQPVY
3ek2C           DGLVHSIGFAPREALDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLLTLSYLG-AERAIPNYNTM
3edmB           HGLVHVAGGLIARKIAEMDEAFWHQVLDVNLTSLFLTAKTALP--KMAKGGAIVTFSSQAGRGGPGALAY
3edmA           HGLVHVAGGLIARKIAEMDEAFWHQVLDVNLTSLFLTAKTALP--KMAKGGAIVTFSSQAGRGGPGALAY
2yw9H           DYLVHAIAFAPREAMEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
2ehdA           SALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSLAKNPFKGGAAY
2bd0A           DCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGHIFFITSVAATKARHSSIY
2bgkA           DIMFGNVGVTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSY
3guyH           STVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVNVVMIMSTAAQQPKAQESTY
3guyG           STVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVNVVMIMSTAAQQPKAQESTY
3guyD           STVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVNVVMIMSTAAQQPKAQESTY
3guyC           STVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVNVVMIMSTAAQQPKAQESTY
1uluD           DYLVHAIAFA-PREAEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
1fjhA           DGLVLCAGLGPQTKV-------LGNVVSVNYFGATELMDAFLPALKKGQPXXXXXXXXXXXHLAFDKNAY
3e9nC           --VLEEGGVDKLKNLDHVDVAEWHAHLDLNVIVPAELSRQLLPALRAA-SGCVIYI---------NNTIY
3ctmA           DVFVANAGVTWTQEIDVDNYDSWNKIISVDLNGVYYCSHXXXXXXXXXXXXSLIITSSISGKIVQLQAPY
3bzuD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
1zmoA           DTIVSNDYIPRPMNLEGTSEADIRQMFEALSIFPILLLQSAIAPLRAAGGASVIFITSSV--GKKPNPLY
2yw9B           DYLVHAIAFAPREAMEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
1uluC           DYLVHAIAFA-PREAEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
1y5mA           DMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQS-NGSIAVISSLAGKMTQPMIAY
1so8A           DVAVNCAGI-------------FQRVLDVNLMGTFNVIRLVAGEMGQNEPGVIINTASAAFEGQVGQAAY
3ctmH           DVFVANAGVTWTQKIISVDLNGVYYCSHXXXXXXXXXXXXSL-IITSSISGKIVNI-------PQLQAPY
3ctmF           DVFVANAGVTWTQKIISVDLNGVYYCSHXXXXXXXXXXXXSL-IITSSISGKIVNI-------PQLQAPY
1w73A           --VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAF-LSITTIYAETGSGFV
3guyB           -TVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVNVVMIMSTAAQQPKAQESTY
3ctmD           DVFVANAGVTWTQKIISVDLNGVYYCSHXXXXXXXXXXXXSL-IITSSISGKIVNI-------PQLQAPY
3ctmB           DVFVANAGVTWTQKIISVDLNGVYYCSHXXXXXXXXXXXXSL-IITSSISGKIVNI-------PQLQAPY
3e9nF           --VLEEGGVDKLKNLDHVDVAEWHAHLDLNVIVPAELSRQLLPAL------RAASGCVIYING---NTIY
1xu9D           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3e9nH           --VLEEGGVDKLKNLDHVDVAEWHAHLDLNVIVPAELSRQLLPAL------RAASGCVIYING---NTIY
3d5qD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2yw9D           DYLVHAIAFAPREAMEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
1xu9C           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
1xu9B           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
1xu9A           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
1xu7D           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
1xu7B           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
1xu7A           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2rbeD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2rbeC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2rbeB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2rbeA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2irwC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2irwA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2iltA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3hfgD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3hfgC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3hfgB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3hfgA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3guyA           STVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVNVVMIMSTAAQQPKAQESTY
3frjA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3ey4C           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3ey4A           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3e9nE           --VLEEGGVDKLKNLDHVDVAEWHAHLDLNVIVPAELSRQLLPAL------RAASGCVIYING---NTIY
3d5qC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3d5qB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3d5qA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3d4nD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3d4nC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3d4nB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3d4nA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3d3eB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3d3eA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3czrA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3ch6E           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3ch6D           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3ch6B           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3ch6A           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3bzuC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3bzuB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3bzuA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
3byzA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2belD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2belC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2belB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
2belA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
1a4uA           DILINGAGI--------LDDHQIERTIAINFTGLVNTTTAILDKRKGGPGGIIANICSNAIHQV---PVY
2yw9A           DYLVHAIAFAPREAMEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
3e9nD           --VLEEGGVDKLKNLDHVDVAEWHAHLDLNVIVPAELSRQLLPALRAA-SGCVIYI---------NNTIY
2yw9E           DYLVHAIAFAPREAMEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
2dknB           NSAVNYFGVSLDGLAEALSRGQQPAAVIVGSIAATQPGAAELPMVEAMLAGDEARAIELAEQQGQTHLAY
2yw9C           DYLVHAIAFAPREAMEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
2yw9F           DYLVHAIAFAPREAMEGIDTRRQDWLLALEVSALVAVARRAEPLLREG--GGIVTLTYYASEKVVPKYNV
3ek2D           DGLVHSIGFAPREALDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLLTLSYLG-AERAIPNYNTM
1w73C           --VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAF-LSITTIYAETGSGFV
1n5dA           DVLVNNAAIAF-----QLDNPTAELTMKTNFMGTRNVCTELLPLIK--PQGRVVNVSS------------
3ek2B           DGLVHSIGFAPREALDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLLTLSYLG-AERAIPNYNTM
3ek2A           DGLVHSIGFAPREALDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLLTLSYLG-AERAIPNYNTM
3e9nB           --VLEEGGVDKLKNLDHVDVAEWHAHLDLNVIVPAELSRQLLPALRAA-SGCVIYI---------NNTIY
1w73D           --VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAF-LSITTIYAETGSGFV
2hrbA           NVLVNNAAVAFPMPFDIKAEMTLKT----NFFATRNMCNELLPIMK--PHGRVVNISS------------
3f1kA           DGVLHNAGL-LGDVCPSEQNPQVWQDVQVNVNATF-LTQAXXXXXXKSDAGSLVFTSSSGRQGRANWGAY
1wmaA           DVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIK--PQGRVVNVSS------------
3bhmA           DVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIK--PQGRVVNVSS------------
1w73B           --VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAF-LSITTIYAETGSGFV
2pfgA           DVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVTE-LLPLIK--PQGRVVNVSS------------
2b37B           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2a4kB           ----------------------------------------------------------------------
2jjyB           DAIVHSIAFAPRDQLEGVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTM
3iahA           DGVLHNAGL-LGEIGPSEQDPQIWQDVQVNVNATF-LTQAXXXXXXKSDAGSLVFTSSSGRQGRANWGAY
1mg5A           DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
1i30A           DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
1lxcA           DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
2b35B           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2b35F           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2b36B           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2nwqC           RGLINNAGLALTDPAQSCDLDDWDTV-DTNIK--------------------------------------
2nwqB           RGLINNAGLALTDPAQSCDLDDWDTV-DTNIK--------------------------------------
2nwqA           RGLINNAGLALTDPAQSCDLDDWDTV-DTNIK--------------------------------------
2jjyA           DAIVHSIAFAPRDQLEGVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTM
1qsgG           DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
1qsgA           DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
1qg6A           DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
2jjyC           DAIVHSIAFAPRDQLEGVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTM
3fneC           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
3e9qB           DGVLHNAGL-LGDVCPSEQNPQVWQDVQINVNATF-LTQAXXXXXXKSDAGSLVFTSSSGRQGRANWGAY
3e9qA           DGVLHNAGL-LGDVCPSEQNPQVWQDVQINVNATF-LTQAXXXXXXKSDAGSLVFTSSSGRQGRANWGAY
1dfiA           DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
1c14A           DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
2b35C           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2h7iA           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
3fnfD           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
3fnfC           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
3fnfB           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
3fneD           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
3fneB           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
1enyA           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2b37C           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2b35E           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2b35D           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2b35A           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2aqiA           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2aqhA           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2aq8A           DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
1xseA           DMTFAEEFVALMGGLDMLEIDNVRKSMEVNFHSFVVLSVAAMPMLMQS-QGSIAVVSSVAGKITYPLIAY
2jjyD           DAIVHSIAFAPRDQLEGVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTM
3g49A           DMTFAEEFVALMGGLDMLEIDNVRKSMEVNFHSFVVLSVAAMPMLMQS-QGSIAVVSSVAGKITYPLIAY
3dwfC           DMTFAEEFVALMGGLDMLEIDNVRKSMEVNFHSFVVLSVAAMPMLMQS-QGSIAVVSSVAGKITYPLIAY
3dwfB           DMTFAEEFVALMGGLDMLEIDNVRKSMEVNFHSFVVLSVAAMPMLMQS-QGSIAVVSSVAGKITYPLIAY
3dwfA           DMTFAEEFVALMGGLDMLEIDNVRKSMEVNFHSFVVLSVAAMPMLMQS-QGSIAVVSSVAGKITYPLIAY
2p91B           ---------------------------DISVYSLIALTRELLPLME----GRNGAIVTLSYYGAEKVVPH
2fhsB           DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
2nv6A           DGVVHAIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2aqkA           DGVVHAIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
2p91A           ---------------------------DISVYSLIALTRELLPLME----GRNGAIVTLSYYGAEKVVPH
3grkA           ----------------------------------------------------------------------
1lx6A           DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM


                         +         .         .         .         .         *         .:210
query           AAAKSALIGVTRTWALELAPLGITANAVAPGPVETELFRLTHPVGSDEEKRILATIPMQRLGKPEEVASL
1q7bA           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETD---MTRALSDDQRAGILAQVPAGRLGGAQEIANA
1i01E           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETD---MTRALSDDQRAGILAQVPAGRLGGAQEIANA
1q7cA           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETD---MTRALSDDQRAGILAQVPAGRLGGAQEIANA
1q7bB           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR-----SDDQRAGILAQVPAGRLGGAQEIANA
3gk3D           ASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAM---VEAVPQDVEAKILPQIPVGRLGRPDEVAAL
3gk3B           ASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAM---VEAVPQDVEAKILPQIPVGRLGRPDEVAAL
1i01B           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIET---------SDDQRAGILAQVPAGRLGGAQEIANA
3gk3A           ASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMV---------EAAKILPQIPVGRLGRPDEVAAL
3gk3C           ASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVA-----------KILPQIPVGRLGRPDEVAAL
1uznA           AASKAGVIGMARSIARELSKANVTANVVAPGYIDTD---MTRALDERIQQGALQFIPAKRVGTPAEVAGV
1i01A           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETD---MTRALSDDQRAGILAQVPAGRLGGAQEIANA
1gegE           SSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGRITLGRLSEPEDVAAC
1gegA           SSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGRITLGRLSEPEDVAAC
3ezlA           STAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRP---DVLEKIVATIPVRRLGSPDEIGSI
1i01G           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETD---MTRALSDDQRAGILAQVPAGRLGGAQEIANA
1i01F           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETD---MTRALSDDQRAGILAQVPAGRLGGAQEIANA
3ftpA           AAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTD---MTKGLPQEQQTALKTQIPLGRLGSPEDIAHA
1i01D           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETAL-------SDDQRAGILAQVPAGRLGGAQEIANA
1xr3B           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREVSTEEADRITARVPIGRYVQPSEVAEM
2zk7B           VTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAEVGSDPEKKISEEHPMQRIGKPQEVASA
1uzlA           AASKAGVIGMARSIARELSKANVTANVVAPGYIDTD---MTRALDERIQQGALQFIPAKRVGTPAEVAGV
2dteA           VTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAEVGSDPEKKISEEHPMQRIGKPQEVASA
2p68A           STTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETD---MTAVLSEEIKQKYKEQIPLGRFGSPEEVANV
2ntnA           AASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDQQGA------LQFIPAKRVGTPAEVAGV
1i01H           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALQRAG------ILAQVPAGRLGGAQEIANA
3ftpC           AAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTK-------EQQTALKTQIPLGRLGSPEDIAHA
2q2qH           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPPLQAQHDLLAEKQ-------PSLAFVTPEHLGEL
2uvdA           VAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATD---MTDVLDENIKAEMLKLIPAAQFGEAQDIANA
2rhrB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHTEEAFDRITARVPIGRYVQPSEVAEM
2q2wC           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDGGDQHDLLAEKQPSLAFVTPEHLGEL
1i01C           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR--------ARAGILAQVPAGRLGGAQEIANA
3ftpD           AAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDT-----------DEQQTALKTIPLGRLGSPEDIAHA
3csdB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHTEEAFDRITARVPIGRYVQPSEVAEM
2q2vD           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRQAQHDLLAEKQPSLAFVTPEHLGEL
1edoA           AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRTGQPENVAGL
1uznB           AASKAGVIGMARSIARELSKANVTANVVAPGYIDT----------------ALQFIPAKRVGTPAEVAGV
1w4zB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYTEEADRITARVPIGRYVQPSEVAEM
1uzmA           AASKAGVIGMARSIARELSKANVTANVVAPGYIDTD---MTRALDERIQQGALQFIPAKRVGTPAEVAGV
2q2wD           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQIDDPLQAQHD-LLAEKQPSLAFVTPEHLGEL
2q2vC           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRLQAQHDLLAKQPSLAFVTPEHLGEL
2q2qF           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLAQ--HDLLAEKQ-------PSLAFVTPEHLGEL
2ph3A           VASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETE---MTERLPQEVKEAYLKQIPAGRFGRPEEVAEA
1x7gB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPM-----AASVREFDRITARVPIGRYVQPSEVAEM
2q2qC           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQAQHDLLAEKQ-------PSLAFVTPEHLGEL
2p68B           STTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVL--------QKYKEQIPLGRFGSPEEVANV
2d1yC           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIALSPDPERRDWEDLALRRLGKPEEVAEA
1uzlB           AASKAGVIGMARSIARELSKANVTANVVAPGYIDT----------------ALQFIPAKRVGTPAEVAGV
2q2wA           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQIDDRNGGDQHDLLAEKQPSLAFVTPEHLGEL
2q2qE           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQIDDRALQAQHDLLAEKQPSLAFVTPEHLGEL
2q2qB           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVRAGDPLQAQHD-LLAEKQPSLAFVTPEHLGEL
2d1yD           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIATRRDWED----LHALRRLGKPEEVAEA
2yz7A           VAAKHGVVGLTKVTALENAGKGITCNAICPGWVRTPLVEISQQKGIDIERELLAKQPSLQFVTPEQLGGA
1x7hB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDEEDRITARVPIGRYVQPSEVAEM
1w4zA           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDEEDRITARVPIGRYVQPSEVAEM
2rh4B           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDEEDRITARVPIGRYVQPSEVAEM
2rh4A           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDEEDRITARVPIGRYVQPSEVAEM
2d1yB           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIRTRRDWED----LHALRRLGKPEEVAEA
2d1yA           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATE--AVLEAIARRDWEDLHA---LRRLGKPEEVAEA
1x7gA           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDEEDRITARVPIGRYVQPSEVAEM
2rhrA           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDEEDRITARVPIGRYVQPSEVAEM
2q2qA           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKRDPLQAQHD-LLAEKQPSLAFVTPEHLGEL
2q2vB           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQIDDRAAGDQHDLLAEKQPSLAFVTPEHLGEL
2q2qG           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQRAAPLQAQHD-LLAEKQPSLAFVTPEHLGEL
1ae1B           SASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETANPHQKEEIDNFIVKTPMGRAGKPQEVSAL
2q2vA           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKRAANGGDQHDLLAEKQPSLAFVTPEHLGEL
2ntnB           AASKAGVIGMARSIARELSKANVTANVVAPGYIDT-----------------LQFIPAKRVGTPAEVAGV
3f9iA           CASKAGLIGMTKSLSYEVATRGITVNAVAPGFIK---------LNEKQREAIVQKIPLGTYGIPEDVAYA
1uzmB           AASKAGVIGMARSIARELSKANVTANVVAPGYIDT----------------ALQFIPAKRVGTPAEVAGV
1iy8A           AAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPRFIQVNPSKRYGEAPEIAAV
2hq1A           AASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTD---MTDVLPDKVKEMYLNNIPLKRFGTPEEVANV
3cxtA           AAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATP---QTHPF----DQFIIAKTPAARWGEAEDLMGP
2c07A           SSSKAGVIGFTKSLAKELASRNITVNAIAPGFISS--------ISEQIKKNIISNIPAGRMGTPEEVANL
1o5iA           NSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETE--RVKELLSEEKKKQVESQIPMRRMAKPEEIASV
3f9iB           CASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSD---MTDKLNEKQREAIVQKIPLGTYGIPEDVAYA
3cxrA           AAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIQTAPLRELHPF----DQFIIAKTPAARWGEAEDLMGP
3i3oF           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLI----PSSFDEKKQFGSNVPMQRPGQPYELAPA
3i3oE           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLI----PSSFDEKKQFGSNVPMQRPGQPYELAPA
3i3oC           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLI----PSSFDEKKQFGSNVPMQRPGQPYELAPA
3i3oB           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLI----PSSFDEKKQFGSNVPMQRPGQPYELAPA
3i3oA           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLI----PSSFDEKKQFGSNVPMQRPGQPYELAPA
2ae2A           GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTDPEQKENLNKLIDRCALRRMGEPKELAAM
1ae1A           SASKGAINQMTKSLACEWAKDNIRVNSVAPGVI----------LQKEEIDNFIVKTPMGRAGKPQEVSAL
2ztvC           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISAGVDQETAARELLPSLQFVTPEQLGGT
1ulsB           AAS-AGVVGLTRTLALELGRWGIRVNTLAPGFIETRTAKVPEKV---REKAIAAT-PLGRAGKPLEVAYA
1ulsA           AAS-AGVVGLTRTLALELGRWGIRVNTLAPGFIETRTAKVPEKV---REKAIAAT-PLGRAGKPLEVAYA
2cfcA           TTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMWRLDQPELRDQ---VLARIPQKEIGTAAQVADA
2ztvD           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISVDQETAARELLSQPSLQFVTPEQLGGT
2pd6D           AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATP---MTQKVPQKVVDKITEMIPMGHLGDPEDVADV
2pd6C           AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATP---MTQKVPQKVVDKITEMIPMGHLGDPEDVADV
2ztvB           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKTAARELLSEKQ-----PSLQFVTPEQLGGT
2ztmC           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPL--VEKQISALAEKELLSKQPSLQFVTPEQLGGT
2zk7A           VTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAEVGSDPEKKISEEHPMQRIGKPQEVASA
2ae1A           GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATQ-----DPEQKENLNKLIDRCALRRMGEPKELAAM
2ztlA           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVELAEKNGVDQETAARELLPSLQFVTPEQLGGT
3i3oH           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWT-------PLIPSSFSQFGSNVPMQRPGQPYELAPA
2ztmA           VAAKHGVVGFTKVTALETAGQGITANAICPGLVEKQISALAEKNGVDQETAARELLPSLQFVTPEQLGGT
2ph3B           VASKAGLIGFTRAVAKEYAQRGITVNAV----IETEM---TERLPQEVKEAYLKQIPAGRFGRPEEVAEA
1ulsC           AAS-AGVVGLTRTLALELGRWGIRVNTLAPGFIETP--------EKVREKAIAAT-PLGRAGKPLEVAYA
3ijrH           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLI----PSSFDEKKQFGSNVP-QRPGQPYELAPA
3ijrF           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLI----PSSFDEKKQFGSNVP-QRPGQPYELAPA
3ijrE           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLI----PSSFDEKKQFGSNVP-QRPGQPYELAPA
3ijrB           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLI----PSSFDEKKQFGSNVP-QRPGQPYELAPA
3ijrA           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLI----PSSFDEKKQFGSNVP-QRPGQPYELAPA
3grpA           CAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKS---AMTDKLNEKQKEAIMAMIPMKRMGIGEEIAFA
2b4qA           APSKAALHQLSRMLAKELVGEHINVNVIAPGRFPS---RMTRHIANDPQEADSASIPMGRWGRPEEMAAL
2pd6B           AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATP---MTQKVPQKVVDKITEMIPMGHLGDPEDVADV
1xg5C           SATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFKLH---DKDPEKAAATYEQMKCLKPEDVAEA
2pd6A           AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM-------------KITEMIPMGHLGDPEDVADV
2nm0A           AASKAGLVGFARSLARELGSRNITFNVVAPGFVDT------------QRANIVSQVPLGRYARPEEIAAT
1x1tA           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRTLL----------SEKQ-----PSLQFVTPEQLGGT
1zemA           GTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMELQAKVGSQVAQQMIGSVPMRRYGDINEIPGV
2ztmD           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLV----------EKQISAKQPSLQFVTPEQLGGT
2ztuC           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRQE---------TAARELLSEKQPSLQFVTPEQLGGT
1vl8B           AASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRT---KMTEAVFSDPEKYMLKRIPLGRTGVPEDLKGV
1vl8A           AASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRT---KMTEAVFSDPEKYMLKRIPLGRTGVPEDLKGV
3i3oG           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPG-----------PIGSN--------VPMQRPGQPYELAPA
2ztmB           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRSARELLS-------EKQ-----PSLQFVTPEQLGGT
2ztuD           VAAKHGVVGFTKVTALETAGQGITANAICPGWVETAARELL------SEKQ-----PSLQFVTPEQLGGT
2ztuB           VAAKHGVVGFTKVTALETAGQGITANAICPGWVELL-----------SEKQ-----PSLQFVTPEQLGGT
1nffA           TATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPM--------TDWVPEDIFQTALGRAAEPVEVSNL
2zatA           NVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLW-MDKARKEYMKESLRIRRLGNPEDCAGI
3d3wA           CSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWS-DPHKAKTMLNRIPLGKFAEVEHVVNA
1spxA           SIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFY--------STMATMKECVPAGVMGQPQDIAEV
3gafA           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTD--ALATVLTPEIERAMLKHTPLGRLGEAQDIANA
3imfB           AAAKAGVLA-TKTLAVEWGKYGIRVNAIAPGPIE-------RTGGADEEKRTIQSVPLGRLGTPEEIAGL
3gafD           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDV--LTPEI----ERAMLKHTPLGRLGEAQDIANA
2ztuA           VAAKHGVVGFTKVTALETAGQGITANAICPGWV-----RLL------SEKQ-----PSLQFVTPEQLGGT
1xg5A           SATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFKLH--DKDPEK---AAATYECL-KPEDVAEA
3imfA           AAAKAGVLA-TKTLAVEWGKYGIRVNAIAPGPIER--------TGGAEAKRTIQSVPLGRLGTPEEIAGL
3gafF           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDAV-LTPEI----ERAMLKHTPLGRLGEAQDIANA
2z1nB           NIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVR---------SLSMASRIPMGRVGKPEELASV
1yxmD           GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSGQSFFEGSFQKIPAKRIGVPEEVSSV
1xkqB           AIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVET---GFTNAMGMPDQANFMASIPIGAAGKPEHIANI
1xkqA           AIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVET---GFTNAMGMPDQANFMASIPIGAAGKPEHIANI
1xhlA           ACAKAALDQYTRCTAIDLIQHGVRVNSVSPGAVETASDKLYSFIGSRKE-----CIPVGHCGKPEEIANI
1x1eA           TTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETE---FTLPLRQNPEEPITARIPMGRWARPEEIARV
3gafG           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDT--------PEIERAMLKHTPLGRLGEAQDIANA
3gafC           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDT--------PEIERAMLKHTPLGRLGEAQDIANA
3gafB           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTD---------PEIERAMLKHTPLGRLGEAQDIANA
2et6A           ASAKSALLGFAETLAKEGAKYNIKANAIAP------LAR------SRMTESIMPPPMLEKLG-PEKVAPL
2ekpA           TTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETE---FTLPLRQNPEEPITARIPMGRWARPEEIARV
1cydA           SSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGK---KVSADPERKLKERHPLRKFAEVEDVVNS
3emkA           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAM--------EKQKDAIMGNIPMKRMGVGADIAAA
2ekqD           TTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETELY-----------EPITARIPMGRWARPEEIARV
3ennA           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIE-----------SKQKDAIMGNIPMKRMGVGADIAAA
2z1nA           NIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVR---------------RIPMGRVGKPEELASV
3gafH           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKT----------PEIERAMLKHTPLGRLGEAQDIANA
3gafE           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTT---------PEIERAMLKHTPLGRLGEAQDIANA
3ennB           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIES---------NEKQKDAIMGNIPMKRMGVGADIAAA
2c7vA           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
1pr9A           CSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWS-DPHKAKTMLNRIPLGKFAEVEHVVNA
2c7vB           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3emkD           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIEEK-----------QKDAIMGNIPMKRMGVGADIAAA
1yxmB           GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAQSFFE-GSFQK------IPAKRIGVPEEVSSV
1xg5B           SATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFKLH----------------MKCLKPEDVAEA
1fmcA           ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTD--ALKSVITPEIEQKMLQHTPIRRLGQPQDIANA
2c7vD           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmqA           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmnA           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
1ahhA           ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTD--ALKSVITPEIEQKMLQHTPIRRLGQPQDIANA
1yxmA           GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSGQSFFEGSFQKIPAKRIGVPEEVSSV
1hdcA           GASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTP---MTAETGIRQGEGNYPNTPMGRVGEPGEIAGA
2b4qB           APSKAALHQLSRMLAKELVGEHINVNVIAPGRFPS---RMTRHIANDPQEADSASIPMGRWGRPEEMAAL
3i4fD           AAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEAT----IQEARQLIG-----RSGTGEDIART
3grpB           CAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKS---------------AIMAMIPMKRMGIGEEIAFA
3ennD           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIEKD--------------AIMGNIPMKRMGVGADIAAA
3ennC           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIEKD--------------AIMGNIPMKRMGVGADIAAA
3imfC           AAAKAGVLA-TKTLAVEWGKYGIRVNAIAPGPIE-------------RAKRTIQSVPLGRLGTPEEIAGL
3bmjD           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3i4fC           AAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEAT-----IQEARQL------RSGTGEDIART
3i4fA           AAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEAT-----IQEARQL------RSGTGEDIART
3bmoB           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmfB           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmeA           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmeB           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
2ag5C           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTSLQERIQARGNPEEARFLKRQKTGRFATAEEIAML
2ag5B           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTSLQERIQARGNPEEARFLKRQKTGRFATAEEIAML
2ag5A           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTSLQERIQARGNPEEARFLKRQKTGRFATAEEIAML
3emkC           CASKAGLIGFSKSLAQEIASRNVTVNCIAPG-------------FEKQKDAIMGNIPMKRMGVGADIAAA
3emkB           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFI---------------KDAIMGNIPMKRMGVGADIAAA
3bmnD           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmfD           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmfC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGV----------SLGEEEKDKWRRKVPLRREASAEQIADA
1yxmC           GAARAGVYNLTKSLALEWACSGIRINCVAPGVIQTAVFE-----GSFQK------IPAKRIGVPEEVSSV
3bmnC           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmiB           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
2wd7B           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
2ewmB           ISTKAANIGFTRALASDLGKDGITVNAIAPSLVRT-----------------------------------
2ewmA           ISTKAANIGFTRALASDLGKDGITVNAIAPSLVRT-----------------------------------
3bmoD           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmoC           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
2c7vC           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmdB           NMGKHALVGLTQSAALELAPYGIRVNGVAPG------VSLLPAMGEEEKDKWRRKVPLRREASAEQIADA
2wd7C           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
2vz0B           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3gvcD           GMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAGGA----RSMIARLQGRMAAPEEMAGI
3bmoA           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3grpC           CAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKKE--------------AIMAMIPMKRMGIGEEIAFA
2ew8B           ISTKAANIGFTRALASDLGKDGITVNAIAPSLV-------------------------------------
2ew8A           ISTKAANIGFTRALASDLGKDGITVNAIAPSLV-------------------------------------
3bmnB           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmkC           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmfA           NMGKHALVGLTQSAALELAPYGIRVNGVAPG------VSLLPAMGEEEKDKWRRKVPLRREASAEQIADA
2vz0A           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3bmqC           NMGKHALVGLTQSAALELAPYGIRVNGVAPG-----VSLLPVAMGEEEKDKWRRKVPLRREASAEQIADA
3gvcC           GMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMGALGGARSMIARLQGRMAAPEEMAGI
3gvcB           GMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMGALGGARSMIARLQGRMAAPEEMAGI
3bmeC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGSLLPDKWRRKVPLG-------------RREASAEQIADA
2a4kA           AAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQE---VGASPLGRAGRPEEVAQA
3gvcA           GMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFGGARSMIARL--QGRMAAPEEMAGI
1nfrA           TATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTP---------TDWVPEDIFQTALGRAAEPVEVSNL
3grpD           CAAKAGLIGFSKALAQEIASRNITVNCIAPG--------------------FIKMIPMKRMGIGEEIAFA
1k2wA           CATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKFADYERQVGAAVPFGRMGRAEDLTGM
3iccA           ST--KGAINTTFTLAKQLGARGITVNAILPGFVKTDNAELL----SDPKQYATTISAFNRLGEVEDIADT
1g0nB           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHA-------DEYAAVQWSPLRRVGLPIDIARV
1ybvA           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGSNEEVDEYAAVPLRRVGLPIDIARV
1g0oC           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGSNEEVDEYAAVPLRRVGLPIDIARV
1g0oA           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGSNEEVDEYAAVPLRRVGLPIDIARV
1dohB           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGSNEEVDEYAAVPLRRVGLPIDIARV
1dohA           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGSNEEVDEYAAVPLRRVGLPIDIARV
1bdbA           TAAKHAIVGLVRELAFELAPY-VRVNGVGSGGINSDL-RGPSSLGPLAD-MLKSVLPIGRMPEVEEYTGA
1xq1A           SATKGALNQLARNLACEWASDGIRANAVAPAVI---------------------------AGEPEEVSSL
1e6wD           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLL-TTLP---DKVRNFLASVPFSRLGDPAEYAHL
1fdvB           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTEVLDRT-----------------------------
2japC           QATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTELGHITHTATKEMYEQRISQI---RKLQAQDIAEA
2japA           QATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTELGHITHTATKEMYEQRISQI---RKLQAQDIAEA
1ydeP           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIMLAQPLGRMGQPAEVGAA
1ydeM           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIMLAQPLGRMGQPAEVGAA
1ydeI           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIMLAQPLGRMGQPAEVGAA
1ydeH           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIMLAQPLGRMGQPAEVGAA
1ydeG           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIMLAQPLGRMGQPAEVGAA
1ydeF           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIMLAQPLGRMGQPAEVGAA
1ydeD           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIMLAQPLGRMGQPAEVGAA
1ydeA           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIMLAQPLGRMGQPAEVGAA
1ydeN           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLW---EPRASIREGMLAQ--PLGRMGQPAEVGAA
1ydeB           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLW---EPRASIREGMLAQ--PLGRMGQPAEVGAA
1fduC           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAF--MEKVLGSPEE---------------------
1e6wC           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPL--LTNFLASQ--------VPFSRLGDPAEYAHL
1e6wA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFAT-------PLLTKVRNFLASQVPFSRLGDPAEYAHL
1e3wA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFAT-------PLLTTVRNFLASQVPFSRLGDPAEYAHL
1bhsA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAF--MEKVLGSPEE---------------------
1a27A           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAF--MEKVLGSPEE---------------------
2p8kG           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVDDMEGHR--SKVPLQRDSSAAEVSDV
1fdsA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTVL-------GSPEE---------------------
1e6wB           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTF-----------LASQVPFSRLGDPAEYAHL
1fdwA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPV--------HTAGSPEE---------------------
1w0cG           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVDDMPPEGHRSKVPLQRDSSAAEVSDV
1uayB           AASKGGVVALTLPAARELAGWGIRVVTVAPGLFDT-------PLPEKAKASLAAQVPFPRLGRPEEYAAL
1uayA           AASKGGVVALTLPAARELAGWGIRVVTVAPGLFDTPLLQ-----GLPEKAKLAAQVPFPRLGRPEEYAAL
3gedB           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTEF----------TQEDCAAIPAGKVGTPKDISNM
3gedA           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTEF----------TQEDCAAIPAGKVGTPKDISNM
1zbqA           SAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGS----RMTQTVMPEDLVEAL---------KPEYVAPL
1u7tA           SASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSL----PEKVRNFLASVPFSRLGDPAEYAHL
1qyxA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
1qyvA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
1jtvA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
1iolA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAF--MEKVLGSPEE---------------------
1fduD           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
1fduB           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
1fduA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
1e92C           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVGHRSK------VPLQRDSSAAEVSDV
1e7wB           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLVDWEGHRSKVPL-------------YQRDSSAAEVSDV
3deyX           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
2o23B           SASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLNF-----------LASQVPFSRLGDPAEYAHL
3g1tA           ATSKFATEGMMQVLADEYQNRSLRVNCINPGGTRTSMRASAFP-----------TEDPQKLKTPADIMPL
2dknA           AGSKYAVTCLARRNVVDWAGRGVRLNVVAPGAVETPLLQASDPRYGESTRRFVA--PLGRGSEPREVAEA
2bfaB           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
3gz4B           AASKFATEGMMQVLADEYQQ-RLRVNCINPGGTRTAMRASAFP-----------TEDPQKLKTPADIMPL
3gz4A           AASKFATEGMMQVLADEYQQ-RLRVNCINPGGTRTAMRASAFP-----------TEDPQKLKTPADIMPL
3gegA           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTF-----------TQEDCAAIPAGKVGTPKDISNM
2o23A           SASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPNF-------------LASQVPFSRLGDPAEYAHL
1h5qA           NSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTD---QTAHMDKKIRDHQASNIPLNRFAQPEEMTGQ
2bf7C           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVGHRSK------VPLQRDSSAAEVSDV
2p8kC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGSVLVEGHRSKVPL-------------YQRDSSAAEVSDV
2qhxC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGSVLVEGHRSKVPL-------------YQRDSSAAEVSDV
1ja9A           AGSKAAVEGFCRAFAVDCGAKGVTVNCIAPGGVKTDMFNSWHYAGMPQEKEGLANMPLKRIGYPADIGRA
3diiA           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTEF----------TQEDCAAIPAGKVGTPKDISNM
2bfoC           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVDGHRSK-----VPLQRDSSAAEVSDV
1w0cH           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVAVWEGHR--SKVPLQRDSSAAEVSDV
2p8kH           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---------LSVLVDDEGHR--SKVPLQRDSSAAEVSDV
3f1lB           AASKFATEGMMQVLADEYQQ-RLRVNCINPGGTRTAMRASAFP-----------TEDPQKLKTPADIMPL
3f1lA           AASKFATEGMMQVLADEYQQ-RLRVNCINPGGTRTAMRASAFP-----------TEDPQKLKTPADIMPL
1e3sA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATP-----------------SQVPFSRLGDPAEYAHL
2bfoA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
3gy0A           AASKFATEGMMQVLADEYQQ-RLRVNCINPGGTRTAMRASAFP-----------TEDPQKLKTPADIMPL
1e92D           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVGHRSK------VPLQRDSSAAEVSDV
2bfaD           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVH----------RSKVPLQRDSSAAEVSDV
1w0cE           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
2qhxA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
1gz6A           SAAKLGLLGLANTLVIEGRKNNIHCNTIAPN------------AGSRTE-----TVPLVEALKPEYVAPL
2fwmX           GXXXXXXXXXXXXVGLELAGSGVRCNVVSPGST-----------------------------RPQEIANT
2bfpB           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
2bfmC           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVGHRSK------VPLQRDSSAAEVSDV
2bf7A           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
2qhxD           TMAKGALEGLTRSAALELAPLQIRVNGVGPGSVLVEGHRSKVPL-------------YQRDSSAAEVSDV
3dijA           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTF-----------TQEDCAAIPAGKVGTPKDISNM
2bfaA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
1mxhA           TMAKHALGGLTRAAALELAPRHIRVNAVAPGPQETEEYRRKVPLG-------------------------
1e92A           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
2bfaC           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--LSVLVRSKVPL-------------YQRDSSAAEVSDV
2bf7D           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--LSVLVRSKVPL-------------YQRDSSAAEVSDV
1yb1A           CSSKFAAVGFHKTLTDELAALQIT----------------------------------------------
1w0cC           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVGHRSK------VPLQRDSSAAEVSDV
1gz6C           SAAKLGLLGLANTLVIEGRKNNIHCNTIAP----------------------------------------
1gz6B           SAAKLGLLGLANTLVIEGRKNNIHCNTIAP----------------------------------------
3f5qA           AASKFATEGMMQVLADEYQQ-RLRVNCINPGGTRQKL---------------------------------
1e92B           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
2bfpD           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVGHRSK------VPLQRDSSAAEVSDV
2bf7B           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
1g6kA           AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTP---INAEKFADPEQRVESMIPMGYIGEP------
1w6uB           ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTGTF----------EKEMIGRIPCGRLGTVEELANL
1w0cF           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
1w0cB           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
2p8kD           TMAKGALEGLTRSAALELAPLQIRVNGVGPG--------LSVLVDDMVWEGHRSKVPLQRDSSAAEVSDV
2p8kB           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
3f5qB           AASKFATEGMMQVLADEYQQ-RLRVNCINPG---------------------------------------
1w6uC           ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTGAF-------GTFEKEMIGRIPCGRLGTVEELANL
1w6uA           ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT-----LDPTGTFE-KEMIGRIPCGRLGTVEELANL
1p33D           TMAKEALEGLTRSAALELASLQIRVNGVSPG---LSVLPDDMPFSVQEDYR--RKVPLQRNSSAEEVSDV
2bfmB           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
1uluB           AIAKAALEASVRYLAYELGPKGVRVNAISAGPVRTVAARSI--PGFTKYDRVAQTAPLRRNITQEEVGNL
1rwbA           AASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTP---INAEKFADPEQRVESMIPMGYIGEP------
1fk8A           AGSKNALTVAVRKRAAAWGEAGVRLNTIAPGATETPFVP-----------------PMGRRAEPSEMASV
3f5sB           AASKFATEGMMQVLADEYQQ-RLRVNCINPGGTRT-----------------------------------
3f5sA           AASKFATEGMMQVLADEYQQ-RLRVNCINPGGTRT-----------------------------------
2p8kA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
1p33C           TMAKEALEGLTRSAALELASLQIRVNGVSPG---LSVLPDDMPFSVQEDYR--RKVPLQRNSSAEEVSDV
1p33B           TMAKEALEGLTRSAALELASLQIRVNGVSPG---LSVLPDDMPFSVQEDYR--RKVPLQRNSSAEEVSDV
2jahC           QATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTELGHITHTATKEYEQRISQIRKLQ----AQDIAEA
2jahA           QATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTELGHITHTATKEYEQRISQIRKLQ----AQDIAEA
1e7wA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
1geeA           AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTP---INAEKFADPEQRVESMIPMGYIGEP------
1gcoA           AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTP---INAEKFADPEQRVESMIPMGYIGEP------
3e03C           TLAKGSL--VTLGLAAEFGPQGVAINALWPRTV-------------------------------------
3e03B           TLAKGSL--VTLGLAAEFGPQGVAINALWPRTV-------------------------------------
3e03A           TLAKGSL--VTLGLAAEFGPQGVAINALWPRTV-------------------------------------
1p33A           TMAKEALEGLTRSAALELASLQIRVNGVSPG---LSVLPDDMPFSVQEDYR--RKVPLQRNSSAEEVSDV
1yb1B           CSSKFAAVGFHKTLTDELAALQIT----------------------------------------------
1mxfA           TA-KHALGGLTRAAALELAPRHIRVNAVAPGPQETEEYRRKVPLG-------------------------
1w6uD           ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTF------------EKEMIGRIPCGRLGTVEELANL
2ehdB           NASKFXXXXXXXXXMLDLREANVRVVNVLPGSVK------------------------------------
1zjyA           NASKGAVRIMSKSAALDCADYDVRVNTVHPGYIKTPL--VDDLPGAEEAMSQRTKTPMGHIGEPNDIAYI
1w0cA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
1nxqA           NASKGAVRIMSKSAALDCADYDVRVNTVHPGYIKTPL--VDDLPGAEEAMSQRTKTPMGHIGEPNDIAYI
3e9nA           AASKHALRGLADAFRKEEANNGIRVSTVSPGPTRPEIY--------------------------------
1uluA           AIAKAALEASVRYLAYELGPKGVRVNAISAGPVFTKY------------DRVAQTAPLRRNITQEEVGNL
2gdzA           CASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTAI---------------------------------
3ek2C           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKTSFGKILDFVESNS--------PLKRNVTIEQVGNA
3edmB           ATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTT-----------------------REGSSEDVAGL
3edmA           ATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMIST------------------------REGSSEDVAGL
2yw9H           MAAKAALEASVRYLAYELGPKGVRVNAISAGPVFTKMY-----------DRVAQTAPLRRNITQEEVGNL
2ehdA           NASKFXXXXXXXXXMLDLREANVRVVNVLPG---------------------------------------
2bd0A           CMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYTPMWGKV-----DDEMQALMMMP-------------
2bgkA           TATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPL--LTDVFGVDEELAHQAANLKGTLLRAEDVADA
3guyH           CAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFW--------------------------------
3guyG           CAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFW--------------------------------
3guyD           CAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFW--------------------------------
3guyC           CAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFW--------------------------------
1uluD           AIAKAALEASVRYLAYELGPKGVRVNAISAGPVR-------------KYDRVAQTAPLRRNITQEEVGNL
1fjhA           AGSKNALTVAVRKRAAAWGEAGVRLNTIAPGAFVP---------------------PMGRRAEPSEMASV
3e9nC           AASKHALRGLADAFRKEEANNGIRVSTVSPGPEPKEI---------------------------------
3ctmA           NTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTD---ITDFASKDMKAKWWQLTPLGREGLTQELVGG
3bzuD           SASKFALDG-------------------------------------------------------------
1zmoA           GPARAATVALVESAAKTLSRDGILLYAIGPNFFNNPTYFPTSDWENNPEERVDRDVPLGRLGRPDEMGAL
2yw9B           MAAKAALEASVRYLAYELGPKGVRVNAISAGPVRVAARSI--PGFTKMYDRVAQTAPLRRNITQEEVGNL
1uluC           AIAKAALEASVRYLAYELGPKGVRVNAISAGPV---------------YDRVAQTAPLRRNITQEEVGNL
1y5mA           SASKFALDGFFSTIRTELTKVNVSITLCVLGLIDTE----------------------------------
1so8A           SASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPL--LTDP---------------------------
3ctmH           NTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTD---ITDFASKDMKAKWWQLTPLGREGLTQELVGG
3ctmF           NTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTD---ITDFASKDMKAKWWQLTPLGREGLTQELVGG
1w73A           VPSASAKAGVSKSLAAEWGKYG-RFNVIQPGPIKT-----LDPTGTFEKE--IGRIPCGRLGTVEELANL
3guyB           CAVKWAVKGLIESVRLELKGKPMKIIAVYPG---------------------------------------
3ctmD           NTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTD---ITDFASKDMKAKWWQLTPLGREGLTQELVGG
3ctmB           NTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTD---ITDFASKDMKAKWWQLTPLGREGLTQELVGG
3e9nF           AASKHALRGLADAFRKEEANNGIRVSTVSPG---------------------------------------
1xu9D           SASKFALDGIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSMQAAPKEE---------------------
3e9nH           AASKHALRGLADAFRKEEANNGIRVSTVSPG---------------------------------------
3d5qD           SASKFALDGIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSMQAAPKEE---------------------
2yw9D           MAAKAALEASVRYLAYELGPKGVRVNAISAGPVGTKMY-----------DRVAQTAPLRRNITQEEVGNL
1xu9C           SASKFALDG-------------------------------------------------------------
1xu9B           SASKFALDG-------------------------------------------------------------
1xu9A           SASKFALDG-------------------------------------------------------------
1xu7D           SASKFALDG-------------------------------------------------------------
1xu7B           SASKFALDG-------------------------------------------------------------
1xu7A           SASKFALDG-------------------------------------------------------------
2rbeD           SASKFALDG-------------------------------------------------------------
2rbeC           SASKFALDG-------------------------------------------------------------
2rbeB           SASKFALDG-------------------------------------------------------------
2rbeA           SASKFALDG-------------------------------------------------------------
2irwC           SASKFALDG-------------------------------------------------------------
2irwA           SASKFALDG-------------------------------------------------------------
2iltA           SASKFALDG-------------------------------------------------------------
3hfgD           SASKFALDG-------------------------------------------------------------
3hfgC           SASKFALDG-------------------------------------------------------------
3hfgB           SASKFALDG-------------------------------------------------------------
3hfgA           SASKFALDG-------------------------------------------------------------
3guyA           CAVKWAVKGLIESVRLELKGKPMKIIAVYPG---------------------------------------
3frjA           SASKFALDG-------------------------------------------------------------
3ey4C           SASKFALDG-------------------------------------------------------------
3ey4A           SASKFALDG-------------------------------------------------------------
3e9nE           AASKHALRGLADAFRKEEANNGIRVSTVSPG---------------------------------------
3d5qC           SASKFALDG-------------------------------------------------------------
3d5qB           SASKFALDG-------------------------------------------------------------
3d5qA           SASKFALDG-------------------------------------------------------------
3d4nD           SASKFALDG-------------------------------------------------------------
3d4nC           SASKFALDG-------------------------------------------------------------
3d4nB           SASKFALDG-------------------------------------------------------------
3d4nA           SASKFALDG-------------------------------------------------------------
3d3eB           SASKFALDG-------------------------------------------------------------
3d3eA           SASKFALDG-------------------------------------------------------------
3czrA           SASKFALDG-------------------------------------------------------------
3ch6E           SASKFALDG-------------------------------------------------------------
3ch6D           SASKFALDG-------------------------------------------------------------
3ch6B           SASKFALDG-------------------------------------------------------------
3ch6A           SASKFALDG-------------------------------------------------------------
3bzuC           SASKFALDG-------------------------------------------------------------
3bzuB           SASKFALDG-------------------------------------------------------------
3bzuA           SASKFALDG-------------------------------------------------------------
3byzA           SASKFALDG-------------------------------------------------------------
2belD           SASKFALDG-------------------------------------------------------------
2belC           SASKFALDG-------------------------------------------------------------
2belB           SASKFALDG-------------------------------------------------------------
2belA           SASKFALDG-------------------------------------------------------------
1a4uA           SASKAAVVSFTNSLA-KLAPIGVTAYSINPGITRTPL---------------------------------
2yw9A           MAAKAALEASVRYLAYELGPKGVRVNAISAGPV---------------RDRVAQTAPLRRNITQEEVGNL
3e9nD           AASKHALRGLADAFRKEEANNGIRVSTVSPG---------------------------------------
2yw9E           MAAKAALEASVRYLAYELGPKGVRVNAISAGPVRKMY------------DRVAQTAPLRRNITQEEVGNL
2dknB           AGSKYAVTCLARRNVVDWAGRGVRLNVVAPG-----------------------VAPLGRGSEPREVAEA
2yw9C           MAAKAALEASVRYLAYELGPKGVRVNAISAGPV---------------YDRVAQTAPLRRNITQEEVGNL
2yw9F           MAAKAALEASVRYLAYELGPKGVRVNAISAGPYD----------------RVAQTAPLRRNITQEEVGNL
3ek2D           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKS-FGKILDFVESNS--------PLKRNVTIEQVGNA
1w73C           VPSASAKAGVSKSLAAEWGKYG-RFNVIQPGPIKT--------TGTFEKE--IGRIPCGRLGTVEELANL
1n5dA           ----------------------------------------------------------------------
3ek2B           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPI--KFGKILDFVESNS--------PLKRNVTIEQVGNA
3ek2A           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIS----------GIKSFGKILSNSPLKRNVTIEQVGNA
3e9nB           AASKHALRGLADAFRKEEANNGIRVSTVSP----------------------------------------
1w73D           VPSASAKAGVSKSLAAEWGKYG-RFNVIQPGPIKT---------------KEIGRIPCGRLGTVEELANL
2hrbA           ----------------------------------------------------------------------
3f1kA           AASKFATEGQVLADEYQQR---LRVNCINPGGTRTAMRASAFPTEDPQKLKTPADIPL------------
1wmaA           ----------------------------------------------------------------------
3bhmA           ----------------------------------------------------------------------
1w73B           VPSASAKAGVSKSLAAEWGKYG-RFNVIQPGPIK--------------EKEI-GRIPCGRLGTVEELANL
2pfgA           ----------------------------------------------------------------------
2b37B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIG-------------------------
2a4kB           -----------RTLALELARKGVRVNVLLPGLIQAW------------EQEVGAS-PLGRAGRPEEVAQA
2jjyB           GVAKASLEATVRYTALALGEDGIKVNAVSAGPIKT-----------------LMVSPLKKNVDIMEVGNT
3iahA           ATSKFATEG--QVLADEYQNRSLRVNCINPGGTRTSR-ASAFPTEDPQKLKTPADIPL------------
1mg5A           SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
1i30A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTFRKMLAH---------CEAVTPIRRTVTIEDVGNS
1lxcA           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-LFRLAH---------CEAVTPIRRTVTIEDVGNS
2b35B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTE----------------------------------
2b35F           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTQI---------------------------------
2b36B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTAL---------------------------------
2nwqC           ----------------------------------------------------------------------
2nwqB           ----------------------------------------------------------------------
2nwqA           ----------------------------------------------------------------------
2jjyA           GVAKASLEATVRYTALALGEDGIKVNAVSAGPIKKML---------DYNAMV---SPLKKNVDIMEVGNT
1qsgG           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-----LAASGIKDFRKMLAVTPIRRTVTIEDVGNS
1qsgA           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-----LAASGIKDFRKMLAVTPIRRTVTIEDVGNS
1qg6A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-----LAASGIKDFRKMLAVTPIRRTVTIEDVGNS
2jjyC           GVAKASLEATVRYTALALGEDGIKVNAVSAGPIDYNAM----------------VSPLKKNVDIMEVGNT
3fneC           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGEE----------------------
3e9qB           AASKFATEG-------------------------------------------------------------
3e9qA           AASKFATEG-------------------------------------------------------------
1dfiA           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT--LMLAH---------CEAVTPIRRTVTIEDVGNS
1c14A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-----LAASGIKDFRKMLAVTPIRRTVTIEDVGNS
2b35C           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLL---------------------------------
2h7iA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
3fnfD           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
3fnfC           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
3fnfB           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
3fneD           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
3fneB           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
1enyA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
2b37C           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
2b35E           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
2b35D           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
2b35A           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
2aqiA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
2aqhA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
2aq8A           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
1xseA           SASKFALDGFFSTLRSEVNKVNVSITLCILGLIDTE----------------------------------
2jjyD           GVAKASLEATVRYTALALGEDGIKVNAVSAGPIKMLDYN-------------AMVSPLKKNVDIMEVGNT
3g49A           SASKFALDGFFSTLRSEVNKVNVSITLCILGLIDTE----------------------------------
3dwfC           SASKFALDGFFSTLRSEVNKVNVSITLCILGLIDTE----------------------------------
3dwfB           SASKFALDGFFSTLRSEVNKVNVSITLCILGLIDTE----------------------------------
3dwfA           SASKFALDGFFSTLRSEVNKVNVSITLCILGLIDTE----------------------------------
2p91B           GIAKAALESTVRYLAYDIAKHGHRINAISAGPVKTLAATGFHLL-------MEHTTKVNPFGKPEDVGDT
2fhsB           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTKDFRLAH---------CEAVTPIRRTVTIEDVGNS
2nv6A           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
2aqkA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
2p91A           GIAKAALESTVRYLAYDIAKHGHRINAISAGPVKT-LAAIT-----GFHLLMEHTTKVNPFGKPEDVGDT
3grkA           --AKAALEASVKYLAVDLGPQNIRVNAISAGPIKTGDFRYI-------LKWNEYNAPLRRTVTIDEVGDV
1lx6A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPI-----MLAH---------CEAVTPIRRTVTIEDVGNS


                         .         .         .         +         .         .         .:280
query           ISYLISDGASFVTxxxxxxxxxxxxxxx
1q7bA           VAFLASDEAAYIT---------------
1i01E           VAFLASDEAAYIT---------------
1q7cA           VAFLASDEAAYIT---------------
1q7bB           VAFLASDEAAYIT---------------
3gk3D           IAFLCSDDAGFVT---------------
3gk3B           IAFLCSDDAGFVT---------------
1i01B           VAFLASDEAAYIT---------------
3gk3A           IAFLCSDDAGFVT---------------
3gk3C           IAFLCSDDAGFVT---------------
1uznA           VSFLASEDASYIS---------------
1i01A           VAFLASDEAAYIT---------------
1gegE           VSYLASPDSDYMT---------------
1gegA           VSYLASPDSDYMT---------------
3ezlA           VAWLASEESGFST---------------
1i01G           VAFLASDEAAYIT---------------
1i01F           VAFLASDEAAYIT---------------
3ftpA           VAFLASPQAGYIT---------------
1i01D           VAFLASDEAAYIT---------------
1xr3B           VAYLIGPGAAAVT---------------
2zk7B           VAFLASREASFIT---------------
1uzlA           VSFLASEDASYIS---------------
2dteA           VAFLASREASFIT---------------
2p68A           VLFLCSELASYIT---------------
2ntnA           VSFLASEDASYIS---------------
1i01H           VAFLASDEAAYIT---------------
3ftpC           VAFLASPQAGYIT---------------
2q2qH           VLFLCSEAGSQV----------------
2uvdA           VTFFASDQSKYIT---------------
2rhrB           VAYLIGPGAAAVT---------------
2q2wC           VLFLCSEAGSQV----------------
1i01C           VAFLASDEAAYIT---------------
3ftpD           VAFLASPQAGYIT---------------
3csdB           VAYLIGPGAAAVT---------------
2q2vD           VLFLCSEAGSQV----------------
1edoA           VEFLLSPAASYIT---------------
1uznB           VSFLASEDASYIS---------------
1w4zB           VAYLIGPGAAAVT---------------
1uzmA           VSFLASEDASYIS---------------
2q2wD           VLFLCSEAGSQV----------------
2q2vC           VLFLCSEAGSQV----------------
2q2qF           VLFLCSEAGSQV----------------
2ph3A           VAFLVSEKAGYIT---------------
1x7gB           VAYLIGPGAAAVT---------------
2q2qC           VLFLCSEAGSQV----------------
2p68B           VLFLCSELASYIT---------------
2d1yC           VLFLASEKASFIT---------------
1uzlB           VSFLASEDASYIS---------------
2q2wA           VLFLCSEAGSQV----------------
2q2qE           VLFLCSEAGSQV----------------
2q2qB           VLFLCSEAGSQV----------------
2d1yD           VLFLASEKASFIT---------------
2yz7A           AVFLSSAAADQMT---------------
1x7hB           VAYLIGPGAAAVT---------------
1w4zA           VAYLIGPGAAAVT---------------
2rh4B           VAYLIGPGAAAVT---------------
2rh4A           VAYLIGPGAAAVT---------------
2d1yB           VLFLASEKASFIT---------------
2d1yA           VLFLASEKASFIT---------------
1x7gA           VAYLIGPGAAAVT---------------
2rhrA           VAYLIGPGAAAVT---------------
2q2qA           VLFLCSEAGSQV----------------
2q2vB           VLFLCSEAGSQV----------------
2q2qG           VLFLCSEAGSQV----------------
1ae1B           IAFLCFPAASYIT---------------
2q2vA           VLFLCSEAGSQV----------------
2ntnB           VSFLASEDASYIS---------------
3f9iA           VAFLASNNASYIT---------------
1uzmB           VSFLASEDASYIS---------------
1iy8A           VAFLLSDDASYV----------------
2hq1A           VGFLASDDSNYIT---------------
3cxtA           AVFLASDASNFV----------------
2c07A           ACFLSSDKSGYI----------------
1o5iA           VAFLCSEKASYLT---------------
3f9iB           VAFLASNNASYIT---------------
3cxrA           AVFLASDASNFV----------------
3i3oF           YVYLASSDSSYVT---------------
3i3oE           YVYLASSDSSYVT---------------
3i3oC           YVYLASSDSSYVT---------------
3i3oB           YVYLASSDSSYVT---------------
3i3oA           YVYLASSDSSYVT---------------
2ae2A           VAFLCFPAASYVT---------------
1ae1A           IAFLCFPAASYIT---------------
2ztvC           AVFLASDAAAQIT---------------
1ulsB           ALFLLSDESSFIT---------------
1ulsA           ALFLLSDESSFIT---------------
2cfcA           VMFLAGEDATYV----------------
2ztvD           AVFLASDAAAQIT---------------
2pd6D           VAFLASEDSGYIT---------------
2pd6C           VAFLASEDSGYIT---------------
2ztvB           AVFLASDAAAQIT---------------
2ztmC           AVFLASDAAAQIT---------------
2zk7A           VAFLASREASFIT---------------
2ae1A           VAFLCFPAASYVT---------------
2ztlA           AVFLASDAAAQIT---------------
3i3oH           YVYLASSDSSYVT---------------
2ztmA           AVFLASDAAAQIT---------------
2ph3B           VAFLVSEKAGYIT---------------
1ulsC           ALFLLSDESSFIT---------------
3ijrH           YVYLASSDSSYVT---------------
3ijrF           YVYLASSDSSYVT---------------
3ijrE           YVYLASSDSSYVT---------------
3ijrB           YVYLASSDSSYVT---------------
3ijrA           YVYLASSDSSYVT---------------
3grpA           TVYLASDEAAYLT---------------
2b4qA           AISLAGTAGAYMT---------------
2pd6B           VAFLASEDSGYIT---------------
1xg5C           VIYVLSTPA-------------------
2pd6A           VAFLASEDSGYIT---------------
2nm0A           VRFLASDDASYIT---------------
1x1tA           AVFLASDAAAQIT---------------
1zemA           VAFLLGDDSSFMT---------------
2ztmD           AVFLASDAAAQIT---------------
2ztuC           AVFLASDAAAQIT---------------
1vl8B           AVFLASEEAKYVT---------------
1vl8A           AVFLASEEAKYVT---------------
3i3oG           YVYLASSDSSYVT---------------
2ztmB           AVFLASDAAAQIT---------------
2ztuD           AVFLASDAAAQIT---------------
2ztuB           AVFLASDAAAQIT---------------
1nffA           VVYLASDESSYST---------------
2zatA           VSFLCSEDASYI----------------
3d3wA           ILFLLSDRSGMTT---------------
1spxA           IAFL------------------------
3gafA           ALFLCSPAAAWIS---------------
3imfB           AYYLCSDEAAYI----------------
3gafD           ALFLCSPAAAWIS---------------
2ztuA           AVFLASDAAAQIT---------------
1xg5A           VIYVLSTPA-------------------
3imfA           AYYLCSDEAAYI----------------
3gafF           ALFLCSPAAAWIS---------------
2z1nB           VAFLASEKASFIT---------------
1yxmD           VCFLLSPAASFIT---------------
1xkqB           ILFLADRNLSF-----------------
1xkqA           ILFLADRNLSF-----------------
1xhlA           IVFL------------------------
1x1eA           AAVLCGDEAEYLT---------------
3gafG           ALFLCSPAAAWIS---------------
3gafC           ALFLCSPAAAWIS---------------
3gafB           ALFLCSPAAAWIS---------------
2et6A           VLYLSS----------------------
2ekpA           AAVLCGDEAEYLT---------------
1cydA           ILFLLSD---------------------
3emkA           VVYLASDEAAYVT---------------
2ekqD           AAVLCGDEAEYLT---------------
3ennA           VVYLASDEAAYVT---------------
2z1nA           VAFLASEKASFIT---------------
3gafH           ALFLCSPAAAWIS---------------
3gafE           ALFLCSPAAAWIS---------------
3ennB           VVYLASDEAAYVT---------------
2c7vA           VIFLVSGSAQYIT---------------
1pr9A           ILFLLSDRSGMTT---------------
2c7vB           VIFLVSGSAQYIT---------------
3emkD           VVYLASDEAAYVT---------------
1yxmB           VCFLLSPAASFIT---------------
1xg5B           VIYVLSTPA-------------------
1fmcA           ALFLCSPAASWVS---------------
2c7vD           VIFLVSGSAQYIT---------------
3bmqA           VIFLVSGSAQYIT---------------
3bmnA           VIFLVSGSAQYIT---------------
1ahhA           ALFLCSPAASWVS---------------
1yxmA           VCFLLSPAASFIT---------------
1hdcA           VVKLLSDTSSYVT---------------
2b4qB           AISLAGTAGAYMT---------------
3i4fD           ISFLCEDDSDMIT---------------
3grpB           TVYLASDEAAYLT---------------
3ennD           VVYLASDEAAYVT---------------
3ennC           VVYLASDEAAYVT---------------
3imfC           AYYLCSDEAAYI----------------
3bmjD           VIFLVSGSAQYIT---------------
3i4fC           ISFLCEDDSDMIT---------------
3i4fA           ISFLCEDDSDMIT---------------
3bmoB           VIFLVSGSAQYIT---------------
3bmfB           VIFLVSGSAQYIT---------------
3bmeA           VIFLVSGSAQYIT---------------
3bmeB           VIFLVSGSAQYIT---------------
2ag5C           CVYLASDESAYVT---------------
2ag5B           CVYLASDESAYVT---------------
2ag5A           CVYLASDESAYVT---------------
3emkC           VVYLASDEAAYVT---------------
3emkB           VVYLASDEAAYVT---------------
3bmnD           VIFLVSGSAQYIT---------------
3bmfD           VIFLVSGSAQYIT---------------
3bmfC           VIFLVSGSAQYIT---------------
1yxmC           VCFLLSPAASFIT---------------
3bmnC           VIFLVSGSAQYIT---------------
3bmiB           VIFLVSGSAQYIT---------------
2wd7B           VIFLVSGSAQYIT---------------
2ewmB           ----------------------------
2ewmA           ----------------------------
3bmoD           VIFLVSGSAQYIT---------------
3bmoC           VIFLVSGSAQYIT---------------
2c7vC           VIFLVSGSAQYIT---------------
3bmdB           VIFLVSGSAQYIT---------------
2wd7C           VIFLVSGSAQYIT---------------
2vz0B           VIFLVSGSAQYIT---------------
3gvcD           VVFLLSDDASMIT---------------
3bmoA           VIFLVSGSAQYIT---------------
3grpC           TVYLASDEAAYLT---------------
2ew8B           ----------------------------
2ew8A           ----------------------------
3bmnB           VIFLVSGSAQYIT---------------
3bmkC           VIFLVSGSAQYIT---------------
3bmfA           VIFLVSGSAQYIT---------------
2vz0A           VIFLVSGSAQYIT---------------
3bmqC           VIFLVSGSAQYIT---------------
3gvcC           VVFLLSDDASMIT---------------
3gvcB           VVFLLSDDASMIT---------------
3bmeC           VIFLVSGSAQYIT---------------
2a4kA           ALFLLSEESAYIT---------------
3gvcA           VVFLLSDDASMIT---------------
1nfrA           VVYLASDESSYST---------------
3grpD           TVYLASDEAAYLT---------------
1k2wA           AIFLATPEADYI----------------
3iccA           AAFLASPDSRWVT---------------
1g0nB           VCFLASNDGGWVT---------------
1ybvA           VCFLASNDGGWVT---------------
1g0oC           VCFLASNDGGWVT---------------
1g0oA           VCFLASNDGGWVT---------------
1dohB           VCFLASNDGGWVT---------------
1dohA           VCFLASNDGGWVT---------------
1bdbA           YVFFATRG--------------------
1xq1A           VAFLCMPAASYIT---------------
1e6wD           VQMVIEN---------------------
1fdvB           ----------------------------
2japC           VRYAVT----------------------
2japA           VRYAVT----------------------
1ydeP           AVFLASE-ANFCT---------------
1ydeM           AVFLASE-ANFCT---------------
1ydeI           AVFLASE-ANFCT---------------
1ydeH           AVFLASE-ANFCT---------------
1ydeG           AVFLASE-ANFCT---------------
1ydeF           AVFLASE-ANFCT---------------
1ydeD           AVFLASE-ANFCT---------------
1ydeA           AVFLASE-ANFCT---------------
1ydeN           AVFLASE-ANFCT---------------
1ydeB           AVFLASE-ANFCT---------------
1fduC           ----------------------------
1e6wC           VQMVIEN---------------------
1e6wA           VQMVIEN---------------------
1e3wA           VQMVIEN---------------------
1bhsA           ----------------------------
1a27A           ----------------------------
2p8kG           VIFLCSSKAKYIT---------------
1fdsA           ----------------------------
1e6wB           VQMVIEN---------------------
1fdwA           ----------------------------
1w0cG           VIFLCSSKAKYIT---------------
1uayB           VLHILEN---------------------
1uayA           VLHILEN---------------------
3gedB           VLFL------------------------
3gedA           VLFL------------------------
1zbqA           VLWL------------------------
1u7tA           VQAIIEN---------------------
1qyxA           ----------------------------
1qyvA           ----------------------------
1jtvA           ----------------------------
1iolA           ----------------------------
1fduD           ----------------------------
1fduB           ----------------------------
1fduA           ----------------------------
1e92C           VIFLCSSKAKYIT---------------
1e7wB           VIFLCSSKAKYIT---------------
3deyX           ----------------------------
2o23B           VQAIIEN---------------------
3g1tA           YLWLMGD---------------------
2dknA           IAFLLGPQASFI----------------
2bfaB           VIFLCSSKAKYIT---------------
3gz4B           YLWLMGD---------------------
3gz4A           YLWLMGD---------------------
3gegA           VLFL------------------------
2o23A           VQAIIEN---------------------
1h5qA           AILLLSDHATYMT---------------
2bf7C           VIFLCSSKAKYIT---------------
2p8kC           VIFLCSSKAKYIT---------------
2qhxC           VIFLCSSKAKYIT---------------
1ja9A           VSALCQEESEWI----------------
3diiA           VLFL------------------------
2bfoC           VIFLCSSKAKYIT---------------
1w0cH           VIFLCSSKAKYIT---------------
2p8kH           VIFLCSSKAKYIT---------------
3f1lB           YLWLMGD---------------------
3f1lA           YLWLMGD---------------------
1e3sA           VQMVIEN---------------------
2bfoA           VIFLCSSKAKYIT---------------
3gy0A           YLWLMGD---------------------
1e92D           VIFLCSSKAKYIT---------------
2bfaD           VIFLCSSKAKYIT---------------
1w0cE           VIFLCSSKAKYIT---------------
2qhxA           VIFLCSSKAKYIT---------------
1gz6A           VLWL------------------------
2fwmX           ILFLASDLASHIT---------------
2bfpB           VIFLCSSKAKYIT---------------
2bfmC           VIFLCSSKAKYIT---------------
2bf7A           VIFLCSSKAKYIT---------------
2qhxD           VIFLCSSKAKYIT---------------
3dijA           VLFL------------------------
2bfaA           VIFLCSSKAKYIT---------------
1mxhA           ----------------------------
1e92A           VIFLCSSKAKYIT---------------
2bfaC           VIFLCSSKAKYIT---------------
2bf7D           VIFLCSSKAKYIT---------------
1yb1A           ----------------------------
1w0cC           VIFLCSSKAKYIT---------------
1gz6C           ----------------------------
1gz6B           ----------------------------
3f5qA           ----------------------------
1e92B           VIFLCSSKAKYIT---------------
2bfpD           VIFLCSSKAKYIT---------------
2bf7B           VIFLCSSKAKYIT---------------
1g6kA           ----------------------------
1w6uB           AAFLCSDYASWI----------------
1w0cF           VIFLCSSKAKYIT---------------
1w0cB           VIFLCSSKAKYIT---------------
2p8kD           VIFLCSSKAKYIT---------------
2p8kB           VIFLCSSKAKYIT---------------
3f5qB           ----------------------------
1w6uC           AAFLCSDYASWI----------------
1w6uA           AAFLCSDYASWI----------------
1p33D           VIFLCSPKAKYIT---------------
2bfmB           VIFLCSSKAKYIT---------------
1uluB           GLFLLSPLASGIT---------------
1rwbA           ----------------------------
1fk8A           IAFLMSPAASYV----------------
3f5sB           ----------------------------
3f5sA           ----------------------------
2p8kA           VIFLCSSKAKYIT---------------
1p33C           VIFLCSPKAKYIT---------------
1p33B           VIFLCSPKAKYIT---------------
2jahC           VRYAVT----------------------
2jahA           VRYAVT----------------------
1e7wA           VIFLCSSKAKYIT---------------
1geeA           ----------------------------
1gcoA           ----------------------------
3e03C           ----------------------------
3e03B           ----------------------------
3e03A           ----------------------------
1p33A           VIFLCSPKAKYIT---------------
1yb1B           ----------------------------
1mxfA           ----------------------------
1w6uD           AAFLCSDYASWI----------------
2ehdB           ----------------------------
1zjyA           CVYLASNESKFAT---------------
1w0cA           VIFLCSSKAKYIT---------------
1nxqA           CVYLASNESKFAT---------------
3e9nA           ----------------------------
1uluA           GLFLLSPLASGIT---------------
2gdzA           ----------------------------
3ek2C           GAFLLSDLASGVT---------------
3edmB           VAFLASDDAAYVT---------------
3edmA           VAFLASDDAAYVT---------------
2yw9H           GLFLLSPLASGIT---------------
2ehdA           ----------------------------
2bd0A           ----------------------------
2bgkA           VAYLAGDESKYVS---------------
3guyH           ----------------------------
3guyG           ----------------------------
3guyD           ----------------------------
3guyC           ----------------------------
1uluD           GLFLLSPLASGIT---------------
1fjhA           IAFLMSPAASYV----------------
3e9nC           ----------------------------
3ctmA           YLYLASNASTFTT---------------
3bzuD           ----------------------------
1zmoA           ITFLASRRAA------------------
2yw9B           GLFLLSPLASGIT---------------
1uluC           GLFLLSPLASGIT---------------
1y5mA           ----------------------------
1so8A           ----------------------------
3ctmH           YLYLASNASTFTT---------------
3ctmF           YLYLASNASTFTT---------------
1w73A           AAFLCSDYASWI----------------
3guyB           ----------------------------
3ctmD           YLYLASNASTFTT---------------
3ctmB           YLYLASNASTFTT---------------
3e9nF           ----------------------------
1xu9D           ----------------------------
3e9nH           ----------------------------
3d5qD           ----------------------------
2yw9D           GLFLLSPLASGIT---------------
1xu9C           ----------------------------
1xu9B           ----------------------------
1xu9A           ----------------------------
1xu7D           ----------------------------
1xu7B           ----------------------------
1xu7A           ----------------------------
2rbeD           ----------------------------
2rbeC           ----------------------------
2rbeB           ----------------------------
2rbeA           ----------------------------
2irwC           ----------------------------
2irwA           ----------------------------
2iltA           ----------------------------
3hfgD           ----------------------------
3hfgC           ----------------------------
3hfgB           ----------------------------
3hfgA           ----------------------------
3guyA           ----------------------------
3frjA           ----------------------------
3ey4C           ----------------------------
3ey4A           ----------------------------
3e9nE           ----------------------------
3d5qC           ----------------------------
3d5qB           ----------------------------
3d5qA           ----------------------------
3d4nD           ----------------------------
3d4nC           ----------------------------
3d4nB           ----------------------------
3d4nA           ----------------------------
3d3eB           ----------------------------
3d3eA           ----------------------------
3czrA           ----------------------------
3ch6E           ----------------------------
3ch6D           ----------------------------
3ch6B           ----------------------------
3ch6A           ----------------------------
3bzuC           ----------------------------
3bzuB           ----------------------------
3bzuA           ----------------------------
3byzA           ----------------------------
2belD           ----------------------------
2belC           ----------------------------
2belB           ----------------------------
2belA           ----------------------------
1a4uA           ----------------------------
2yw9A           GLFLLSPLASGIT---------------
3e9nD           ----------------------------
2yw9E           GLFLLSPLASGIT---------------
2dknB           IAFLLGPQASFI----------------
2yw9C           GLFLLSPLASGIT---------------
2yw9F           GLFLLSPLASGIT---------------
3ek2D           GAFLLSDLASGVT---------------
1w73C           AAFLCSDYASWI----------------
1n5dA           ----------------------------
3ek2B           GAFLLSDLASGVT---------------
3ek2A           GAFLLSDLASGVT---------------
3e9nB           ----------------------------
1w73D           AAFLCSDYASWI----------------
2hrbA           ----------------------------
3f1kA           ----------------------------
1wmaA           ----------------------------
3bhmA           ----------------------------
1w73B           AAFLCSDYASWI----------------
2pfgA           ----------------------------
2b37B           ----------------------------
2a4kB           ALFLLSEESAYIT---------------
2jjyB           VAFLCSDMATGIT---------------
3iahA           ----------------------------
1mg5A           ----------------------------
1i30A           AAFLCSD---------------------
1lxcA           AAFLCSD---------------------
2b35B           ----------------------------
2b35F           ----------------------------
2b36B           ----------------------------
2nwqC           ----------------------------
2nwqB           ----------------------------
2nwqA           ----------------------------
2jjyA           VAFLCSDMATGIT---------------
1qsgG           AAFLCSD---------------------
1qsgA           AAFLCSD---------------------
1qg6A           AAFLCSD---------------------
2jjyC           VAFLCSDMATGIT---------------
3fneC           ----------------------------
3e9qB           ----------------------------
3e9qA           ----------------------------
1dfiA           AAFLCSD---------------------
1c14A           AAFLCSD---------------------
2b35C           ----------------------------
2h7iA           ----------------------------
3fnfD           ----------------------------
3fnfC           ----------------------------
3fnfB           ----------------------------
3fneD           ----------------------------
3fneB           ----------------------------
1enyA           ----------------------------
2b37C           ----------------------------
2b35E           ----------------------------
2b35D           ----------------------------
2b35A           ----------------------------
2aqiA           ----------------------------
2aqhA           ----------------------------
2aq8A           ----------------------------
1xseA           ----------------------------
2jjyD           VAFLCSDMATGIT---------------
3g49A           ----------------------------
3dwfC           ----------------------------
3dwfB           ----------------------------
3dwfA           ----------------------------
2p91B           AVFLCSDWARAIT---------------
2fhsB           AAFLCSD---------------------
2nv6A           ----------------------------
2aqkA           ----------------------------
2p91A           AVFLCSDWARAIT---------------
3grkA           GLYFLSDLSRSVT---------------
1lx6A           AAFLCSD---------------------