[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF08950.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1yhdA.bssp"
#ERROR : Can't open dsspfile "1xs8A.bssp"
#ERROR : Can't open dsspfile "1t07A.bssp"

## Summary of PDB Search
:114
    5e-18  44%  1yhdA  [x.x.x] UPF0269 PROTEIN YGGX
    6e-18  43%  1xs8A  [d.279.1] UPF0269 PROTEIN YGGX
    4e-14  51%  1t07A  [d.279.1] HYPOTHETICAL UPF0269 PROTEIN PA5148
:114

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxMARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQT
1yhdA           ------------------------SRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
1xs8A           -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
1t07A           -----------------------------CRKYHEELPGLDRPPYPGAKGEDIYNNVSRKAWDEWQKHQT


                         .         .         *         .         .         .         .:140
query           MLINENRLNMADPRARQYLIKQTEKYFFGDGADQAAGYVPxxxx
1yhdA           MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
1xs8A           MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
1t07A           -LINERRLNNAEDRK---FLQQEDKFLSGE--------------