[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF09080.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1x7hB.bssp"
#ERROR : Can't open dsspfile "1x7gA.bssp"
#ERROR : Can't open dsspfile "1w4zA.bssp"
#ERROR : Can't open dsspfile "2rhrA.bssp"
#ERROR : Can't open dsspfile "2rh4B.bssp"
#ERROR : Can't open dsspfile "2rh4A.bssp"
#ERROR : Can't open dsspfile "1xr3B.bssp"
#ERROR : Can't open dsspfile "2yz7A.bssp"
#ERROR : Can't open dsspfile "1w4zB.bssp"
#ERROR : Can't open dsspfile "2rhrB.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "1x7gB.bssp"
#ERROR : Can't open dsspfile "2ztlA.bssp"
#ERROR : Can't open dsspfile "2q2vA.bssp"
#ERROR : Can't open dsspfile "2ztmA.bssp"
#ERROR : Can't open dsspfile "2q2wA.bssp"
#ERROR : Can't open dsspfile "2q2qB.bssp"
#ERROR : Can't open dsspfile "2q2wC.bssp"
#ERROR : Can't open dsspfile "2q2qA.bssp"
#ERROR : Can't open dsspfile "2q2vD.bssp"
#ERROR : Can't open dsspfile "2q2qE.bssp"
#ERROR : Can't open dsspfile "2q2vB.bssp"
#ERROR : Can't open dsspfile "2q2wD.bssp"
#ERROR : Can't open dsspfile "2q2vC.bssp"
#ERROR : Can't open dsspfile "2q2qG.bssp"
#ERROR : Can't open dsspfile "2q2qC.bssp"
#ERROR : Can't open dsspfile "2ztvC.bssp"
#ERROR : Can't open dsspfile "2ztvD.bssp"
#ERROR : Can't open dsspfile "2q2qF.bssp"
#ERROR : Can't open dsspfile "2ztmC.bssp"
#ERROR : Can't open dsspfile "2q2qH.bssp"
#ERROR : Can't open dsspfile "2ztvB.bssp"
#ERROR : Can't open dsspfile "2ztmD.bssp"
#ERROR : Can't open dsspfile "2ztuC.bssp"
#ERROR : Can't open dsspfile "2p68A.bssp"
#ERROR : Can't open dsspfile "2ztuD.bssp"
#ERROR : Can't open dsspfile "3ezlA.bssp"
#ERROR : Can't open dsspfile "2ztmB.bssp"
#ERROR : Can't open dsspfile "1uznA.bssp"
#ERROR : Can't open dsspfile "2ztuB.bssp"
#ERROR : Can't open dsspfile "1x1tA.bssp"
#ERROR : Can't open dsspfile "2ztuA.bssp"
#ERROR : Can't open dsspfile "2uvdA.bssp"
#ERROR : Can't open dsspfile "2ph3A.bssp"
#ERROR : Can't open dsspfile "2zk7B.bssp"
#ERROR : Can't open dsspfile "2dteA.bssp"
#ERROR : Can't open dsspfile "2p68B.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "1iy8A.bssp"
#ERROR : Can't open dsspfile "1gegE.bssp"
#ERROR : Can't open dsspfile "1gegA.bssp"
#ERROR : Can't open dsspfile "1q7bB.bssp"
#ERROR : Can't open dsspfile "1q7bA.bssp"
#ERROR : Can't open dsspfile "1uznB.bssp"
#ERROR : Can't open dsspfile "1q7cA.bssp"
#ERROR : Can't open dsspfile "3ftpA.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "1uzlB.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "1uzlA.bssp"
#ERROR : Can't open dsspfile "3ftpC.bssp"
#ERROR : Can't open dsspfile "3gk3D.bssp"
#ERROR : Can't open dsspfile "3gk3B.bssp"
#ERROR : Can't open dsspfile "2zk7A.bssp"
#ERROR : Can't open dsspfile "1uzmA.bssp"
#ERROR : Can't open dsspfile "3ftpD.bssp"
#ERROR : Can't open dsspfile "2ntnA.bssp"
#ERROR : Can't open dsspfile "1hdcA.bssp"
#ERROR : Can't open dsspfile "3gvcC.bssp"
#ERROR : Can't open dsspfile "3gvcB.bssp"
#ERROR : Can't open dsspfile "1x1eA.bssp"
#ERROR : Can't open dsspfile "3gk3A.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "3gk3C.bssp"
#ERROR : Can't open dsspfile "1i01E.bssp"
#ERROR : Can't open dsspfile "2nm0A.bssp"
#ERROR : Can't open dsspfile "3gvcA.bssp"
#ERROR : Can't open dsspfile "2ph3B.bssp"
#ERROR : Can't open dsspfile "2ekqD.bssp"
#ERROR : Can't open dsspfile "3gvcD.bssp"
#ERROR : Can't open dsspfile "1yxmD.bssp"
#ERROR : Can't open dsspfile "1edoA.bssp"
#ERROR : Can't open dsspfile "1yxmA.bssp"
#ERROR : Can't open dsspfile "1nffA.bssp"
#ERROR : Can't open dsspfile "1i01B.bssp"
#ERROR : Can't open dsspfile "3gafA.bssp"
#ERROR : Can't open dsspfile "1zemA.bssp"
#ERROR : Can't open dsspfile "3gafD.bssp"
#ERROR : Can't open dsspfile "2c07A.bssp"
#ERROR : Can't open dsspfile "1k2wA.bssp"
#ERROR : Can't open dsspfile "1i01A.bssp"
#ERROR : Can't open dsspfile "3gafF.bssp"
#ERROR : Can't open dsspfile "1i01F.bssp"
#ERROR : Can't open dsspfile "1yxmB.bssp"
#ERROR : Can't open dsspfile "2ntnB.bssp"
#ERROR : Can't open dsspfile "2hq1A.bssp"
#ERROR : Can't open dsspfile "3gafG.bssp"
#ERROR : Can't open dsspfile "3gafC.bssp"
#ERROR : Can't open dsspfile "1i01C.bssp"
#ERROR : Can't open dsspfile "3gafB.bssp"
#ERROR : Can't open dsspfile "3f9iA.bssp"
#ERROR : Can't open dsspfile "1uzmB.bssp"
#ERROR : Can't open dsspfile "2pd6D.bssp"
#ERROR : Can't open dsspfile "2pd6C.bssp"
#ERROR : Can't open dsspfile "2pd6B.bssp"
#ERROR : Can't open dsspfile "1i01G.bssp"
#ERROR : Can't open dsspfile "1fmcA.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "2z1nB.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "3ennB.bssp"
#ERROR : Can't open dsspfile "1i01H.bssp"
#ERROR : Can't open dsspfile "3gafH.bssp"
#ERROR : Can't open dsspfile "3gafE.bssp"
#ERROR : Can't open dsspfile "3emkA.bssp"
#ERROR : Can't open dsspfile "1nfrA.bssp"
#ERROR : Can't open dsspfile "3ennD.bssp"
#ERROR : Can't open dsspfile "3ennC.bssp"
#ERROR : Can't open dsspfile "2a4kA.bssp"
#ERROR : Can't open dsspfile "1i01D.bssp"
#ERROR : Can't open dsspfile "3emkD.bssp"
#ERROR : Can't open dsspfile "3ennA.bssp"
#ERROR : Can't open dsspfile "3f9iB.bssp"
#ERROR : Can't open dsspfile "1zjyA.bssp"
#ERROR : Can't open dsspfile "1nxqA.bssp"
#ERROR : Can't open dsspfile "1yxmC.bssp"
#ERROR : Can't open dsspfile "3emkB.bssp"
#ERROR : Can't open dsspfile "1ulsB.bssp"
#ERROR : Can't open dsspfile "1ulsA.bssp"
#ERROR : Can't open dsspfile "3cxtA.bssp"
#ERROR : Can't open dsspfile "2z1nA.bssp"
#ERROR : Can't open dsspfile "3emkC.bssp"
#ERROR : Can't open dsspfile "2pd6A.bssp"
#ERROR : Can't open dsspfile "2japC.bssp"
#ERROR : Can't open dsspfile "2japA.bssp"
#ERROR : Can't open dsspfile "3grpA.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"
#ERROR : Can't open dsspfile "1ulsC.bssp"
#ERROR : Can't open dsspfile "1ja9A.bssp"
#ERROR : Can't open dsspfile "3i4fA.bssp"
#ERROR : Can't open dsspfile "3i4fD.bssp"
#ERROR : Can't open dsspfile "2b4qA.bssp"
#ERROR : Can't open dsspfile "3grpB.bssp"
#ERROR : Can't open dsspfile "2ewmA.bssp"
#ERROR : Can't open dsspfile "1ae1B.bssp"
#ERROR : Can't open dsspfile "3i4fC.bssp"
#ERROR : Can't open dsspfile "2ewmB.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "2gdzA.bssp"
#ERROR : Can't open dsspfile "2ae2A.bssp"
#ERROR : Can't open dsspfile "1xkqB.bssp"
#ERROR : Can't open dsspfile "1xkqA.bssp"
#ERROR : Can't open dsspfile "3grpC.bssp"
#ERROR : Can't open dsspfile "2ew8B.bssp"
#ERROR : Can't open dsspfile "2ew8A.bssp"
#ERROR : Can't open dsspfile "1cydA.bssp"
#ERROR : Can't open dsspfile "3imfB.bssp"
#ERROR : Can't open dsspfile "2et6A.bssp"
#ERROR : Can't open dsspfile "1w6uA.bssp"
#ERROR : Can't open dsspfile "1xhlA.bssp"
#ERROR : Can't open dsspfile "1w6uC.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "1w6uB.bssp"
#ERROR : Can't open dsspfile "3grpD.bssp"
#ERROR : Can't open dsspfile "3iccA.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "2ehdA.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "1yb1B.bssp"
#ERROR : Can't open dsspfile "3i3oF.bssp"
#ERROR : Can't open dsspfile "3i3oE.bssp"
#ERROR : Can't open dsspfile "3i3oC.bssp"
#ERROR : Can't open dsspfile "3i3oB.bssp"
#ERROR : Can't open dsspfile "3i3oA.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "3imfA.bssp"
#ERROR : Can't open dsspfile "2jahC.bssp"
#ERROR : Can't open dsspfile "2jahA.bssp"
#ERROR : Can't open dsspfile "1w6uD.bssp"
#ERROR : Can't open dsspfile "2zatA.bssp"
#ERROR : Can't open dsspfile "2ehdB.bssp"
#ERROR : Can't open dsspfile "1vl8B.bssp"
#ERROR : Can't open dsspfile "1vl8A.bssp"
#ERROR : Can't open dsspfile "1g6kA.bssp"
#ERROR : Can't open dsspfile "1rwbA.bssp"
#ERROR : Can't open dsspfile "3i3oH.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "3edmA.bssp"
#ERROR : Can't open dsspfile "1geeA.bssp"
#ERROR : Can't open dsspfile "1gcoA.bssp"
#ERROR : Can't open dsspfile "3imfC.bssp"
#ERROR : Can't open dsspfile "1zbqA.bssp"
#ERROR : Can't open dsspfile "1uayA.bssp"
#ERROR : Can't open dsspfile "3edmD.bssp"
#ERROR : Can't open dsspfile "3edmC.bssp"
#ERROR : Can't open dsspfile "2c7vB.bssp"
#ERROR : Can't open dsspfile "2c7vA.bssp"
#ERROR : Can't open dsspfile "3ijrH.bssp"
#ERROR : Can't open dsspfile "3ijrF.bssp"
#ERROR : Can't open dsspfile "3ijrE.bssp"
#ERROR : Can't open dsspfile "3ijrB.bssp"
#ERROR : Can't open dsspfile "3ijrA.bssp"
#ERROR : Can't open dsspfile "2wd7C.bssp"
#ERROR : Can't open dsspfile "1uayB.bssp"
#ERROR : Can't open dsspfile "3bmnD.bssp"
#ERROR : Can't open dsspfile "3bmeB.bssp"
#ERROR : Can't open dsspfile "3bmiB.bssp"
#ERROR : Can't open dsspfile "2c7vD.bssp"
#ERROR : Can't open dsspfile "3bmqA.bssp"
#ERROR : Can't open dsspfile "3bmnC.bssp"
#ERROR : Can't open dsspfile "3bmeA.bssp"
#ERROR : Can't open dsspfile "2wd7B.bssp"
#ERROR : Can't open dsspfile "3bmoC.bssp"
#ERROR : Can't open dsspfile "3bmjD.bssp"
#ERROR : Can't open dsspfile "2vz0A.bssp"
#ERROR : Can't open dsspfile "3i3oG.bssp"
#ERROR : Can't open dsspfile "3bmoD.bssp"
#ERROR : Can't open dsspfile "3bmnA.bssp"
#ERROR : Can't open dsspfile "3bmkC.bssp"
#ERROR : Can't open dsspfile "1pr9A.bssp"
#ERROR : Can't open dsspfile "3bmnB.bssp"
#ERROR : Can't open dsspfile "3bmqC.bssp"
#ERROR : Can't open dsspfile "3bmfD.bssp"
#ERROR : Can't open dsspfile "3bmfA.bssp"
#ERROR : Can't open dsspfile "2vz0B.bssp"
#ERROR : Can't open dsspfile "3g1tA.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "3bmoA.bssp"
#ERROR : Can't open dsspfile "3bmfB.bssp"
#ERROR : Can't open dsspfile "3bmdB.bssp"
#ERROR : Can't open dsspfile "2c7vC.bssp"
#ERROR : Can't open dsspfile "3d3wA.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "3bmfC.bssp"
#ERROR : Can't open dsspfile "1ybvA.bssp"
#ERROR : Can't open dsspfile "1g0oC.bssp"
#ERROR : Can't open dsspfile "1g0oA.bssp"
#ERROR : Can't open dsspfile "3e03C.bssp"
#ERROR : Can't open dsspfile "3e03B.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "2bd0A.bssp"
#ERROR : Can't open dsspfile "1u7tA.bssp"
#ERROR : Can't open dsspfile "1p33D.bssp"
#ERROR : Can't open dsspfile "2o23B.bssp"
#ERROR : Can't open dsspfile "1fdvB.bssp"
#ERROR : Can't open dsspfile "1xg5C.bssp"
#ERROR : Can't open dsspfile "2o23A.bssp"
#ERROR : Can't open dsspfile "1xu9B.bssp"
#ERROR : Can't open dsspfile "1xu9A.bssp"
#ERROR : Can't open dsspfile "1xu7D.bssp"
#ERROR : Can't open dsspfile "1xu7B.bssp"
#ERROR : Can't open dsspfile "1xu7A.bssp"
#ERROR : Can't open dsspfile "1so8A.bssp"
#ERROR : Can't open dsspfile "2rbeD.bssp"
#ERROR : Can't open dsspfile "2rbeC.bssp"
#ERROR : Can't open dsspfile "2rbeB.bssp"
#ERROR : Can't open dsspfile "2rbeA.bssp"
#ERROR : Can't open dsspfile "2irwC.bssp"
#ERROR : Can't open dsspfile "2irwA.bssp"
#ERROR : Can't open dsspfile "1iolA.bssp"
#ERROR : Can't open dsspfile "2iltA.bssp"
#ERROR : Can't open dsspfile "3hfgA.bssp"
#ERROR : Can't open dsspfile "3gz4B.bssp"
#ERROR : Can't open dsspfile "3gz4A.bssp"
#ERROR : Can't open dsspfile "3ey4C.bssp"
#ERROR : Can't open dsspfile "3ey4A.bssp"
#ERROR : Can't open dsspfile "3e03A.bssp"
#ERROR : Can't open dsspfile "3d5qB.bssp"
#ERROR : Can't open dsspfile "3d4nB.bssp"
#ERROR : Can't open dsspfile "3ch6E.bssp"
#ERROR : Can't open dsspfile "3ch6D.bssp"
#ERROR : Can't open dsspfile "3ch6B.bssp"
#ERROR : Can't open dsspfile "3ch6A.bssp"
#ERROR : Can't open dsspfile "3bzuB.bssp"
#ERROR : Can't open dsspfile "3bzuA.bssp"
#ERROR : Can't open dsspfile "3byzA.bssp"
#ERROR : Can't open dsspfile "2belD.bssp"
#ERROR : Can't open dsspfile "2belB.bssp"
#ERROR : Can't open dsspfile "2belA.bssp"
#ERROR : Can't open dsspfile "2yw9B.bssp"
#ERROR : Can't open dsspfile "1qyxA.bssp"
#ERROR : Can't open dsspfile "1qyvA.bssp"
#ERROR : Can't open dsspfile "1fduD.bssp"
#ERROR : Can't open dsspfile "1fduA.bssp"
#ERROR : Can't open dsspfile "1p33C.bssp"
#ERROR : Can't open dsspfile "1p33B.bssp"
#ERROR : Can't open dsspfile "1jtvA.bssp"
#ERROR : Can't open dsspfile "1fdwA.bssp"
#ERROR : Can't open dsspfile "1fduC.bssp"
#ERROR : Can't open dsspfile "1fduB.bssp"
#ERROR : Can't open dsspfile "1fdsA.bssp"
#ERROR : Can't open dsspfile "3deyX.bssp"
#ERROR : Can't open dsspfile "3bzuD.bssp"
#ERROR : Can't open dsspfile "1bhsA.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "1p33A.bssp"
#ERROR : Can't open dsspfile "1e6wC.bssp"
#ERROR : Can't open dsspfile "1ydeP.bssp"
#ERROR : Can't open dsspfile "1ydeM.bssp"
#ERROR : Can't open dsspfile "1ydeI.bssp"
#ERROR : Can't open dsspfile "1ydeH.bssp"
#ERROR : Can't open dsspfile "1ydeG.bssp"
#ERROR : Can't open dsspfile "1ydeF.bssp"
#ERROR : Can't open dsspfile "1ydeD.bssp"
#ERROR : Can't open dsspfile "1ydeA.bssp"
#ERROR : Can't open dsspfile "3f5qB.bssp"
#ERROR : Can't open dsspfile "3f5qA.bssp"
#ERROR : Can't open dsspfile "3f1lB.bssp"
#ERROR : Can't open dsspfile "3f1lA.bssp"
#ERROR : Can't open dsspfile "3d3eB.bssp"
#ERROR : Can't open dsspfile "3d3eA.bssp"
#ERROR : Can't open dsspfile "1w73A.bssp"
#ERROR : Can't open dsspfile "3gy0A.bssp"
#ERROR : Can't open dsspfile "3f5sB.bssp"
#ERROR : Can't open dsspfile "3f5sA.bssp"
#ERROR : Can't open dsspfile "1w0cC.bssp"
#ERROR : Can't open dsspfile "3hfgB.bssp"
#ERROR : Can't open dsspfile "3d4nD.bssp"
#ERROR : Can't open dsspfile "1xq1A.bssp"
#ERROR : Can't open dsspfile "1w73C.bssp"
#ERROR : Can't open dsspfile "3d4nC.bssp"
#ERROR : Can't open dsspfile "3czrA.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "1gz6A.bssp"
#ERROR : Can't open dsspfile "3gegA.bssp"
#ERROR : Can't open dsspfile "1e6wA.bssp"
#ERROR : Can't open dsspfile "1e3wA.bssp"
#ERROR : Can't open dsspfile "2dknA.bssp"
#ERROR : Can't open dsspfile "1xu9C.bssp"
#ERROR : Can't open dsspfile "3hfgC.bssp"
#ERROR : Can't open dsspfile "1g0nB.bssp"
#ERROR : Can't open dsspfile "1e6wD.bssp"
#ERROR : Can't open dsspfile "1e6wB.bssp"
#ERROR : Can't open dsspfile "1uluB.bssp"
#ERROR : Can't open dsspfile "3d4nA.bssp"
#ERROR : Can't open dsspfile "2yw9A.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "1e3sA.bssp"
#ERROR : Can't open dsspfile "2bf7B.bssp"
#ERROR : Can't open dsspfile "3hfgD.bssp"
#ERROR : Can't open dsspfile "3gedB.bssp"
#ERROR : Can't open dsspfile "3gedA.bssp"
#ERROR : Can't open dsspfile "3frjA.bssp"
#ERROR : Can't open dsspfile "1e92B.bssp"
#ERROR : Can't open dsspfile "1e7wA.bssp"
#ERROR : Can't open dsspfile "3d5qA.bssp"
#ERROR : Can't open dsspfile "3bzuC.bssp"
#ERROR : Can't open dsspfile "2bfmC.bssp"
#ERROR : Can't open dsspfile "2yw9D.bssp"
#ERROR : Can't open dsspfile "1xu9D.bssp"
#ERROR : Can't open dsspfile "2qhxA.bssp"
#ERROR : Can't open dsspfile "3d5qD.bssp"
#ERROR : Can't open dsspfile "3d5qC.bssp"
#ERROR : Can't open dsspfile "2bf7C.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"
#ERROR : Can't open dsspfile "1xg5B.bssp"
#ERROR : Can't open dsspfile "1w0cA.bssp"
#ERROR : Can't open dsspfile "2a4kB.bssp"
#ERROR : Can't open dsspfile "2yw9H.bssp"
#ERROR : Can't open dsspfile "1ydeN.bssp"
#ERROR : Can't open dsspfile "1ydeB.bssp"
#ERROR : Can't open dsspfile "1e92D.bssp"
#ERROR : Can't open dsspfile "2bfpB.bssp"
#ERROR : Can't open dsspfile "2bfaA.bssp"
#ERROR : Can't open dsspfile "2bf7A.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "1w0cF.bssp"
#ERROR : Can't open dsspfile "1gz6C.bssp"
#ERROR : Can't open dsspfile "1e92C.bssp"
#ERROR : Can't open dsspfile "3dijA.bssp"
#ERROR : Can't open dsspfile "2bfpD.bssp"
#ERROR : Can't open dsspfile "2bfmB.bssp"
#ERROR : Can't open dsspfile "2bfaB.bssp"
#ERROR : Can't open dsspfile "1w73D.bssp"
#ERROR : Can't open dsspfile "1w0cE.bssp"
#ERROR : Can't open dsspfile "1w0cB.bssp"
#ERROR : Can't open dsspfile "2p8kB.bssp"
#ERROR : Can't open dsspfile "3ctmA.bssp"
#ERROR : Can't open dsspfile "2bfoA.bssp"
#ERROR : Can't open dsspfile "2yw9C.bssp"
#ERROR : Can't open dsspfile "1w0cH.bssp"
#ERROR : Can't open dsspfile "2p8kG.bssp"
#ERROR : Can't open dsspfile "2p8kD.bssp"
#ERROR : Can't open dsspfile "2p8kA.bssp"
#ERROR : Can't open dsspfile "1gz6B.bssp"
#ERROR : Can't open dsspfile "1e92A.bssp"
#ERROR : Can't open dsspfile "2yw9E.bssp"
#ERROR : Can't open dsspfile "1w0cG.bssp"
#ERROR : Can't open dsspfile "2qhxC.bssp"
#ERROR : Can't open dsspfile "1e7wB.bssp"
#ERROR : Can't open dsspfile "2bfoC.bssp"
#ERROR : Can't open dsspfile "1uluA.bssp"
#ERROR : Can't open dsspfile "2p8kC.bssp"
#ERROR : Can't open dsspfile "3diiA.bssp"
#ERROR : Can't open dsspfile "2yw9F.bssp"
#ERROR : Can't open dsspfile "1w73B.bssp"
#ERROR : Can't open dsspfile "2qhxD.bssp"
#ERROR : Can't open dsspfile "1uluC.bssp"
#ERROR : Can't open dsspfile "1y5mA.bssp"
#ERROR : Can't open dsspfile "1uluD.bssp"
#ERROR : Can't open dsspfile "2p8kH.bssp"
#ERROR : Can't open dsspfile "3ctmE.bssp"
#ERROR : Can't open dsspfile "2bfaC.bssp"
#ERROR : Can't open dsspfile "2bf7D.bssp"
#ERROR : Can't open dsspfile "3ctmG.bssp"
#ERROR : Can't open dsspfile "2bfaD.bssp"
#ERROR : Can't open dsspfile "3ctmC.bssp"
#ERROR : Can't open dsspfile "1hxhA.bssp"
#ERROR : Can't open dsspfile "2fwmX.bssp"
#ERROR : Can't open dsspfile "1pwxA.bssp"
#ERROR : Can't open dsspfile "1zmoA.bssp"
#ERROR : Can't open dsspfile "1mxfA.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "2qq5A.bssp"
#ERROR : Can't open dsspfile "2dknB.bssp"
#ERROR : Can't open dsspfile "1mxhA.bssp"
#ERROR : Can't open dsspfile "3ctmF.bssp"
#ERROR : Can't open dsspfile "3ctmD.bssp"
#ERROR : Can't open dsspfile "3ctmB.bssp"
#ERROR : Can't open dsspfile "1fk8A.bssp"
#ERROR : Can't open dsspfile "1mg5A.bssp"
#ERROR : Can't open dsspfile "3ctmH.bssp"
#ERROR : Can't open dsspfile "3guyH.bssp"
#ERROR : Can't open dsspfile "3guyG.bssp"
#ERROR : Can't open dsspfile "3guyD.bssp"
#ERROR : Can't open dsspfile "3guyC.bssp"
#ERROR : Can't open dsspfile "3guyB.bssp"
#ERROR : Can't open dsspfile "2p91A.bssp"
#ERROR : Can't open dsspfile "3guyA.bssp"
#ERROR : Can't open dsspfile "1z6zE.bssp"
#ERROR : Can't open dsspfile "1z6zD.bssp"
#ERROR : Can't open dsspfile "1z6zB.bssp"
#ERROR : Can't open dsspfile "1z6zA.bssp"
#ERROR : Can't open dsspfile "1qsgG.bssp"
#ERROR : Can't open dsspfile "1qsgA.bssp"
#ERROR : Can't open dsspfile "1qg6A.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "3e9nA.bssp"
#ERROR : Can't open dsspfile "2fhsB.bssp"
#ERROR : Can't open dsspfile "1lxcA.bssp"
#ERROR : Can't open dsspfile "2p91B.bssp"
#ERROR : Can't open dsspfile "1i30A.bssp"
#ERROR : Can't open dsspfile "1dfiA.bssp"
#ERROR : Can't open dsspfile "2jjyB.bssp"
#ERROR : Can't open dsspfile "1enoA.bssp"
#ERROR : Can't open dsspfile "3e9nD.bssp"
#ERROR : Can't open dsspfile "1d7oA.bssp"
#ERROR : Can't open dsspfile "1cwuA.bssp"
#ERROR : Can't open dsspfile "2qioA.bssp"
#ERROR : Can't open dsspfile "1n5dA.bssp"
#ERROR : Can't open dsspfile "2jjyA.bssp"
#ERROR : Can't open dsspfile "3e9nC.bssp"
#ERROR : Can't open dsspfile "3f1kA.bssp"
#ERROR : Can't open dsspfile "3ek2B.bssp"
#ERROR : Can't open dsspfile "3ek2C.bssp"
#ERROR : Can't open dsspfile "3e9qB.bssp"
#ERROR : Can't open dsspfile "3e9qA.bssp"
#ERROR : Can't open dsspfile "3e9nH.bssp"
#ERROR : Can't open dsspfile "3e9nF.bssp"
#ERROR : Can't open dsspfile "3e9nE.bssp"
#ERROR : Can't open dsspfile "2jjyC.bssp"

## Summary of PDB Search
:264
    4e-39  40%  1x7hB  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    4e-39  40%  1x7gA  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    4e-39  40%  1w4zA  [c.2.1] KETOACYL REDUCTASE
    4e-39  40%  2rhrA  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    4e-39  40%  2rh4B  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    4e-39  40%  2rh4A  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-38  42%  1xr3B  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    3e-38  41%  2yz7A  [x.x.x] D-3-HYDROXYBUTYRATE DEHYDROGENASE
    3e-38  41%  1w4zB  [c.2.1] KETOACYL REDUCTASE
    3e-38  41%  2rhrB  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    3e-38  41%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    1e-36  41%  1x7gB  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    4e-36  39%  2ztlA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    4e-36  38%  2q2vA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-35  39%  2ztmA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-35  40%  2q2wA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-35  39%  2q2qB  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    4e-35  40%  2q2wC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    4e-35  40%  2q2qA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    5e-35  41%  2q2vD  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    5e-35  39%  2q2qE  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    6e-35  39%  2q2vB  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-34  40%  2q2wD  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-34  40%  2q2vC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-34  38%  2q2qG  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-34  41%  2q2qC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    3e-34  39%  2ztvC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-33  39%  2ztvD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    3e-33  41%  2q2qF  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    4e-33  39%  2ztmC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    7e-33  42%  2q2qH  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-32  40%  2ztvB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-32  40%  2ztmD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    4e-32  41%  2ztuC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-31  35%  2p68A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-31  41%  2ztuD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    4e-31  40%  3ezlA  [x.x.x] ACETOACETYL-COA REDUCTASE
    5e-31  41%  2ztmB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-30  38%  1uznA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-30  41%  2ztuB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    3e-30  41%  1x1tA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-29  41%  2ztuA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-29  37%  2uvdA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    4e-29  41%  2ph3A  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    5e-29  36%  2zk7B  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    5e-29  36%  2dteA  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    9e-29  36%  2p68B  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-28  43%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    3e-28  33%  1iy8A  [c.2.1] LEVODIONE REDUCTASE
    3e-28  34%  1gegE  [c.2.1] ACETOIN REDUCTASE
    3e-28  34%  1gegA  [c.2.1] ACETOIN REDUCTASE
    4e-28  37%  1q7bB  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    4e-28  37%  1q7bA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-27  41%  1uznB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-27  36%  1q7cA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-27  38%  3ftpA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-27  46%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    2e-27  46%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    4e-27  45%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    6e-27  40%  1uzlB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    6e-27  38%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    8e-27  39%  1uzlA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-26  37%  3ftpC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-26  34%  3gk3D  [x.x.x] ACETOACETYL-COA REDUCTASE
    2e-26  34%  3gk3B  [x.x.x] ACETOACETYL-COA REDUCTASE
    4e-26  39%  2zk7A  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    5e-26  39%  1uzmA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    7e-26  38%  3ftpD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-25  41%  2ntnA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-25  39%  1hdcA  [c.2.1] 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-25  35%  3gvcC  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    2e-25  35%  3gvcB  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    2e-25  44%  1x1eA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    2e-25  35%  3gk3A  [x.x.x] ACETOACETYL-COA REDUCTASE
    2e-25  44%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    3e-25  36%  3gk3C  [x.x.x] ACETOACETYL-COA REDUCTASE
    4e-25  37%  1i01E  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    7e-25  38%  2nm0A  [x.x.x] PROBABLE 3-OXACYL-(ACYL-CARRIER-PROTEIN)
    7e-25  35%  3gvcA  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    1e-24  41%  2ph3B  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    1e-24  46%  2ekqD  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    3e-24  35%  3gvcD  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    5e-24  33%  1yxmD  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    5e-24  36%  1edoA  [c.2.1] BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
    6e-24  33%  1yxmA  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    1e-23  39%  1nffA  [c.2.1] PUTATIVE OXIDOREDUCTASE RV2002
    2e-23  37%  1i01B  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    2e-23  36%  3gafA  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-23  31%  1zemA  [x.x.x] XYLITOL DEHYDROGENASE
    3e-23  36%  3gafD  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-23  31%  2c07A  [x.x.x] 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
    4e-23  31%  1k2wA  [c.2.1] SORBITOL DEHYDROGENASE
    5e-23  37%  1i01A  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    5e-23  36%  3gafF  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-23  38%  1i01F  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-22  31%  1yxmB  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    1e-22  42%  2ntnB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-22  33%  2hq1A  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-22  36%  3gafG  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-22  36%  3gafC  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-22  45%  1i01C  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    3e-22  36%  3gafB  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-22  41%  3f9iA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    3e-22  41%  1uzmB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-22  40%  2pd6D  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    3e-22  40%  2pd6C  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    3e-22  40%  2pd6B  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    3e-22  37%  1i01G  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    3e-22  31%  1fmcA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-22  31%  1ahhA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    8e-22  31%  2z1nB  [x.x.x] DEHYDROGENASE
    8e-22  33%  1o5iA  [c.2.1] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    8e-22  32%  3ennB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-21  36%  1i01H  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-21  34%  3gafH  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-21  36%  3gafE  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-21  32%  3emkA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-21  38%  1nfrA  [c.2.1] PUTATIVE OXIDOREDUCTASE RV2002
    2e-21  34%  3ennD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-21  34%  3ennC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-21  45%  2a4kA  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    4e-21  37%  1i01D  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    4e-21  32%  3emkD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    5e-21  33%  3ennA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    7e-21  37%  3f9iB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    9e-21  34%  1zjyA  [x.x.x] R-SPECIFIC ALCOHOL DEHYDROGENASE
    9e-21  34%  1nxqA  [c.2.1] R-ALCOHOL DEHYDROGENASE
    1e-20  33%  1yxmC  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    1e-20  33%  3emkB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-20  40%  1ulsB  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    1e-20  40%  1ulsA  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    1e-20  28%  3cxtA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    2e-20  32%  2z1nA  [x.x.x] DEHYDROGENASE
    2e-20  32%  3emkC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    3e-20  41%  2pd6A  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    4e-20  36%  2japC  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    4e-20  36%  2japA  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    4e-20  34%  3grpA  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    4e-20  27%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    4e-19  41%  1ulsC  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    1e-18  28%  1ja9A  [c.2.1] 1,3,6,8-TETRAHYDROXYNAPHTHALENE REDUCTASE
    1e-18  30%  3i4fA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-18  33%  3i4fD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-18  28%  2b4qA  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    3e-18  36%  3grpB  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    4e-18  31%  2ewmA  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    4e-18  31%  1ae1B  [c.2.1] TROPINONE REDUCTASE-I
    7e-18  33%  3i4fC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    9e-18  32%  2ewmB  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    9e-18  31%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    1e-17  37%  2gdzA  [x.x.x] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN
    1e-17  31%  2ae2A  [c.2.1] PROTEIN (TROPINONE REDUCTASE-II)
    3e-17  30%  1xkqB  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5D234)
    3e-17  30%  1xkqA  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5D234)
    3e-17  35%  3grpC  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    3e-17  33%  2ew8B  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    3e-17  33%  2ew8A  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    3e-17  29%  1cydA  [c.2.1] CARBONYL REDUCTASE
    3e-17  38%  3imfB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-17  36%  2et6A  [x.x.x] (3R)-HYDROXYACYL-COA DEHYDROGENASE
    7e-17  33%  1w6uA  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    1e-16  28%  1xhlA  [c.2.1] SHORT-CHAIN DEHYDROGENASE/REDUCTASE FAMILY
    1e-16  34%  1w6uC  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    2e-16  32%  1yb1A  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    2e-16  34%  1w6uB  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    2e-16  36%  3grpD  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    3e-16  29%  3iccA  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL CARRIER PROTEIN)
    3e-16  31%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    4e-16  37%  2ehdA  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    4e-16  29%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    5e-16  33%  1ae1A  [c.2.1] TROPINONE REDUCTASE-I
    6e-16  31%  1yb1B  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    6e-16  28%  3i3oF  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-16  28%  3i3oE  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-16  28%  3i3oC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-16  28%  3i3oB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-16  28%  3i3oA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-16  28%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    6e-16  28%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    6e-16  28%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    8e-16  38%  3imfA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-15  36%  2jahC  [x.x.x] CLAVULANIC ACID DEHYDROGENASE
    1e-15  36%  2jahA  [x.x.x] CLAVULANIC ACID DEHYDROGENASE
    1e-15  33%  1w6uD  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    2e-15  28%  2zatA  [x.x.x] DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 4
    2e-15  38%  2ehdB  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    3e-15  27%  1vl8B  [c.2.1] GLUCONATE 5-DEHYDROGENASE
    3e-15  27%  1vl8A  [c.2.1] GLUCONATE 5-DEHYDROGENASE
    3e-15  31%  1g6kA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    7e-15  30%  1rwbA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    7e-15  28%  3i3oH  [x.x.x] SHORT CHAIN DEHYDROGENASE
    7e-15  38%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    7e-15  38%  3edmA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-14  30%  1geeA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    1e-14  30%  1gcoA  [c.2.1] GLUCOSE DEHYDROGENASE
    2e-14  39%  3imfC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-14  36%  1zbqA  [x.x.x] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4
    3e-14  39%  1uayA  [c.2.1] TYPE II 3-HYDROXYACYL-COA DEHYDROGENASE
    5e-14  38%  3edmD  [x.x.x] SHORT CHAIN DEHYDROGENASE
    5e-14  38%  3edmC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-14  31%  2c7vB  [x.x.x] PTERIDINE REDUCTASE
    6e-14  31%  2c7vA  [x.x.x] PTERIDINE REDUCTASE
    8e-14  29%  3ijrH  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    8e-14  29%  3ijrF  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    8e-14  29%  3ijrE  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    8e-14  29%  3ijrB  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    8e-14  29%  3ijrA  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    1e-13  31%  2wd7C  [x.x.x] PTERIDINE REDUCTASE
    1e-13  40%  1uayB  [c.2.1] TYPE II 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-13  33%  3bmnD  [x.x.x] PTERIDINE REDUCTASE
    1e-13  31%  3bmeB  [x.x.x] PTERIDINE REDUCTASE
    1e-13  34%  3bmiB  [x.x.x] PTERIDINE REDUCTASE
    2e-13  31%  2c7vD  [x.x.x] PTERIDINE REDUCTASE
    2e-13  33%  3bmqA  [x.x.x] PTERIDINE REDUCTASE
    2e-13  33%  3bmnC  [x.x.x] PTERIDINE REDUCTASE
    2e-13  32%  3bmeA  [x.x.x] PTERIDINE REDUCTASE
    2e-13  32%  2wd7B  [x.x.x] PTERIDINE REDUCTASE
    2e-13  33%  3bmoC  [x.x.x] PTERIDINE REDUCTASE
    2e-13  33%  3bmjD  [x.x.x] PTERIDINE REDUCTASE
    3e-13  34%  2vz0A  [x.x.x] PTERIDINE REDUCTASE
    3e-13  30%  3i3oG  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-13  33%  3bmoD  [x.x.x] PTERIDINE REDUCTASE
    3e-13  34%  3bmnA  [x.x.x] PTERIDINE REDUCTASE
    3e-13  34%  3bmkC  [x.x.x] PTERIDINE REDUCTASE
    4e-13  27%  1pr9A  [c.2.1] L-XYLULOSE REDUCTASE
    4e-13  34%  3bmnB  [x.x.x] PTERIDINE REDUCTASE
    5e-13  34%  3bmqC  [x.x.x] PTERIDINE REDUCTASE
    5e-13  34%  3bmfD  [x.x.x] PTERIDINE REDUCTASE
    5e-13  34%  3bmfA  [x.x.x] PTERIDINE REDUCTASE
    7e-13  34%  2vz0B  [x.x.x] PTERIDINE REDUCTASE
    7e-13  33%  3g1tA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    9e-13  29%  1spxA  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    1e-12  34%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    1e-12  35%  3bmoA  [x.x.x] PTERIDINE REDUCTASE
    1e-12  34%  3bmfB  [x.x.x] PTERIDINE REDUCTASE
    1e-12  34%  3bmdB  [x.x.x] PTERIDINE REDUCTASE
    1e-12  32%  2c7vC  [x.x.x] PTERIDINE REDUCTASE
    2e-12  27%  3d3wA  [x.x.x] L-XYLULOSE REDUCTASE
    2e-12  34%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    2e-12  35%  3bmfC  [x.x.x] PTERIDINE REDUCTASE
    3e-12  25%  1ybvA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    3e-12  25%  1g0oC  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    3e-12  25%  1g0oA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    3e-12  35%  3e03C  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-12  35%  3e03B  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-12  25%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    3e-12  25%  1dohA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    3e-12  31%  2bd0A  [x.x.x] SEPIAPTERIN REDUCTASE
    6e-12  37%  1u7tA  [c.2.1] 3-HYDROXYACYL-COA DEHYDROGENASE TYPE II
    6e-12  37%  1p33D  [c.2.1] PTERIDINE REDUCTASE 1
    6e-12  37%  2o23B  [x.x.x] HADH2 PROTEIN
    6e-12  31%  1fdvB  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    7e-12  27%  1xg5C  [c.2.1] ARPG836
    9e-12  38%  2o23A  [x.x.x] HADH2 PROTEIN
    1e-11  27%  1xu9B  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-11  27%  1xu9A  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-11  27%  1xu7D  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-11  27%  1xu7B  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-11  27%  1xu7A  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-11  37%  1so8A  [c.2.1] 3-HYDROXYACYL-COA DEHYDROGENASE TYPE II
    1e-11  27%  2rbeD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  2rbeC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  2rbeB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  2rbeA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  2irwC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  2irwA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  32%  1iolA  [x.x.x] ESTROGENIC 17-BETA HYDROXYSTEROID DEHYDROGENASE
    1e-11  27%  2iltA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  3hfgA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  35%  3gz4B  [x.x.x] HYPOTHETICAL OXIDOREDUCTASE YCIK
    1e-11  35%  3gz4A  [x.x.x] HYPOTHETICAL OXIDOREDUCTASE YCIK
    1e-11  27%  3ey4C  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-11  27%  3ey4A  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-11  34%  3e03A  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-11  27%  3d5qB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  3d4nB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  3ch6E  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  3ch6D  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  3ch6B  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  3ch6A  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  3bzuB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  3bzuA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  3byzA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  2belD  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  2belB  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-11  27%  2belA  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-11  33%  2yw9B  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-11  33%  1qyxA  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 1
    2e-11  33%  1qyvA  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 1
    2e-11  30%  1fduD  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-11  30%  1fduA  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    3e-11  37%  1p33C  [c.2.1] PTERIDINE REDUCTASE 1
    3e-11  37%  1p33B  [c.2.1] PTERIDINE REDUCTASE 1
    3e-11  32%  1jtvA  [c.2.1] 17 BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    3e-11  32%  1fdwA  [x.x.x] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    3e-11  32%  1fduC  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    3e-11  32%  1fduB  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    3e-11  32%  1fdsA  [x.x.x] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    3e-11  32%  3deyX  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 1
    3e-11  30%  3bzuD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-11  32%  1bhsA  [c.2.1 (1dhtA)] 17BETA-HYDROXYSTEROID DEHYDROGENASE
    3e-11  32%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    4e-11  36%  1p33A  [c.2.1] PTERIDINE REDUCTASE 1
    4e-11  34%  1e6wC  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    5e-11  28%  1ydeP  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    5e-11  28%  1ydeM  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    5e-11  28%  1ydeI  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    5e-11  28%  1ydeH  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    5e-11  28%  1ydeG  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    5e-11  28%  1ydeF  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    5e-11  28%  1ydeD  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    5e-11  28%  1ydeA  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    5e-11  35%  3f5qB  [x.x.x] DEHYGROGENASE
    5e-11  35%  3f5qA  [x.x.x] DEHYGROGENASE
    5e-11  34%  3f1lB  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    5e-11  34%  3f1lA  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    5e-11  27%  3d3eB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-11  27%  3d3eA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-11  28%  1w73A  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    6e-11  33%  3gy0A  [x.x.x] DEHYDROGENASE
    6e-11  33%  3f5sB  [x.x.x] DEHYDROGENASE
    6e-11  33%  3f5sA  [x.x.x] DEHYDROGENASE
    8e-11  35%  1w0cC  [c.2.1] PTERIDINE REDUCTASE
    8e-11  28%  3hfgB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    8e-11  28%  3d4nD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-10  39%  1xq1A  [c.2.1] PUTATIVE TROPINONE REDUCATSE
    1e-10  28%  1w73C  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    1e-10  27%  3d4nC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-10  27%  3czrA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-10  25%  1h5qA  [c.2.1] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    1e-10  33%  1gz6A  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    1e-10  30%  3gegA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    1e-10  35%  1e6wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-10  35%  1e3wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-10  35%  2dknA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-10  29%  1xu9C  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    2e-10  29%  3hfgC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-10  26%  1g0nB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-10  36%  1e6wD  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    2e-10  36%  1e6wB  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    2e-10  34%  1uluB  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    2e-10  27%  3d4nA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-10  34%  2yw9A  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    3e-10  29%  1xg5A  [c.2.1] ARPG836
    3e-10  37%  1e3sA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    3e-10  35%  2bf7B  [x.x.x] PTERIDINE REDUCTASE 1
    4e-10  29%  3hfgD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-10  31%  3gedB  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    4e-10  31%  3gedA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    4e-10  27%  3frjA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    4e-10  35%  1e92B  [c.2.1] PTERIDINE REDUCTASE 1
    4e-10  34%  1e7wA  [c.2.1] PTERIDINE REDUCTASE
    4e-10  29%  3d5qA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-10  29%  3bzuC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-10  36%  2bfmC  [x.x.x] PTERIDINE REDUCTASE 1
    5e-10  32%  2yw9D  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    5e-10  29%  1xu9D  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    5e-10  35%  2qhxA  [x.x.x] PTERIDINE REDUCTASE 1
    5e-10  29%  3d5qD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-10  29%  3d5qC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-10  36%  2bf7C  [x.x.x] PTERIDINE REDUCTASE 1
    5e-10  27%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    7e-10  29%  1xg5B  [c.2.1] ARPG836
    7e-10  36%  1w0cA  [c.2.1] PTERIDINE REDUCTASE
    7e-10  41%  2a4kB  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    9e-10  33%  2yw9H  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    9e-10  29%  1ydeN  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    9e-10  29%  1ydeB  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    9e-10  36%  1e92D  [c.2.1] PTERIDINE REDUCTASE 1
    9e-10  35%  2bfpB  [x.x.x] PTERIDINE REDUCTASE 1
    9e-10  35%  2bfaA  [x.x.x] PTERIDINE REDUCTASE 1
    9e-10  35%  2bf7A  [x.x.x] PTERIDINE REDUCTASE 1
    9e-10  31%  1bdbA  [x.x.x] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    1e-09  35%  1w0cF  [c.2.1] PTERIDINE REDUCTASE
    1e-09  35%  1gz6C  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    1e-09  35%  1e92C  [c.2.1] PTERIDINE REDUCTASE 1
    1e-09  36%  3dijA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    1e-09  38%  2bfpD  [x.x.x] PTERIDINE REDUCTASE 1
    1e-09  36%  2bfmB  [x.x.x] PTERIDINE REDUCTASE 1
    1e-09  35%  2bfaB  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  27%  1w73D  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    2e-09  35%  1w0cE  [c.2.1] PTERIDINE REDUCTASE
    2e-09  36%  1w0cB  [c.2.1] PTERIDINE REDUCTASE
    2e-09  36%  2p8kB  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  25%  3ctmA  [x.x.x] CARBONYL REDUCTASE
    2e-09  36%  2bfoA  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  33%  2yw9C  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-09  34%  1w0cH  [c.2.1] PTERIDINE REDUCTASE
    2e-09  34%  2p8kG  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  38%  2p8kD  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  36%  2p8kA  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  33%  1gz6B  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    2e-09  34%  1e92A  [c.2.1] PTERIDINE REDUCTASE 1
    3e-09  32%  2yw9E  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    3e-09  33%  1w0cG  [c.2.1] PTERIDINE REDUCTASE
    3e-09  35%  2qhxC  [x.x.x] PTERIDINE REDUCTASE 1
    3e-09  33%  1e7wB  [c.2.1] PTERIDINE REDUCTASE
    3e-09  33%  2bfoC  [x.x.x] PTERIDINE REDUCTASE 1
    3e-09  34%  1uluA  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    3e-09  35%  2p8kC  [x.x.x] PTERIDINE REDUCTASE 1
    3e-09  37%  3diiA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    4e-09  32%  2yw9F  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    6e-09  27%  1w73B  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    6e-09  35%  2qhxD  [x.x.x] PTERIDINE REDUCTASE 1
    8e-09  35%  1uluC  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    1e-08  24%  1y5mA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    1e-08  35%  1uluD  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    1e-08  34%  2p8kH  [x.x.x] PTERIDINE REDUCTASE 1
    1e-08  26%  3ctmE  [x.x.x] CARBONYL REDUCTASE
    1e-08  37%  2bfaC  [x.x.x] PTERIDINE REDUCTASE 1
    2e-08  39%  2bf7D  [x.x.x] PTERIDINE REDUCTASE 1
    2e-08  26%  3ctmG  [x.x.x] CARBONYL REDUCTASE
    2e-08  35%  2bfaD  [x.x.x] PTERIDINE REDUCTASE 1
    3e-08  26%  3ctmC  [x.x.x] CARBONYL REDUCTASE
    5e-08  26%  1hxhA  [c.2.1] 3BETA/17BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-07  34%  2fwmX  [x.x.x] 2,3-DIHYDRO-2,3-DIHYDROXYBENZOATE DEHYDROGENASE
    3e-07  25%  1pwxA  [c.2.1] HALOHYDRIN DEHALOGENASE
    4e-07  24%  1zmoA  [x.x.x] HALOHYDRIN DEHALOGENASE
    7e-07  38%  1mxfA  [c.2.1] PTERIDINE REDUCTASE 2
    9e-07  35%  1a4uA  [c.2.1] ALCOHOL DEHYDROGENASE
    1e-06  28%  2qq5A  [x.x.x] DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 1
    1e-06  42%  2dknB  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-06  32%  1mxhA  [c.2.1] PTERIDINE REDUCTASE 2
    2e-06  27%  3ctmF  [x.x.x] CARBONYL REDUCTASE
    2e-06  26%  3ctmD  [x.x.x] CARBONYL REDUCTASE
    2e-06  26%  3ctmB  [x.x.x] CARBONYL REDUCTASE
    5e-06  35%  1fk8A  [c.2.1] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    6e-06  36%  1mg5A  [c.2.1] ALCOHOL DEHYDROGENASE
    6e-06  25%  3ctmH  [x.x.x] CARBONYL REDUCTASE
    8e-06  30%  3guyH  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    8e-06  30%  3guyG  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    8e-06  30%  3guyD  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    8e-06  30%  3guyC  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    8e-06  28%  3guyB  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    1e-05  28%  2p91A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-05  30%  3guyA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    5e-05  32%  1z6zE  [x.x.x] SEPIAPTERIN REDUCTASE
    5e-05  32%  1z6zD  [x.x.x] SEPIAPTERIN REDUCTASE
    5e-05  32%  1z6zB  [x.x.x] SEPIAPTERIN REDUCTASE
    5e-05  32%  1z6zA  [x.x.x] SEPIAPTERIN REDUCTASE
    5e-05  30%  1qsgG  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    5e-05  30%  1qsgA  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    5e-05  30%  1qg6A  [c.2.1] PROTEIN (ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE)
    5e-05  30%  1c14A  [c.2.1] ENOYL REDUCTASE
    7e-05  33%  3e9nA  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    9e-05  33%  2fhsB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE, NADH-
    1e-04  34%  1lxcA  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-04  26%  2p91B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-04  33%  1i30A  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-04  34%  1dfiA  [c.2.1] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    2e-04  36%  2jjyB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-04  34%  1enoA  [x.x.x] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    2e-04  32%  3e9nD  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    2e-04  34%  1d7oA  [c.2.1] ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH)
    2e-04  34%  1cwuA  [c.2.1] ENOYL ACP REDUCTASE
    3e-04  31%  2qioA  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    3e-04  35%  1n5dA  [c.2.1] CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID
    4e-04  34%  2jjyA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    4e-04  33%  3e9nC  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    6e-04  31%  3f1kA  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    6e-04  32%  3ek2B  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    7e-04  31%  3ek2C  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    7e-04  30%  3e9qB  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    7e-04  30%  3e9qA  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    7e-04  30%  3e9nH  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    7e-04  30%  3e9nF  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    7e-04  30%  3e9nE  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    0.001  35%  2jjyC  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGNALQGRHALVTXXXXXXXXXXXXXXXXXXXSVTLLGREQAALDATVHALQSCVIEGAALGAVSADITD
1x7hB           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
1x7gA           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
1w4zA           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
2rhrA           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
2rh4B           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
2rh4A           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
1xr3B           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
2yz7A           ---------------------------------------------------------------LNADLSD
1w4zB           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
2rhrB           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
3csdB           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
1x7gB           ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
2ztlA           -----------------------------------------------------------------ADLSK
2q2vA           -----------------------------------------------------------------ADLSD
2ztmA           -----------------------------------------------------------------ADLSK
2q2wA           -----------------------------------------------------------------ADLSD
2q2qB           -----------------------------------------------------------------ADLSD
2q2wC           -----------------------------------------------------------------ADLSD
2q2qA           -----------------------------------------------------------------ADLSD
2q2vD           -----------------------------------------------------------------ADLSD
2q2qE           -----------------------------------------------------------------ADLSD
2q2vB           -----------------------------------------------------------------ADLSD
2q2wD           -----------------------------------------------------------------ADLSD
2q2vC           -----------------------------------------------------------------ADLSD
2q2qG           -----------------------------------------------------------------ADLSD
2q2qC           -----------------------------------------------------------------ADLSD
2ztvC           -----------------------------------------------------------------ADLSK
2ztvD           -----------------------------------------------------------------ADLSK
2q2qF           -----------------------------------------------------------------ADLSD
2ztmC           -----------------------------------------------------------------ADLSK
2q2qH           -----------------------------------------------------------------ADLSD
2ztvB           -----------------------------------------------------------------ADLSK
2ztmD           -----------------------------------------------------------------ADLSK
2ztuC           -----------------------------------------------------------------ADLSK
2p68A           ----LQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKY--GVKAHGVEMNLLS
2ztuD           -----------------------------------------------------------------ADLSK
3ezlA           --------------------------------------------------------------ASEGNVGD
2ztmB           -----------------------------------------------------------------ADLSK
1uznA           ------------------------------------------------------------LFGVEVDVTD
2ztuB           -----------------------------------------------------------------ADLSK
1x1tA           -----------------------------------------------------------------ADLSK
2ztuA           -----------------------------------------------------------------ADLSK
2uvdA           --------------------------------------------------------------AVRADVAN
2ph3A           ----------------------------------------------------------------------
2zk7B           ---------------------------------------------------------------IECDVTN
2dteA           ---------------------------------------------------------------IECDVTN
2p68B           ----LQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKY--GVKAHGVEMNLLS
2d1yC           ----------------------------------------------------------------------
1iy8A           ---------------------------------LSLVDVSSEGLEASKAAVLETAPDAEVLTTV-ADVSD
1gegE           --------------------------------------------DATAKAVASEINQGGHAVAVKVDVSD
1gegA           --------------------------------------------DATAKAVASEINQGGHAVAVKVDVSD
1q7bB           ---------------------------------------------------------GANGKGLMLNVTD
1q7bA           ---------------------------------------------------------GANGKGLMLNVTD
1uznB           ------------------------------------------------------------LFGVEVDVTD
1q7cA           ---------------------------------------------------------GANGKGLMLNVTD
3ftpA           -------------------------------------------------------------GAV-LNVND
2d1yD           ----------------------------------------------------------------------
2d1yB           ----------------------------------------------------------------------
2d1yA           ----------------------------------------------------------------------
1uzlB           ------------------------------------------------------------LFGVECDVTD
2cfcA           ---------------------------------------------------------------VRADVAD
1uzlA           ------------------------------------------------------------LFGVECDVTD
3ftpC           -------------------------------------------------------------GAV-LNVND
3gk3D           ---------------------------------------------------------GRDFKAYAVDVAD
3gk3B           ---------------------------------------------------------GRDFKAYAVDVAD
2zk7A           ---------------------------------------------------------------IECDVTN
1uzmA           ------------------------------------------------------------LFGVEVDVTD
3ftpD           -------------------------------------------------------------GAV-LNVND
2ntnA           ------------------------------------------------------------LFGVEVDVTD
1hdcA           ------------------------------------------------------------------DVTE
3gvcC           ------------------------------------------------------------------DVSD
3gvcB           ------------------------------------------------------------------DVSD
1x1eA           ----------------------------------------------------------------------
3gk3A           ---------------------------------------------------------GRDFKAYAVDVAD
2ekpA           ----------------------------------------------------------------------
3gk3C           ---------------------------------------------------------GRDFKAYAVDVAD
1i01E           ---------------------------------------------------------GANGKGLMLNVTD
2nm0A           --------------------------------------------------------------AVKCDITD
3gvcA           ------------------------------------------------------------------DVSD
2ph3B           ----------------------------------------------------------------------
2ekqD           ----------------------------------------------------------------------
3gvcD           ------------------------------------------------------------------DVSD
1yxmD           ----LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANL---ARVIPIQCNIRN
1edoA           ------------------------------------------------------------------DVSK
1yxmA           ----LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLTKQARVIPIQCNIRN
1nffA           --------------------------------------------------------EGKAMAAVHLDVTQ
1i01B           ---------------------------------------------------------GANGKGLMLNVTD
3gafA           ---------------------------------------------------------GKAIG-LECNVTD
1zemA           --------------------------------AIALLDMNREALEKAEASVRE---KGVEARSYVCDVTS
3gafD           ---------------------------------------------------------GKAIG-LECNVTD
2c07A           ---------------------------------VICISRTQKSCDSVVDEIKSFGYESSGY---AGDVSK
1k2wA           ------------------------------------------------------------------DVTD
1i01A           ---------------------------------------------------------GANGKGLMLNVTD
3gafF           ---------------------------------------------------------GKAIG-LECNVTD
1i01F           ---------------------------------------------------------GANGKGLMLNVTD
1yxmB           ----LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLTKQARVIPIQCNIRN
2ntnB           ------------------------------------------------------------LFGVEVDVTD
2hq1A           ----LKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPASSLDATAEEFKAA---GINVVVAKGDVKN
3gafG           ---------------------------------------------------------GKAIG-LECNVTD
3gafC           ---------------------------------------------------------GKAIG-LECNVTD
1i01C           ----------------------------------------------------------------------
3gafB           ---------------------------------------------------------GKAIG-LECNVTD
3f9iA           ----------------------------------------------------------------------
1uzmB           ------------------------------------------------------------LFGVEVDVTD
2pd6D           ----------------------------------------------------------------------
2pd6C           ----------------------------------------------------------------------
2pd6B           ----------------------------------------------------------------------
1i01G           ---------------------------------------------------------GANGKGLMLNVTD
1fmcA           --------------------------------------------DAANHVVDEIQQLGGQAFACRCDITS
1ahhA           --------------------------------------------DAANHVVDEIQQLGGQAFACRCDITS
2z1nB           MDLGIQGKLAVVTAGSSGLGFASALELARNGARLLLFSRNREKLEAAASRIAS-LVSGAQVDIVAGDIRE
1o5iA           ----------------------------------------------------------------------
3ennB           ---------------------------------------------------------GERIFVFPANLSD
1i01H           ---------------------------------------------------------GANGKGLMLNVTD
3gafH           ---------------------------------------------------------GKAIG-LECNVTD
3gafE           ---------------------------------------------------------GKAIG-LECNVTD
3emkA           ---------------------------------------------------------GERIFVFPANLSD
1nfrA           ---------------------------------------------------------------VHLDVTQ
3ennD           ---------------------------------------------------------GERIFVFPANLSD
3ennC           ---------------------------------------------------------GERIFVFPANLSD
2a4kA           ----------------------------------------------------------------------
1i01D           ---------------------------------------------------------GANGKGLMLNVTD
3emkD           ---------------------------------------------------------GERIFVFPANLSD
3ennA           ---------------------------------------------------------GERIFVFPANLSD
3f9iB           ----------------------------------------------------------------------
1zjyA           ------------------------------------------------------------------DSSD
1nxqA           ------------------------------------------------------------------DSSD
1yxmC           ----LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLKQARVI-PIQCNIRN
3emkB           ---------------------------------------------------------GERIFVFPANLSD
1ulsB           ------------------------------------------------------------------DVAD
1ulsA           ------------------------------------------------------------------DVAD
3cxtA           ---SLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGIN--AHGYV-CDVTD
2z1nA           MDLGIQGKLAVVTAGSSGLGFASALELARNGARLLLFSRNREKLEAAASRIAS-LVSGAQVDIVAGDIRE
3emkC           ---------------------------------------------------------GERIFVFPANLSD
2pd6A           ----------------------------------------------------------------------
2japC           ------------------------------------LGDELTAAGAKVHVLE-------------LDVAD
2japA           ------------------------------------LGDELTAAGAKVHVLE-------------LDVAD
3grpA           ----------------------------------------------------------------SANLSD
3cxrA           ---SLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGIN--AHGYV-CDVTD
1ulsC           ------------------------------------------------------------------DVAD
1ja9A           -------------------------------------GSSSKAAEEVVAELKKLGAQGVA---IQADISK
3i4fA           -------RHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKETYKDVEE--RLQFVQADVTK
3i4fD           ---------------------------------------------------------------VQADVTK
2b4qA           ---SLAGRIALVTGGSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAY----GDCQAIPADLSS
3grpB           ----------------------------------------------------------------SANLSD
2ewmA           ---------------------------------------------------------GRRVLTVKCDVSQ
1ae1B           ----------------------------------------------------------------------
3i4fC           ---------------------------------------------------------------VQADVTK
2ewmB           ---------------------------------------------------------GRRVLTVKCDVSQ
2bgkA           ---------------------------------------------------------------VHCDVTK
2gdzA           ---------------------------------------------------------------IQCDVAD
2ae2A           ----------------------------------------------------------------------
1xkqB           --------------------------------NVTITGRSSERLEETRQIILKSGVSEKQVNSVVADVTT
1xkqA           --------------------------------NVTITGRSSERLEETRQIILKSGVSEKQVNSVVADVTT
3grpC           ----------------------------------------------------------------SANLSD
2ew8B           ---------------------------------------------------------GRRVLTVKCDVSQ
2ew8A           ---------------------------------------------------------GRRVLTVKCDVSQ
1cydA           -------------------------------------GAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGD
3imfB           ----------------------------------------------------------------------
2et6A           ----------------------------------------------------------------------
1w6uA           --NSFQGKVAFIXXXXXXXXXXXXXXXXXXXAQCVIASRKMDVLKATAEQISSQT--GNKVHAIQCDVRD
1xhlA           ---------------------------------VTITGRNEDRLEETKQQILKAGVPAEKINAVVADVTE
1w6uC           --NSFQGKVAFIXXXXXXXXXXXXXXXXXXXAQCVIASRKMDVLKATAEQISSQT--GNKVHAIQCDVRD
1yb1A           --------------------------------------------DINKHGLEETAAKCKGLGAVHTFVVD
1w6uB           --NSFQGKVAFIXXXXXXXXXXXXXXXXXXXAQCVIASRKMDVLKATAEQISSQT--GNKVHAIQCDVRD
3grpD           ----------------------------------------------------------------SANLSD
3iccA           --NSLKGKVALVTGASRGIGRAIAKRLANDGALVAIYGNRKEEAEETVYEIQSNGGSAFSIGANLESLHG
2ae1A           ----------------------------------------------------------------------
2ehdA           ---------------------------------------------------------------------E
2b4qB           ---SLAGRIALVTGGSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAY----GDCQAIPADLSS
1ae1A           ----------------------------------------------------------------------
1yb1B           --------------------------------------------DINKHGLEETAAKCKGLGAVHTFVVD
3i3oF           --------------------------------------------------------EGVKCVLLPGDLSD
3i3oE           --------------------------------------------------------EGVKCVLLPGDLSD
3i3oC           --------------------------------------------------------EGVKCVLLPGDLSD
3i3oB           --------------------------------------------------------EGVKCVLLPGDLSD
3i3oA           --------------------------------------------------------EGVKCVLLPGDLSD
2ag5C           ----------------------------------------------------------------------
2ag5B           ----------------------------------------------------------------------
2ag5A           ----------------------------------------------------------------------
3imfA           ----------------------------------------------------------------------
2jahC           ------------------------------------LGDELTAAGAKVHVLE-------------LDVAD
2jahA           ------------------------------------LGDELTAAGAKVHVLE-------------LDVAD
1w6uD           --NSFQGKVAFIXXXXXXXXXXXXXXXXXXXAQCVIASRKMDVLKATAEQISSQT--GNKVHAIQCDVRD
2zatA           ----LENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQG---EGLSVTGTVCHVGK
2ehdB           ---------------------------------------------------------------------E
1vl8B           ----LRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRN---LEEASEAAQKLTEKGVETMAFRCDVSN
1vl8A           ----LRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRN---LEEASEAAQKLTEKGVETMAFRCDVSN
1g6kA           --------------------------------------------------------------AVKGDVTV
1rwbA           --------------------------------------------------------------AVKGDVTV
3i3oH           --------------------------------------------------------EGVKCVLLPGDLSD
3edmB           ---------------------------------------------------------GRSALAIKADLTN
3edmA           ---------------------------------------------------------GRSALAIKADLTN
1geeA           --------------------------------------------------------------AVKGDVTV
1gcoA           --------------------------------------------------------------AVKGDVTV
3imfC           ----------------------------------------------------------------------
1zbqA           ----------------------------------------------------------------------
1uayA           ----------------------------------------------------------------------
3edmD           ---------------------------------------------------------GRSALAIKADLTN
3edmC           ---------------------------------------------------------GRSALAIKADLTN
2c7vB           --------------------------------------------------------ERSNTAVVQADLTN
2c7vA           --------------------------------------------------------ERSNTAVVQADLTN
3ijrH           --------------------------------------------------------EGVKCVLLPGDLSD
3ijrF           --------------------------------------------------------EGVKCVLLPGDLSD
3ijrE           --------------------------------------------------------EGVKCVLLPGDLSD
3ijrB           --------------------------------------------------------EGVKCVLLPGDLSD
3ijrA           --------------------------------------------------------EGVKCVLLPGDLSD
2wd7C           --------------------------------------------------------ERSNTAVVQADLTN
1uayB           ----------------------------------------------------------------------
3bmnD           ----------------------------------------------------------------------
3bmeB           --------------------------------------------------------ERSNTAVVQADLTN
3bmiB           ----------------------------------------------------------------------
2c7vD           --------------------------------------------------------ERSNTAVVQADLTN
3bmqA           ----------------------------------------------------------------------
3bmnC           ----------------------------------------------------------------------
3bmeA           --------------------------------------------------------ERSNTAVVQADLTN
2wd7B           --------------------------------------------------------ERSNTAVVQADLTN
3bmoC           ----------------------------------------------------------------------
3bmjD           ----------------------------------------------------------------------
2vz0A           ----------------------------------------------------------------------
3i3oG           --------------------------------------------------------EGVKCVLLPGDLSD
3bmoD           ----------------------------------------------------------------------
3bmnA           ----------------------------------------------------------------------
3bmkC           ----------------------------------------------------------------------
1pr9A           ----LAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVR-------ECPGIEPVCVDLGD
3bmnB           ----------------------------------------------------------------------
3bmqC           ----------------------------------------------------------------------
3bmfD           ----------------------------------------------------------------------
3bmfA           ----------------------------------------------------------------------
2vz0B           ----------------------------------------------------------------------
3g1tA           ----------------------------------------------------------------------
1spxA           ---------------------------------VTITGRHAERLEETRQQILAAGVSEQNVNSVVADVTT
3bmoB           ----------------------------------------------------------------------
3bmoA           ----------------------------------------------------------------------
3bmfB           ----------------------------------------------------------------------
3bmdB           ----------------------------------------------------------------------
2c7vC           --------------------------------------------------------ERSNTAVVQADLTN
3d3wA           ----LAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVR-------ECPGIEPVCVDLGD
3bmeC           --------------------------------------------------------ERSNTAVVQADLTN
3bmfC           ----------------------------------------------------------------------
1ybvA           ---------------------------------------------------------GSDAACVKANVGV
1g0oC           ---------------------------------------------------------GSDAACVKANVGV
1g0oA           ---------------------------------------------------------GSDAACVKANVGV
3e03C           ---------------------------------------------------------------LKCDIRE
3e03B           ---------------------------------------------------------------LKCDIRE
1dohB           ---------------------------------------------------------GSDAACVKANVGV
1dohA           ---------------------------------------------------------GSDAACVKANVGV
2bd0A           -----------------------------------------------------CRAEGALTDTITADISD
1u7tA           -----------------------------------------------------------------ADVTS
1p33D           ----------------------------------------------------------------------
2o23B           -----------------------------------------------------------------ADVTS
1fdvB           -----------------------------------------------------------SLETLQLDVRD
1xg5C           ------------------------------------------------------------------DLSN
2o23A           -----------------------------------------------------------------ADVTS
1xu9B           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1xu9A           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1xu7D           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1xu7B           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1xu7A           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1so8A           -----------------------------------------------------------------ADVTS
2rbeD           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2rbeC           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2rbeB           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2rbeA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2irwC           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2irwA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1iolA           -----------------------------------------------------------SLETLQLDVRD
2iltA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3hfgA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3gz4B           ----------------------------------------------------------------------
3gz4A           ----------------------------------------------------------------------
3ey4C           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3ey4A           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3e03A           ---------------------------------------------------------------LKCDIRE
3d5qB           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3d4nB           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3ch6E           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3ch6D           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3ch6B           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3ch6A           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3bzuB           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3bzuA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3byzA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2belD           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2belB           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2belA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2yw9B           -----------------------------------------------------------------ADVTQ
1qyxA           -----------------------------------------------------------SLETLQLDVRD
1qyvA           -----------------------------------------------------------SLETLQLDVRD
1fduD           -----------------------------------------------------------SLETLQLDVRD
1fduA           -----------------------------------------------------------SLETLQLDVRD
1p33C           ----------------------------------------------------------------------
1p33B           ----------------------------------------------------------------------
1jtvA           -----------------------------------------------------------SLETLQLDVRD
1fdwA           -----------------------------------------------------------SLETLQLDVRD
1fduC           -----------------------------------------------------------SLETLQLDVRD
1fduB           -----------------------------------------------------------SLETLQLDVRD
1fdsA           -----------------------------------------------------------SLETLQLDVRD
3deyX           -----------------------------------------------------------SLETLQLDVRD
3bzuD           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARE---------TLQKVVSHCLELGAASAHMED
1bhsA           -----------------------------------------------------------SLETLQLDVRD
1a27A           -----------------------------------------------------------SLETLQLDVRD
1p33A           ----------------------------------------------------------------------
1e6wC           -----------------------------------------------------------------ANVTS
1ydeP           ---------------------------------------------------------------ILCDVTQ
1ydeM           ---------------------------------------------------------------ILCDVTQ
1ydeI           ---------------------------------------------------------------ILCDVTQ
1ydeH           ---------------------------------------------------------------ILCDVTQ
1ydeG           ---------------------------------------------------------------ILCDVTQ
1ydeF           ---------------------------------------------------------------ILCDVTQ
1ydeD           ---------------------------------------------------------------ILCDVTQ
1ydeA           ---------------------------------------------------------------ILCDVTQ
3f5qB           ----------------------------------------------------------------------
3f5qA           ----------------------------------------------------------------------
3f1lB           ----------------------------------------------------------------------
3f1lA           ----------------------------------------------------------------------
3d3eB           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3d3eA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1w73A           -----------------------------------VIASRKDVLKATAEQISSQT--GNKVHAIQCDVRD
3gy0A           ----------------------------------------------------------------------
3f5sB           ----------------------------------------------------------------------
3f5sA           ----------------------------------------------------------------------
1w0cC           ----------------------------------------------TVQADLSNVATAPVSGAGSAPVTL
3hfgB           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3d4nD           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1xq1A           ----------------------------------------------------------------------
1w73C           -----------------------------------VIASRKDVLKATAEQISSQT--GNKVHAIQCDVRD
3d4nC           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3czrA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1h5qA           ---------------------------------------------------------GVKTKAYQCDVSN
1gz6A           ----------------------------------------------------------------------
3gegA           ----------------------------------------------------------------------
1e6wA           -----------------------------------------------------------------ANVTS
1e3wA           -----------------------------------------------------------------ANVTS
2dknA           ----------------------------------------------------------------------
1xu9C           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3hfgC           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1g0nB           ---------------------------------------------------------GSDAACVKANVGV
1e6wD           -----------------------------------------------------------------ANVTS
1e6wB           -----------------------------------------------------------------ANVTS
1uluB           -----------------------------------------------------------------ADVTQ
3d4nA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2yw9A           -----------------------------------------------------------------ADVTQ
1xg5A           ------------------------------------------------------------------DLSN
1e3sA           -----------------------------------------------------------------ANVTS
2bf7B           ---------------------------------------EANALSATLNARRSAITVQADLSNVSAPVTL
3hfgD           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3gedB           ----------------------------------------------------------------------
3gedA           ----------------------------------------------------------------------
3frjA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1e92B           ---------------------------------------EANALSATLNARRSAITVQADLSNVSAPVTL
1e7wA           ---------------------------------------EANALSATLNAVQADLSNVATAPVSSAPVTL
3d5qA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3bzuC           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2bfmC           ---------------------------------------EANALSATLNARRSAITVQADLSATAAPVTL
2yw9D           -----------------------------------------------------------------ADVTQ
1xu9D           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2qhxA           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
3d5qD           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
3d5qC           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
2bf7C           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
2belC           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
1xg5B           ------------------------------------------------------------------DLSN
1w0cA           ----------------------------------------------------------------------
2a4kB           ----------------------------------------------------------------------
2yw9H           -----------------------------------------------------------------ADVTQ
1ydeN           ---------------------------------------------------------------ILCDVTQ
1ydeB           ---------------------------------------------------------------ILCDVTQ
1e92D           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
2bfpB           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
2bfaA           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
2bf7A           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
1bdbA           -------------------------------------GAKVAVLDKSAERLAELETDGDNVLGIVGDVRS
1w0cF           ---------------------------------------EANALSATLNARRSAITVQADLSNVSAPVTL
1gz6C           ----------------------------------------------------------------------
1e92C           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
3dijA           ----------------------------------------------------------------------
2bfpD           ----------------------------------------------------------------------
2bfmB           ----------------------------------------------------------------------
2bfaB           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
1w73D           -----------------------------------VIASRKDVLKATAEQISSQT--GNKVHAIQCDVRD
1w0cE           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
1w0cB           ----------------------------------------------------------------------
2p8kB           ----------------------------------------------------------------------
3ctmA           --------------------------------------------------------------AYKCNISD
2bfoA           ----------------------------------------------------------------------
2yw9C           -----------------------------------------------------------------ADVTQ
1w0cH           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
2p8kG           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
2p8kD           ----------------------------------------------------------------------
2p8kA           ----------------------------------------------------------------------
1gz6B           ----------------------------------------------------------------------
1e92A           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
2yw9E           -----------------------------------------------------------------ADVTQ
1w0cG           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
2qhxC           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
1e7wB           ---------------------------------------EANALSATLNARRAITVQADLSNVATAPVTL
2bfoC           ---------------------------------------EANALSATLNARRAITVQADLSNVATAPVTL
1uluA           -----------------------------------------------------------------ADVTQ
2p8kC           ---------------------------------------EANALSATLNARRSAITVQADLSNVSAPVTL
3diiA           ----------------------------------------------------------------------
2yw9F           -----------------------------------------------------------------ADVTQ
1w73B           -----------------------------------VIASRKDVLKATAEQISSQT--GNKVHAIQCDVRD
2qhxD           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
1uluC           -----------------------------------------------------------------ADVTQ
1y5mA           ----LQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVV---SRCLELGAASAHIAGTMED
1uluD           -----------------------------------------------------------------ADVTQ
2p8kH           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
3ctmE           --------------------------------------------------------------AYKCNISD
2bfaC           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
2bf7D           ----------------------------------------------------------------------
3ctmG           --------------------------------------------------------------AYKCNISD
2bfaD           ---------------------------------------EANALSATLNARRSAITVQADLSNVAAPVTL
3ctmC           --------------------------------------------------------------AYKCNISD
1hxhA           --------------------------------------------------------------------SE
2fwmX           ----------------------------------------------------------------------
1pwxA           ----------------------------------------------------------------------
1zmoA           ----------------------------------------------------------------------
1mxfA           ----------------------------------------------------------------------
1a4uA           ----------------------------------------------------------------------
2qq5A           ----------------------------------------------------------------------
2dknB           ----------------------------------------------------------------------
1mxhA           ----------------------------------------------------------------------
3ctmF           --------------------------------------------------------------AYKCNISD
3ctmD           --------------------------------------------------------------AYKCNISD
3ctmB           --------------------------------------------------------------AYKCNISD
1fk8A           ----------------------------------------------------------------------
1mg5A           ----------------------------------------------------------------------
3ctmH           --------------------------------------------------------------AYKCNISD
3guyH           ----------------------------------------------------------------------
3guyG           ----------------------------------------------------------------------
3guyD           ----------------------------------------------------------------------
3guyC           ----------------------------------------------------------------------
3guyB           -----------------------------------LTGRSESKLSTVTNCLSNNV------GYRARDLAS
2p91A           ----------------------------------------------------------------------
3guyA           ----------------------------------------------------------------------
1z6zE           ----------------------------------------------------------------------
1z6zD           ----------------------------------------------------------------------
1z6zB           ----------------------------------------------------------------------
1z6zA           ----------------------------------------------------------------------
1qsgG           ----------------------------------------------------------------------
1qsgA           ----------------------------------------------------------------------
1qg6A           ----------------------------------------------------------------------
1c14A           ----------------------------------------------------------------------
3e9nA           ----------------------------------------------------------------------
2fhsB           ----------------------------------------------------------------------
1lxcA           ----------------------------------------------------------------------
2p91B           ----------------------------------------------------------------------
1i30A           ----------------------------------------------------------------------
1dfiA           ----------------------------------------------------------------------
2jjyB           ----------------------------------------------------------------------
1enoA           ----------------------------------------------------------------------
3e9nD           ----------------------------------------------------------------------
1d7oA           ----------------------------------------------------------------------
1cwuA           ----------------------------------------------------------------------
2qioA           ----------------------------------------------------------------------
1n5dA           ---------------------------------VVLTARDVARGQAAVKQLQA---EGLSPRFHQLDIID
2jjyA           ----------------------------------------------------------------------
3e9nC           ----------------------------------------------------------------------
3f1kA           ----------------------------------------------------------------------
3ek2B           ----------------------------------------------------------------------
3ek2C           ----------------------------------------------------------------------
3e9qB           ----------------------------------------------------------------------
3e9qA           ----------------------------------------------------------------------
3e9nH           ----------------------------------------------------------------------
3e9nF           ----------------------------------------------------------------------
3e9nE           ----------------------------------------------------------------------
2jjyC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ADWVSGAFAGATEARGPITLLVNNAGQAYSAPFGKTDLALWQRMLEVNLTGTFICTQAALPAMLEAGWGR
1x7hB           VPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
1x7gA           VPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
1w4zA           VPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
2rhrA           VPEIEALVAAVVERYGPVDVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
2rh4B           VPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
2rh4A           VPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
1xr3B           VPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
2yz7A           AQATRDFIAKAAEALGGLDILVNNAGIQHTAPIEEFPVDKWNAIIALNLSAVFHGTAAALPIMQKQGWGR
1w4zB           VPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
2rhrB           VPEIEALVAAVVERYGPVDVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
3csdB           VPEIEALVAAVVERYGPVDVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
1x7gB           VPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
2ztlA           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
2q2vA           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2ztmA           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
2q2wA           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2q2qB           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2q2wC           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2q2qA           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2q2vD           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2q2qE           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2q2vB           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2q2wD           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2q2vC           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2q2qG           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2q2qC           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2ztvC           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
2ztvD           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
2q2qF           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2ztmC           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
2q2qH           VAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGR
2ztvB           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
2ztmD           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
2ztuC           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
2p68A           EESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGR
2ztuD           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
3ezlA           WDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGR
2ztmB           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
1uznA           SDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGR
2ztuB           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
1x1tA           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
2ztuA           GEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGR
2uvdA           AEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGR
2ph3A           ----------AAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGR
2zk7B           PDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPS
2dteA           PDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPS
2p68B           EESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGR
2d1yC           ----------AAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGA
1iy8A           EAQVEAYVTATTERFGRIDGFFNNAGEGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGM
1gegE           RDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGK
1gegA           RDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGK
1q7bB           PASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGR
1q7bA           PASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGR
1uznB           SDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGR
1q7cA           PASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGR
3ftpA           ATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGR
2d1yD           ----------AAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGA
2d1yB           ----------AAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGA
2d1yA           ----------AAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGA
1uzlB           SDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGR
2cfcA           EGDVNAAIAATMEQFGAIDVLVNNAGITGNSEAGTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGV
1uzlA           SDAVDRAFTAVEEHQGPVEVLVSNAGLSADMTEEK-----FEKVINANLTGAFRVAQRASRSMQRNKFGR
3ftpC           ATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGR
3gk3D           FESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGR
3gk3B           FESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGR
2zk7A           PDQVKASIDHIFKEYGSISVLVNNAS-----------MGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPS
1uzmA           SDAVDRAFTAVEEHQGPVEVLVSNAGLSARMTEEK-----FEKVINANLTGAFRVAQRASRSMQRNKFGR
3ftpD           ATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGR
2ntnA           SDAVDRAFTAVEEHQGPVEVLVSNAGLMTEEKF--------EKVINANLTGAFRVAQRASRSMQRNKFGR
1hdcA           EDW-QRVVAYAREEFGSVDGLVNNAGISTGMFLETESVERFRKVVEINLTGVFIGMKTVIPAMKDAGGGS
3gvcC           EQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGA
3gvcB           EQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGA
1x1eA           ----------------------------------------WRRVLYLHLDVAFLLAQAAAPHMAEAGWGR
3gk3A           FESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGR
2ekpA           ----------------------------------------WRRVLYLHLDVAFLLAQAAAPHMAEAGWGR
3gk3C           FESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGR
1i01E           PASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGR
2nm0A           TEQVEQAYKEIEETHGPVEVLIANAGVTKDQLMSEEDFT---SVVETNLTGTFRVVKRANRAMLRAKKGR
3gvcA           EQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGA
2ph3B           ----------AAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGR
2ekqD           ----------------------------------------WRRVLYLHLDVAFLLAQAAAPHMAEAGWGR
3gvcD           EQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGA
1yxmD           EEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGS
1edoA           EADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXX
1yxmA           EEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGS
1nffA           PAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGS
1i01B           PASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGR
3gafA           EQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMP-MSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGA
1zemA           EEAVIGTVDSVVRDFGKIDFLFNNAGQGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGR
3gafD           EQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMP-MSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGA
2c07A           KEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGR
1k2wA           QASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGGGK
1i01A           PASIESVLEKIRAEFGEVDILVNNANLLMRMKDEE-----WNDIIETNLSSVFRLSKAVMRAMMKKRHGR
3gafF           EQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMP-MSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGA
1i01F           PASIESVLEKIRAEFGEVDILVNNAGNLLMRMKDEE----WNDIIETNLSSVFRLSKAVMRAMMKKRHGR
1yxmB           EEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGS
2ntnB           SDAVDRAFTAVEEHQGPVEVLVSNAGLMTEEKF--------EKVINANLTGAFRVAQRASRSMQRNKFGR
2hq1A           PEDVENMVKTAMDAFGRIDILVNNA---------------WDDVLNTNLKSAYLCTKAVSKIMLKQKSGK
3gafG           EQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMP-MSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGA
3gafC           EQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMP-MSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGA
1i01C           ----------------------------------------WNDIIETNLSSVFRLSKAVMRAMMKKRHGR
3gafB           EQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMP-MSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGA
3f9iA           ----------------------------------------FDKVIDINLKANFILNREAIKKMIQKRYGR
1uzmB           SDAVDRAFTAVEEHQGPVEVLVSNAGLSAMTE------EKFEKVINANLTGAFRVAQRASRSMQRNKFGR
2pd6D           ----------------------------------------WDKVIAVNLKGTFLVTQAAAQALVSNGCGS
2pd6C           ----------------------------------------WDKVIAVNLKGTFLVTQAAAQALVSNGCGS
2pd6B           ----------------------------------------WDKVIAVNLKGTFLVTQAAAQALVSNGCGS
1i01G           PASIESVLEKIRAEFGEVDILVNNADNLLMRMKDEE----WNDIIETNLSSVFRLSKAVMRAMMKKRHGR
1fmcA           EQELSALADFAISKLGKVDILVNNAGGGGPKPFDMP-MADFRRAYELNVFSFFHLSQLVAPEMEKNGGGV
1ahhA           EQELSALADFAISKLGKVDILVNNAGGGGPKPFDMP-MADFRRAYELNVFSFFHLSQLVAPEMEKNGGGV
2z1nB           PGDIDRLFEKARDLGGA-DILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGR
1o5iA           -----------------VDILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGR
3ennB           REAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXX
1i01H           PASIESVLEKIRAEFGEVDILVNNADNLLMRMKDEE----WNDIIETNLSSVFRLSKAVMRAMMKKRHGR
3gafH           EQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMP-MSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGA
3gafE           EQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMP-MSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGA
3emkA           REAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXX
1nfrA           PAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPK-EAGRGS
3ennD           REAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXX
3ennC           REAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXX
2a4kA           ------------------------AGVAHSA----LPLEAWEKVLRVNLTGSFLVARKA-GEVLEEG-GS
1i01D           PASIESVLEKIRAEFGEVDILVNNDNLLMRMKDEE-----WNDIIETNLSSVFRLSKAVMRAMMKKRHGR
3emkD           REAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXX
3ennA           REAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXX
3f9iB           ----------------------------------------FDKVIDINLKANFILNREAIKKMIQKRYGR
1zjyA           EDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGS
1nxqA           EDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGS
1yxmC           EEEVNNLVKSTLDTFGKINFLVNNG---------------WHAVLETNLTGTFYMCKAVYSSWMKEHGGS
3emkB           REAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXX
1ulsB           PASVERGFAEALAHLGRLDGVVHYAGITRDN-FHWKPLEDWELVLRVNLTGSFLVAKAASEAR-EKNPGS
1ulsA           PASVERGFAEALAHLGRLDGVVHYAGITRDN-FHWKPLEDWELVLRVNLTGSFLVAKAASEAR-EKNPGS
3cxtA           EDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGK
2z1nA           PGDIDRLFEKARDLGGA-DILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGR
3emkC           REAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXX
2pd6A           ----------------------------------------WDKVIAVNLKGTFLVTQAAAQALVSNGCGS
2japC           RQGVDAAVASTVEALGGLDILVNNAGIMLLGPVEDADTTDWTRMIDTNLLGLMYMTRAALPHLLRSK-GT
2japA           RQGVDAAVASTVEALGGLDILVNNAGIMLLGPVEDADTTDWTRMIDTNLLGLMYMTRAALPHLLRSK-GT
3grpA           RKSIKQLAEVAEREMEGIDILVNNAG--ITVRMQDQD---WDDVLAVNLTAASTLTRELIHSMMRRRYGR
3cxrA           EDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGK
1ulsC           PASVERGFAEALAHLGRLDGVVHYAGITRDN-FHWKPLEDWELVLRVNLTGSFLVAKAASEAR-EKNPGS
1ja9A           PSEVVALFDKAVSHFGGLDFVMSNSGMEVWCDELEVTQELFDKVFNLNTRGQFFVAQQGLKHCRRGG--R
3i4fA           KEDLHKIVEEAMSHFGKIDFLINNAGPYVFERKKLVDYEEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGR
3i4fD           KEDLHKIVEEAMSHFGKIDFLINNAGPYVFERKKLVDYEEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGR
2b4qA           EAGARRLAQALGELSARLDILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASAR
3grpB           RKSIKQLAEVAEREMEGIDILVNNAGVRMQDQD-------WDDVLAVNLTAASTLTRELIHSMMRRRYGR
2ewmA           PGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGR
1ae1B           ---------------GKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGN
3i4fC           KEDLHKIVEEAMSHFGKIDFLINNAGPYVFERKKLVDYEEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGR
2ewmB           PGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGR
2bgkA           DEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNFKRVMDINVYGAFLVAKHAARVMIPAKKGS
2gdzA           QQQLRDTFRKVVDHFGRLDILVNNAGV--------NNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGE
2ae2A           ----------ANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGN
1xkqB           EDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGIDIYHKTLKLNLQAVIEMTKKVKPHLV-ASKGE
1xkqA           EDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGIDIYHKTLKLNLQAVIEMTKKVKPHLV-ASKGE
3grpC           RKSIKQLAEVAEREMEGIDILVNNQDQD------------WDDVLAVNLTAASTLTRELIHSMMRRRYGR
2ew8B           PGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGR
2ew8A           PGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGR
1cydA           WDATEKALGGI----GPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVGS
3imfB           ------------EKFGRIDILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYWIEKGKGN
2et6A           ---------------GTIDILVNNAGILRDRSFAKMSKQEWDSVQQVHLIGTFNLSRLAWPYFVEKQFGR
1w6uA           PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGA
1xhlA           ASGQDDIINTTLAKFGKIDILVNNAGANLADGTANTDVELYQKTFKLNFQAVIEMTQKTKEHLIKTK-GE
1w6uC           PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGA
1yb1A           CSNREDIYSSAKKVKGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGH
1w6uB           PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGA
3grpD           RKSIKQLAEVAEREMEGIDILVNNAGIDQD----------WDDVLAVNLTAASTLTRELIHSMMRRRYGR
3iccA           VEALYSSLDNELQNRTGSTILINNAGIGPGAFIEETTEQFFDRV-SVNAKAPFFIIQQALSRLRDNS--R
2ae1A           ----------ANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGN
2ehdA           GDWAR-AVAAMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGT
2b4qB           EAGARRLAQALGELSARLDILVNNAGTS--------PVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASAR
1ae1A           ---------------GKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGN
1yb1B           CSNREDIYSSAKKVKGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGH
3i3oF           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
3i3oE           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
3i3oC           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
3i3oB           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
3i3oA           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
2ag5C           -----------------LDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGN
2ag5B           -----------------LDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGN
2ag5A           -----------------LDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGN
3imfA           ------------EKFGRIDILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYWIEKGKGN
2jahC           RQGVDAAVASTVEALGGLDILVNNAG-ILLGPVEDADTTDWTR-IDTNLLGLY--TRAALPHLLRSK-GT
2jahA           RQGVDAAVASTVEALGGLDILVNNAG-ILLGPVEDADTTDWTR-IDTNLLGLY--TRAALPHLLRSK-GT
1w6uD           PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGA
2zatA           AEDRERLVAMAVNLHGGVDILVSNA--AVNPFFGNIIDAVWDKILHVNVKATVLMTKAVVPEMEKRXXXX
2ehdB           GDWAR-AVAAMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGT
1vl8B           YXXXXXXXXXXXXXFGKLDTVVNAAGINRRHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDNPS
1vl8A           YXXXXXXXXXXXXXFGKLDTVVNAAGINRRHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDNPS
1g6kA           ESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGT
1rwbA           ESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGT
3i3oH           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
3edmB           XXXXXXXXXXXXDKFGEIHGLVHVAGGLIARKIAEMDEAFWHQVLDVNLTSLFLTAKTALPKM--AKGGA
3edmA           XXXXXXXXXXXXDKFGEIHGLVHVAGGLIARKIAEMDEAFWHQVLDVNLTSLFLTAKTALPKM--AKGGA
1geeA           ESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGT
1gcoA           ESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGT
3imfC           ------------EKFGRIDILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYWIEKGIGN
1zbqA           ----------ALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGR
1uayA           ----------------PLFAVVSAAGVGLAEKIGPHGLESFRRVLEVNLLGTFNVLRLAAWAMAEGQRGV
3edmD           XXXXXXXXXXXXDKFGEIHGLVHVAGGLIARKIAEMDEAFWHQVLDVNLTSLFLTAKTALPKM--AKGGA
3edmC           XXXXXXXXXXXXDKFGEIHGLVHVAGGLIARKIAEMDEAFWHQVLDVNLTSLFLTAKTALPKM--AKGGA
2c7vB           SNVLPASINSCFRAFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKTSSNLS
2c7vA           SNVLPASINSCFRAFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLS
3ijrH           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
3ijrF           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
3ijrE           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
3ijrB           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
3ijrA           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
2wd7C           SNVLPASINSCFRAFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLS---
1uayB           ----------------PLFAVVSAAGVGLAEKIGPHGLESFRRVLEVNLLGTFNVLRLAAWAMAEGQRGV
3bmnD           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLS
3bmeB           SNVLPASINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----
3bmiB           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSF--AQRQSSNLS
2c7vD           SNVLPASINSCFRAFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLS
3bmqA           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLS
3bmnC           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLS-
3bmeA           SNVLPASINSCFRAFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLS---
2wd7B           SNVLPASINSCFRAFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----
3bmoC           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLS-
3bmjD           -------------AFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLS---
2vz0A           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLS---
3i3oG           EQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAQLEKTFRINIFSYFHVTKAALSHLKQGDV--
3bmoD           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSNLS-
3bmnA           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSF--AQRQSSNLS
3bmkC           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKNLS---
1pr9A           WEATERALGSV----GPVDXXXXXXXXXXXQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVGA
3bmnB           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSF--AQRQKSNLS
3bmqC           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLS---
3bmfD           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLS---
3bmfA           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLS---
2vz0B           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----
3g1tA           --------------------VLHNAGLLGEGPMSEQDPQIWQDVMQVNVNATFMLTQALLPLLLKSDAGS
1spxA           DAGQDEILSTTLGKFGKLDILVNNAGQSIES---------YDATLNLNLRSVIALTKKAVPH-LSSTKGE
3bmoB           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----
3bmoA           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSF--AQRQKGTTS
3bmfB           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----
3bmdB           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----
2c7vC           SNVLPASINSCFRAFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSF--AQRQKGTNS
3d3wA           WEATERALGSV----GPVDXXXXXXXXXXXQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVGA
3bmeC           SNVLPASINSCFRAFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----
3bmfC           -------------AFGRCDVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----
1ybvA           VEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKH-LEIG-GR
1g0oC           VEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKH-LEIG-GR
1g0oA           VEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKH-LEIG-GR
3e03C           EDQVRAAVAATVDTFGGIDILVNNASAIWLR--GTLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPH
3e03B           EDQVRAAVAATVDTFGGIDILVNNASAIWLR--GTLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPH
1dohB           VEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKH-LEIG-GR
1dohA           VEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKH-LEIG-GR
2bd0A           MADVRRLTTHIVERYGHIDCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGH
1u7tA           EKDVQTALALAKGKFGRVDVAVNCAGIAYNLKKGQTHLEDFQRVLDVNLMGTFNVIRLVAGEMGQGQRGV
1p33D           ---------------GRCDVLVNNASSFYPTPLLRKD----KESLEVAAADLFGSNAIAPYFLIKAFAQR
2o23B           EKDVQTALALAKGKFGRVDVAVNCAGIAYNLKKGQTHLEDFQRVLDVNLMGTFNVIRLVAGEMGQGQRGV
1fdvB           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1xg5C           EEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGH
2o23A           EKDVQTALALAKGKFGRVDVAVNCAGIAYNLKKGQTHLEDFQRVLDVNLMGTFNVIRLVAGEMGQGQRGV
1xu9B           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1xu9A           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1xu7D           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1xu7B           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1xu7A           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1so8A           EKDVQTALALAKGKFGRVDVAVNCAG-------------IFQRVLDVNLMGTFNVIRLVAGEMGQGQRGV
2rbeD           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2rbeC           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2rbeB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2rbeA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2irwC           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2irwA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1iolA           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLEVNVVGTVRMLQAFLPDMKRRGSGR
2iltA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3hfgA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3gz4B           --------------------VLHNAGLLGDVPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGS
3gz4A           --------------------VLHNAGLLGDVPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGS
3ey4C           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3ey4A           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3e03A           EDQVRAAVAATVDTFGGIDILVNNASAIWLR--GTLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPH
3d5qB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3d4nB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3ch6E           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3ch6D           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3ch6B           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3ch6A           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3bzuB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3bzuA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3byzA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2belD           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2belB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2belA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2yw9B           DEELDALFAGVKEAFGGLDYLVHAIAEAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLREGGG--
1qyxA           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1qyvA           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1fduD           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1fduA           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1p33C           ---------------GRCDVLVNNASSFYPTP-----LLRKKESLEVAAADLFGSNAIAPYFLIKAFAQR
1p33B           ---------------GRCDVLVNNASSFYPTP-----LLRKKESLEVAAADLFGSNAIAPYFLIKAFAQR
1jtvA           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1fdwA           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1fduC           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1fduB           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1fdsA           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
3deyX           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
3bzuD           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1bhsA           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1a27A           SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1p33A           ---------------GRCDVLVNNASSFYPTPLLRD-----KESLEVAAADLFGSNAIAPYFLIKAFAQR
1e6wC           EKEVQAALTLAKEKFGRIDVAVNCAGIAVAI---KTTLEDFQRVINVNLIGTFNVIRLVAGVMGQGQRGV
1ydeP           EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
1ydeM           EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
1ydeI           EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
1ydeH           EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
1ydeG           EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
1ydeF           EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
1ydeD           EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
1ydeA           EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
3f5qB           --------------------VLHNAGLLGDVPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGS
3f5qA           --------------------VLHNAGLLGDVPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGS
3f1lB           --------------------VLHNAGLLGDVPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGS
3f1lA           --------------------VLHNAGLLGDVPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGS
3d3eB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3d3eA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1w73A           PD-VQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGA
3gy0A           --------------------VLHNAGLLGDVPMSEQNPQVWQDVMQINVNATFMLTQALLPLLLKSDAGS
3f5sB           --------------------VLHNAGLLGDVPMSEQNPQVWQDVMQINVNATFMLTQALLPLLLKSDAGS
3f5sA           --------------------VLHNAGLLGDVPMSEQNPQVWQDVMQINVNATFMLTQALLPLLLKSDAGS
1w0cC           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDREAMETIAPYFLIKAFAHRVAGTPAKHRGTNYS
3hfgB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3d4nD           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1xq1A           ---------------GKLDILINNLG---ALDYTAEDFSFH---ISTNLESAYHLSQLAHPLLKASGCGN
1w73C           PD-VQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGA
3d4nC           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3czrA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1h5qA           TDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKG
1gz6A           ----------ALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHKKQ-NYGR
3gegA           ----------AMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIK-NKGR
1e6wA           EKEVQAALTLAKEKFGRIDVAVNCAGIAVAI---KTTLEDFQRVINVNLIGTFNVIRLVAGVMGQGQRGV
1e3wA           EKEVQAALTLAKEKFGRIDVAVNCAGIAVAI---KTTLEDFQRVINVNLIGTFNVIRLVAGVMGQGQRGV
2dknA           ------AGVGVTAANSGLVVAVNYFGVSALLDGLAEALSRGQQPAAV-IVGSIAATQAELPAMLAGDEAR
1xu9C           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3hfgC           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1g0nB           VEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKH-LEIG-GR
1e6wD           EKEVQAALTLAKEKFGRIDVAVNCAGIAVAI---KTTLEDFQRVINVNLIGTFNVIRLVAGVMGQGQRGV
1e6wB           EKEVQAALTLAKEKFGRIDVAVNCAGIAVAI---KTTLEDFQRVINVNLIGTFNVIRLVAGVMGQGQRGV
1uluB           DEELDALFAGVKEAFGGLDYLVHAIAFAPREAEGRTRRQDWLLALEVSAYSLVAVARRAEPLLREGGGVT
3d4nA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2yw9A           DEELDALFAGVKEAFGGLDYLVHAIAEAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLREGGG--
1xg5A           EEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGH
1e3sA           EKEVQAALTLAKEKFGRIDVAVNCAGIAVAI---KTTLEDFQRVINVNLIGTFNVIRLVAGVMGQGQRGV
2bf7B           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
3hfgD           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3gedB           ----------AMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIK-NKGR
3gedA           ----------AMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIK-NKGR
3frjA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1e92B           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
1e7wA           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
3d5qA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3bzuC           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2bfmC           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2yw9D           DEELDALFAGVKEAFGGLDYLVHAIAEAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLREGGG--
1xu9D           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2qhxA           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
3d5qD           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
3d5qC           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
2bf7C           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2belC           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
1xg5B           EEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGH
1w0cA           ---------------GRCDVLVNNASSFYPTPLLRNDVGDREAMETATLIKAFAHRVAGTPAKHRGTNYS
2a4kB           ----------------------------------------WEKVLRVNLTGSFL----------------
2yw9H           DEELDALFAGVKEAFGGLDYLVHAIAEAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLREGGG--
1ydeN           EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
1ydeB           EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
1e92D           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2bfpB           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2bfaA           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2bf7A           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
1bdbA           LEDQKQAASRCVARFGKIDTLIPNAG-IWDYSTALVDLAAFDEVFHINVKGYIHAVKACLPALV-ASRGN
1w0cF           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRND---GDREAMETATADLFGSNAIAPYFLIKAFAH
1gz6C           ----------ALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHKKQ-NYGR
1e92C           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDREAMETIAPYFLIKAFAHRVAGTPAKHRGTNYS
3dijA           --------------------------------------------------------------------GR
2bfpD           ---------------GRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2bfmB           ---------------GRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2bfaB           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
1w73D           PD-VQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGA
1w0cE           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
1w0cB           ---------------GRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2p8kB           ---------------GRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
3ctmA           PKSVEETISQQEKDFGTIDVFVANAGVTWTQEIDVDNYDSWNKIISVDLNGVYYCSHXXXXXXXXXXXXS
2bfoA           ---------------GRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2yw9C           DEELDALFAGVKEAFGGLDYLVHAIAEAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLREGGG--
1w0cH           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2p8kG           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDREAMETIAPYFLIKAFAHRVAGTPAKHRGTNYS
2p8kD           ---------------GRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2p8kA           ---------------GRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
1gz6B           ----------ALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHKKQ-NYGR
1e92A           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRND---GDREAMETATADLFGSNAIAPYFLIKAFAH
2yw9E           DEELDALFAGVKEAFGGLDYLVHAIAEAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLREGGG--
1w0cG           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDREAMETIAPYFLIKAFAHRVAGTPAKHRGTNYS
2qhxC           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
1e7wB           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2bfoC           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
1uluA           DEELDALFAGVKEAFGGLDYLVHAIAFAPREAEGRTRRQDWLLALEVSAYSLVAVARRAEPLLREGGGVT
2p8kC           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDREAMETIAPYFLIKAFAHRVAGTPAKHRGTNYS
3diiA           --------------------------------------------------------------------GR
2yw9F           DEELDALFAGVKEAFGGLDYLVHAIAEAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLREGGG--
1w73B           PD-VQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGA
2qhxD           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
1uluC           DEELDALFAGVKEAFGGLDYLVHAIAFAPREAEGRTRRQDWLLALEVSAYSLVAVARRAEPLLREGGGVT
1y5mA           MTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALP-MLKQSNGS
1uluD           DEELDALFAGVKEAFGGLDYLVHAIAFAPREAEGRTRRQDWLLALEVSAYSLVAVARRAEPLLREGGGVT
2p8kH           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRND---GDREAMETATADLFGSNAIAPYFLIKAFAH
3ctmE           PKSVEETISQQEKDFGTIDVFVANAGVTWTDNYDS-----WNKIISVDLNGVYYCSHXXXXXXXXXXXXS
2bfaC           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2bf7D           ---------------GRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
3ctmG           PKSVEETISQQEKDFGTIDVFVANAGVTWTVD----NYDSWNKIISVDLNGVYYCSHXXXXXXXXXXXXS
2bfaD           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
3ctmC           PKSVEETISQQEKDFGTIDVFVANAGVTWVDNYDS-----WNKIISVDLNGVYYCSHXXXXXXXXXXXXS
1hxhA           ADWTL-VMAAVQRRLGTLNVLVNNAGILLPGDMETGRLEDFSRLLKINTESVFIGCQQGIAAMKETG-GS
2fwmX           --------------------LVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGA
1pwxA           -----------TSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGH
1zmoA           -------------------------------PLEGTSEADIRQMFEALSIFPILLLQSAIAPLRAAGGAS
1mxfA           -------------AFGRCDVLVNNASAYYPTP-------LLPKPIDAQVAELF-GSNAVAPLFLIRAFAR
1a4uA           -----------------------------------------ERTIAINFTGLVNTTTAILDFWRKGGPGG
2qq5A           ------------EQQGRLDVLVNNAYAGVQTAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGL
2dknB           ------------------------------------------------IVGSIAATQAELPAMLAGDEAR
1mxhA           -------------AFGRCDVLVNNASAYYPTPLLPPIDAQVAELFGSNAVAPLFLIRAF--ARRQSRNLS
3ctmF           PKSVEETISQQEKDFGTIDVFVANAGVTWTGPENK--------IISVDLNGVYYCSHXXXXXXXXXXXXS
3ctmD           PKSVEETISQQEKDFGTIDVFVANAGVTW------TQGPEIDKIISVDLNGVYYCSHXXXXXXXXXXXXS
3ctmB           PKSVEETISQQEKDFGTIDVFVANAGVTW------TQGPEIDKIISVDLNGVYYCSHXXXXXXXXXXXXS
1fk8A           ----------------------------------------------------------------------
1mg5A           -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
3ctmH           PKSVEETISQQEKDFGTIDVFVANAGVTWTQ-------GPEIKIISVDLNGVYYCSHXXXXXXXXXXXXS
3guyH           --------------------VVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-
3guyG           --------------------VVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-
3guyD           --------------------VVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-
3guyC           --------------------VVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-
3guyB           HQEVEQLF----EQLSIPSTVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-
2p91A           --------------------------------------------MDISVYSLIALTRELLPLM-EGRNGA
3guyA           --------------------VVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-
1z6zE           -------------------LLINNAGSLGDVSKGFVDLSDSTQVNNLNLTSMLCLTSSVLKAFPDSGLNR
1z6zD           -------------------LLINNAGSLGDVSKGFVDLSDSTQVNNLNLTSMLCLTSSVLKAFPDSGLNR
1z6zB           -------------------LLINNAGSLGDVSKGFVDLSDSTQVNNLNLTSMLCLTSSVLKAFPDSGLNR
1z6zA           -------------------LLINNAGSLGDVSKGFVDLSDSTQVNNLNLTSMLCLTSSVLKAFPDSGLNR
1qsgG           ----------------------------------------------------------------------
1qsgA           ----------------------------------------------------------------------
1qg6A           ----------------------------------------------------------------------
1c14A           ----------------------------------------------------------------------
3e9nA           -------------------------------------VAEWHAHLDLNVIVPAELSRQLLPA-LRAASGC
2fhsB           ----------------------------------------------------------------------
1lxcA           ----------------------------------------------------------------------
2p91B           --------------------------------------------MDISVYSLIALTRELLPLM-EGRNGA
1i30A           ----------------------------------------------------------------------
1dfiA           ----------------------------------------------------------------------
2jjyB           --------------------------------------------------------------------GR
1enoA           ----------------------------------------------------------------------
3e9nD           -------------------------------------VAEWHAHLDLNVIVPAELSRQLLPA-LRAASGC
1d7oA           ----------------------------------------------------------------------
1cwuA           ----------------------------------------------------------------------
2qioA           ----------------------------------------------------------------------
1n5dA           LQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRVCTEL-LPLIKPQG--R
2jjyA           --------------------------------------------------------------------GR
3e9nC           -------------------------------------VAEWHAHLDLNVIVPAELSRQLLPA-LRAASGC
3f1kA           --------------------VLHNAGLLGDVCPSEQNPQVWQDV-QVNVNATFL-TQAXXXXXXKSDAGS
3ek2B           ----------------------------------------------------------SFPALAKAA---
3ek2C           ----------------------------------------------------------SFPALAKAA---
3e9qB           --------------------VLHNAGLLGDVCPSEQNPQVWQDV-QINVNATFL-TQAXXXXXXKSDAGS
3e9qA           --------------------VLHNAGLLGDVCPSEQNPQVWQDV-QINVNATFL-TQAXXXXXXKSDAGS
3e9nH           -------------------------------------VAEWHAHLDLNVIVPAELSRQLLPA-LRAASGC
3e9nF           -------------------------------------VAEWHAHLDLNVIVPAELSRQLLPA-LRAASGC
3e9nE           -------------------------------------VAEWHAHLDLNVIVPAELSRQLLPA-LRAASGC
2jjyC           --------------------------------------------------------------------GR


                         +         .         .         .         .         *         .:210
query           IVNVASTAGLIGYGYVSAYCAAKHGVIGLTRSLALELATKGVTVNAVCPGYTETDIVRDAVANIVGKTGR
1x7hB           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEV
1x7gA           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEV
1w4zA           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEV
2rhrA           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEV
2rh4B           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEV
2rh4A           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEV
1xr3B           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAA-SVREV------
2yz7A           IINIASAHGLVASVNKSAYVAAKHGVVGLTKVTALENAGKGITCNAICPGWVRTPLVEKQIEAISQQKGI
1w4zB           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYT-----
2rhrB           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETP--------MAASVRE
3csdB           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETP--------MAASVRE
1x7gB           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMA-------------
2ztlA           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGV
2q2vA           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGD
2ztmA           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQISALAEKNGV
2q2wA           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDD---RNGG
2q2qB           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAGDPLQ
2q2wC           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDD-----GG
2q2qA           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDD------R
2q2vD           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQI---------
2q2qE           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDD------R
2q2vB           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDD---RAAG
2q2wD           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDPL-----
2q2vC           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQI---------
2q2qG           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAAPLQA
2q2qC           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIAQ-------
2ztvC           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISAGVDQ---
2ztvD           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQI------SVD
2q2qF           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLAQHDL---------
2ztmC           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQISALAEKELL
2q2qH           IINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPPL-------------
2ztvB           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLV-------------
2ztmD           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQIS--------
2ztuC           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWV-----------------R
2p68A           IVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDM-----------TAV
2ztuD           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVR-----------------
3ezlA           IINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEK---
2ztmB           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRS----------------
1uznA           MIFIGSVSGLWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTR-----------A
2ztuB           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVEL----------------
1x1tA           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGW-------------------
2ztuA           IINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRL----------------
2uvdA           IVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDM-----------TDV
2ph3A           IVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEM-----------TER
2zk7B           IVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAELEVGSDPM
2dteA           IVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAELEVGSDPM
2p68B           IVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMT--AVLQ------K
2d1yC           IVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIA-----LSP
1iy8A           VVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPR
1gegE           IINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGK
1gegA           IINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGK
1q7bB           IITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMT------------R
1q7bA           IITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR----------AL
1uznB           MIFIGSVSGLWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDT-----ALQFI------
1q7cA           IITIGSVVGTMGNGGQANFAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR----------AL
3ftpA           IVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTK----------GL
2d1yD           IVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIA-----TRR
2d1yB           IVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAI-----RTRR
2d1yA           IVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAI---------
1uzlB           MIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDT-----ALQFI------
2cfcA           IVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRL---------
1uzlA           MIFIGSVSGSWGQ---ANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTR-----------A
3ftpC           IVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTK------------
3gk3D           IVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVL-----
3gk3B           IVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVL-----
2zk7A           IVNISSVKN------ASAYVTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAELEVGSDPM
1uzmA           MIFIGSVSG-----NQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTR-----------A
3ftpD           IVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTD---------------
2ntnA           MIFIASVQ--------ANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTR-----------A
1hdcA           IVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTP--------MTAETGI
3gvcC           IVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFDGALG-
3gvcB           IVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFDGALG-
1x1eA           VLFIGSVTTFTAGGPVPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPL---------R
3gk3A           IVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVE------------
2ekpA           VLFIGSVTTFTAGGPVPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPL---------R
3gk3C           IVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMV-------------
1i01E           IITIGSVVGQANYA------AAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR----------AL
2nm0A           XXXXXXXXXXXXXXXQANYAASKAGLVGFARSLARELGSRNITFNVVAPGFVDTQ---------------
3gvcA           IVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFGG----
2ph3B           IVNITSVVGIL--GNPANYVASKAGLIGFTRAVAKEYAQRGITVNAV----IETEM-----------TER
2ekqD           VLFIGSVTTFTAGGPVPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETELYE------------
3gvcD           IVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAG-------
1yxmD           IVNII-VPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGYSQT-----AVEN-YGSWGQ
1edoA           XXXXASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM-----------TAK
1yxmA           IVNII-VPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGYSQT-----AVEN-YGSWGQ
1nffA           IINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMT-DWVPEDIFQTAL
1i01B           IITIGS---VVGTGQAN-YAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIET----------------
3gafA           ILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKT----DALATVL-----
1zemA           IVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVELQAKVGS
3gafD           ILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDVL-------------
2c07A           IINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISS----------------
1k2wA           IINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKFADYENL
1i01A           IITIGSVVGTMA--------AAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR----------AL
3gafF           ILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDAV------------L
1i01F           IITIGSVVA-----------AAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR----------AL
1yxmB           IVNII-VPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGV------------IYSQTAQ
2ntnB           MIFIASVQ--------ANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDT----------------
2hq1A           IINITSQAN---------YAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDM-----------TDV
3gafG           ILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTD---------------
3gafC           ILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTD---------------
1i01C           IITIGSV--------VANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR------------
3gafB           ILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTD---------------
3f9iA           IINISSIVG--GNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKLN---------------
1uzmB           MIFIGSVSQ-------ANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDT-----ALQFI------
2pd6D           IINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDK---
2pd6C           IINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDK---
2pd6B           IINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDK---
1i01G           IITIG-------------YAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR----------AL
1fmcA           ILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVIT--------
1ahhA           ILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVIT--------
2z1nB           MVYIGSVTLLRPWQDLALSNIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVRS-----------
1o5iA           IVAITSFSVISPIENLYTSNSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVKELLS--------
3ennB           XXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIE-----------------
1i01H           IITIGAN-----------YAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR------------
3gafH           ILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTPEIERA----------
3gafE           ILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKT----------------
3emkA           XXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIES----------------
1nfrA           IINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTP--TDWVPEDIFQTAL
3ennD           XXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIEKDAI---MGNI------
3ennC           XXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIEKDAI---MGNI------
2a4kA           LVLTGSVAGLGAFG-LAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPM-----------TAG
1i01D           IITIGSV--------VANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETAL--------------
3emkD           XXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFI------------------
3ennA           XXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESKQKDAIMGNI------
3f9iB           XXXXXXXXXXXXPGQAN-YCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDM-----------TDK
1zjyA           IINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDVRVNTVHPGYIKTPLVDDL-------PGA
1nxqA           IINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDVRVNTVHPGYIKTPLVDDL-------PGA
1yxmC           IVNII----VPGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGYSQTAVFEGSFQKI------
3emkB           XXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGF-----IKDAIMGNI-----
1ulsB           IVLTASRVYLGNLG--QANYAASAGVVGLTRTLALELGRWGIRVNTLAPGFIET------------RTAK
1ulsA           IVLTASRVYLGNLG--QANYAASAGVVGLTRTLALELGRWGIRVNTLAPGFIET------------RTAK
3cxtA           IINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTHPFDQFIIAKT--
2z1nA           MVYIGSVTLLRPWQDLALSNIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVR------------
3emkC           XXXXTSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGF-------------------
2pd6A           IINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM--------------
2japC           VVQMSSIAGRVNVRNAAVYQATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTEL-----------RGH
2japA           VVQMSSIAGRVNVRNAAVYQATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTEL-----------RGH
3grpA           IINITS----IGQ---TNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKS-----------AMTDK
3cxrA           IINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPL---------R
1ulsC           IVLTASRVYLGNLG--QANYAASAGVVGLTRTLALELGRWGIRVNTLAPGFIET----------------
1ja9A           IILTSSIAAVMGIPNHALYAGSKAAVEGFCRAFAVDCGAKGVTVNCIAPGGVKTDMFDENSWHYAGYKGM
3i4fA           IINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPG------------DIIGEMKE
3i4fD           IINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPG------------DIIGEMKE
2b4qA           VINIGSVAGISAMGQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRH-IAN-------
3grpB           IINITS----IGQ---TNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAIM-------------
2ewmA           IINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTLQAIPRL------
1ae1B           VIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAI-----KKNP
3i4fC           IINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPG------------DIIGEMKE
2ewmB           IINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRT----------------
2bgkA           IVFTASISSFTGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFG---VDSSR
2gdzA           IINMSSLAGLMPVAQQPVYCASKHGIVGFTRSLAANLMNSGVRLNAICPGFVNTAIL-------------
2ae2A           VVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQD------P
1xkqB           IVNVSSVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVET-----GFTNAMGMPDQ
1xkqA           IVNVSSVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVET-----GFTNAMGMPDQ
3grpC           IINITSIQ--------TNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGF----IKKEAIMAMI-----
2ew8B           IINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAP---------------------
2ew8A           IINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAP---------------------
1cydA           IVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTD---------MGKKVS
3imfB           IINVATYAWDAGPGVIHS-AAAKAGVLA-TKTLAVEWGRKGIRVNAIAPGPIE-------------RTGG
2et6A           IINITSTSGIYGNFGQANYSSSKAGILGLSKTMAIEGAKNNIKVNIVAP---------------------
1w6uA           FLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT----------LDPTGT
1xhlA           IVNVSSVAGPQAHSGYPYYACAKAALDQYTRCTAIDLIQHGVRVNSVSPGAVATGFM-----GAMGLPET
1w6uC           FLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT-----------GAFGT
1yb1A           IVTVASAAH-VSVPFLLAYCSSKFAAVGFHKTLTDELAATGVKTTCLCPNFVNTGFIKNPSTSL-GPTLE
1w6uB           FLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPI--------------KTGT
3grpD           IINITSIQ--------TNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIK-----------------
3iccA           IINISSAATRISLPDFIAY--STKGAINTTFTLAKQLGARGITVNAILPGFVKTD-----NAELLS----
2ae1A           VVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPG-------------VIATQDP
2ehdA           IVNVGSLAGKNPFKGGAAYNASKFXXXXXXXXXMLDLREANVRVVNVLPGLKPEDVAQ------------
2b4qB           VINIGSVAGISAMGQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRH-IAN-------
1ae1A           VIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVI---LQKEEIDNFIVKT--
1yb1B           IVTVASAH--VSVPFLLAYCSSKFAAVGFHKTLTDELAATGVKTTCLCPNFVNTGFIKNPSTSL-GPTLE
3i3oF           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
3i3oE           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
3i3oC           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
3i3oB           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
3i3oA           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
2ag5C           IINMSSVASSVGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERI-----QARG
2ag5B           IINMSSVASSVGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERI-----QARG
2ag5A           IINMSSVASSVGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERI-----QARG
3imfA           IINVATYAWDAGPGVIHS-AAAKAGVLA-TKTLAVEWGRKGIRVNAIAPGPIE-------------RTGG
2jahC           VVQ-SSIAGRVNVRNAAVYQATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTEL-----------RGH
2jahA           VVQ-SSIAGRVNVRNAAVYQATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTEL-----------RGH
1w6uD           FLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT----------------
2zatA           XXXXXXXXAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNF-----SQVLWMDKA
2ehdB           IVNVGSLAGKNPFKGGAAYNASKFXXXXXXXXXMLDLREANVRVVNVLPG--------------------
1vl8B           IINIGSTVEEVTMPNISAYAASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKMTEAVF---------
1vl8A           IINIGSTVEEVTMPNISAYAASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKMTEAVF---------
1g6kA           VINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFAD-------
1rwbA           VINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKFAD-------
3i3oH           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
3edmB           IVTFSSQAGRDGGGGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTT-----------REGS
3edmA           IVTFSSQAGRDGGGGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMIST------------REGS
1geeA           VINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFAD-------
1gcoA           VINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFAD-------
3imfC           IINVATYAWDAGPGVIHS-AAAKAGVLA-TKTLAVEWGRKGIRVNAIAPGPIE-----------------
1zbqA           IIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNMTQTVMPEDLV---------
1uayA           IVNTASVAAFEGQIGQAAYAASKGGVVALTLPAARELAGWGIRVVTVAPGLFDTPLLQGL----------
3edmD           IVTFSSQAGRDGGGGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGSSE-----------------
3edmC           IVTFSSQAGRDGGGGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGSSE-----------------
2c7vB           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
2c7vA           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3ijrH           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
3ijrF           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
3ijrE           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
3ijrB           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
3ijrA           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSF---------
2wd7C           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
1uayB           IVNTASVAAFEGQIGQAAYAASKGGVVALTLPAARELAGWGIRVVTVAPGLFDTPL--------------
3bmnD           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmeB           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmiB           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
2c7vD           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmqA           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmnC           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmeA           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
2wd7B           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmoC           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmjD           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
2vz0A           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3i3oG           IINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPG--------------------
3bmoD           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmnA           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmkC           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
1pr9A           IVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNP---------TVVMTSMGQATW
3bmnB           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmqC           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmfD           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmfA           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGV--------SLLPAMGEEEK
2vz0B           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3g1tA           LVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNRSLRVNCINPGGTRTSM--------------
1spxA           IVNISSIAGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFY-------------
3bmoB           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmoA           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmfB           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3bmdB           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGV--------SLLPAMGEEEK
2c7vC           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-------MGEEEK
3d3wA           IVNVSSQSQRAVTNH-SVYCSTKGALDMLTKVMALELGPHKIRVNAVNP---------TVVMTSMGQATW
3bmeC           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG----------VSLLPDKWRR
3bmfC           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVS------------LGEEEK
1ybvA           LILMGSITGQAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDVCREYIPN--GENLS
1g0oC           LILMGSITGQAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDVCREYIPN--GENLS
1g0oA           LILMGSITGQAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDVCREYIPN--GENLS
3e03C           ILTLAPPPSLAWWGAHTGYTLAKGSLV--TLGLAAEFGPQGVAINALWP---RTVIATDAI-NLPGVDA-
3e03B           ILTLAPPPSLAWWGAHTGYTLAKGSLV--TLGLAAEFGPQGVAINALWP---RTVIATDAI-NLPGVDA-
1dohB           LILMGSITGQAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDVCREYIPN--GENLS
1dohA           LILMGSITGQAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDVCREYIPN--GENLS
2bd0A           IFFITSVAATKAFRHSSIYCMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYT----------------
1u7tA           IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLL-------------
1p33D           VVDAMTSQPLLGY---TMYTMAKEALEGLTRSAALELASLQIRVNGVSPGLS---VLPDDMPFSV----Q
2o23B           IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLL-------------
1fdvB           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTEVL-------------
1xg5C           IININSMSGVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCPGVVETQF-----------AFK
2o23A           IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPG--------------------
1xu9B           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
1xu9A           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
1xu7D           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
1xu7B           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
1xu7A           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
1so8A           IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTD-----------
2rbeD           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
2rbeC           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
2rbeB           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
2rbeA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
2irwC           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
2irwA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
1iolA           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
2iltA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3hfgA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3gz4B           LVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADEYQQR-LRVNCINPGGTRT----------------
3gz4A           LVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADEYQQR-LRVNCINPGGTRT----------------
3ey4C           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3ey4A           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3e03A           ILTLAPPPSLAWWGAHTGYTLAKGSLV--TLGLAAEFGPQGVAINALWP---------------------
3d5qB           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3d4nB           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3ch6E           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3ch6D           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3ch6B           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3ch6A           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3bzuB           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3bzuA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
3byzA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
2belD           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
2belB           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
2belA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
2yw9B           IVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGP-----VRVAARSIPGFTKM
1qyxA           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLICPVHTSPEEVLD-----------
1qyvA           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLICPVHTSPEEVLD-----------
1fduD           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFM-EKVLEVLDRT--
1fduA           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFM-EKVLGVLDRT--
1p33C           VVDAMTSQPLLGY---TMYTMAKEALEGLTRSAALELASLQIRVNGVSPGLS---VLPDDMPFSV----Q
1p33B           VVDAMTSQPLLGY---TMYTMAKEALEGLTRSAALELASLQIRVNGVSPGLS---VLPDDMPFSV----Q
1jtvA           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
1fdwA           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
1fduC           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
1fduB           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
1fdsA           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
3deyX           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
3bzuD           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
1bhsA           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
1a27A           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
1p33A           VVDAMTSQPLLGY---TMYTMAKEALEGLTRSAALELASLQIRVNGVSPGLS---VLPDDMPFSV----Q
1e6wC           IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTNFLASQVPFPSR
1ydeP           VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRAS
1ydeM           VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRAS
1ydeI           VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRAS
1ydeH           VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRAS
1ydeG           VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRAS
1ydeF           VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRAS
1ydeD           VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRAS
1ydeA           VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRAS
3f5qB           LVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADEYQQR-LRVNCINPGGT------------------
3f5qA           LVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADEYQQR-LRVNCINPGGT------------------
3f1lB           LVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADEYQQR-LRVNCINPGGTRT----------------
3f1lA           LVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADEYQQR-LRVNCINPGGTRT----------------
3d3eB           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVQAAPK
3d3eA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVQAAPK
1w73A           FLSITTIYAETGSGFVVPSASAKAGVEA-SKSLAAEWGKYG-RFNVIQPGPIKT----------LDPTGT
3gy0A           LVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADEYQQR-LRVNCINPGGTRT----------------
3f5sB           LVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADEYQQR-LRVNCINPGGTRT----------------
3f5sA           LVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADEYQQR-LRVNCINPGGTRT----------------
1w0cC           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG----------LSVLVGHRSK
3hfgB           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIHMQAAP
3d4nD           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIHMQAAP
1xq1A           IIFMSG----------SIYSATKGALNQLARNLACEWASDGIRANAVAP------------AVIAGE---
1w73C           FLSITTIYAETGSGFVVPSASAKAGVEA-SKSLAAEWGKYG-RFNVIQPGPIKT-------------TGT
3d4nC           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIMQAAPK
3czrA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGVHMQAAP
1h5qA           SIVVTXXXXXXXXXXXXXYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTD-----------QTAH
1gz6A           IIT-ASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAP-----------------NAGS
3gegA           IINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLG-PDVLVNCIAPGWINVTFTQEDCAAI------
1e6wA           IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLVRNFLASQVPFPSR
1e3wA           IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLVRNFLASQVPFPSR
2dknA           AIELAEQQGQTHL----AYAGSKYAVTCLARRNVVDWAGRGVRLNVVAPGAVETPLLQASKAD-----PR
1xu9C           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIAGGALR
3hfgC           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIAGGALR
1g0nB           LILMGSITGQAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMY------------H
1e6wD           IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLL-------------
1e6wB           IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLL-------------
1uluB           LTYYASEKVVPKYNVAIAKAALEASV----RYLAYELGPKGVRVNAISAGPVRTVAAR----SIPGFTKY
3d4nA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSIVHMQAAP
2yw9A           IVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGP-----VRDRVAQTA-----
1xg5A           IININSMSGVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCPGVVET----------------
1e3sA           IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFAT----------------
2bf7B           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
3hfgD           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIKGGALR
3gedB           IINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLG-PDVLVNCIAPGWINTEFTQEDCAAI------
3gedA           IINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLG-PDVLVNCIAPGWINTEFTQEDCAAI------
3frjA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAV------SGH
1e92B           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
1e7wA           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
3d5qA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVMQIKGGALR
3bzuC           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVMQIKGGALR
2bfmC           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG----------LSVLVGHRSK
2yw9D           IVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPVGFTKMYDRVAQTA-----
1xu9D           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSMIKGGALR
2qhxA           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
3d5qD           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSMIKGGALR
3d5qC           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVQAIKGGALR
2bf7C           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG----------LSVLVGHRSK
2belC           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGM------
1xg5B           IININSMSGVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCPGVVET----------------
1w0cA           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
2a4kB           ---VARKAGEVLEEXXXXXXXXXXXXXXXARTLALELARKGVRVNVLLPGLI------------------
2yw9H           IVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPVFTKMY-DRVAQTA-----
1ydeN           VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPG------------NIWTPLWE
1ydeB           VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPG------------NIWTPLWE
1e92D           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG----------LSVLVGHRSK
2bfpB           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
2bfaA           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
2bf7A           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
1bdbA           VIFTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELAPY-VRVNGVGSGGINSDL--------------
1w0cF           MVDAMTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
1gz6C           IIT-ASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAP----NDLV-------------
1e92C           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG----------LSVLVGHRSK
3dijA           IINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLG-PDVLVNCIAPGWINVTFTQEDCAAI------
2bfpD           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG----------LSVLVGHRSK
2bfmB           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
2bfaB           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
1w73D           FLSITTIYAETGSGFVVPSASAKAGVEA-SKSLAAEWGKYG-RFNVIQPGPIKTKEI-------------
1w0cE           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
1w0cB           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
2p8kB           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
3ctmA           LIITSSISGKI-VQLQAPYNTAKAACTHLAKSLAIEWA-PFARVNTISPGYIDTDI-----------TDF
2bfoA           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
2yw9C           IVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGP-----VYDRVAQTA-----
1w0cH           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVAVWEGHRSKVPLYQR
2p8kG           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSV------LVDDMEGHRSK
2p8kD           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSV--LVDDMVWE--GHRSK
2p8kA           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
1gz6B           IIT-ASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAP---------------------
1e92A           MVDAMTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
2yw9E           IVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPVRK--MYDRVAQTA-----
1w0cG           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG----------LSVLVDDMPP
2qhxC           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------VLVEGHRSK
1e7wB           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS-------VLVDWEGHRSK
2bfoC           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDGHRSKVPLYQR
1uluA           LTYYASEKVVPKYNVAIAKAALEASV----RYLAYELGPKGVRVNAISAGPVFTKYDR------------
2p8kC           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------VLVEGHRSK
3diiA           IINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLG-PDVLVNCIAPGWINTEFTQEDCAAI------
2yw9F           IVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPYD-----------------
1w73B           FLSITTIYAETGSGFVVPSASAKAGVEA-SKSLAAEWGKYG-RFNVIQPG--------------------
2qhxD           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---------VLVEGHRSK
1uluC           LTYYASEKVVPKYNVAIAKAALEASV----RYLAYELGPKGVRVNAISAGP-----VYDRVAQTA-----
1y5mA           IAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELITKNVSITLCVLGLIDTETAMKEISGIINAQAS
1uluD           LTYYASEKVVPKYNVAIAKAALEASV----RYLAYELGPKGVRVNAISAGP-------------VRKYDR
2p8kH           MVDAMTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS-------VLVDDEGHRSK
3ctmE           LIITSSISGKIQLQ--APYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTDI-----------TDF
2bfaC           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSV--LVRSKV---------
2bf7D           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSV--LVRSKV---------
3ctmG           LIITSSISGKIQLQ--APYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTDI-----------TDF
2bfaD           IINMVTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG-----------LSVLVHRSK
3ctmC           LIITSSISGKIQLQ--APYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTDI-----------TDF
1hxhA           IINMASVSSWLPIEQYAGYSXXXXXXXXXXXXXXXXCRKQGIRVNSIHPDGIYTPMMQASLPKGVSK---
2fwmX           IVTVASDAAHTPRIGMSAYGXXXXXXXXXXXXVGLELAGSGVRCNVVSPGST------------------
1pwxA           IIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSE---DSPYFYPTEPWK
1zmoA           VIFITSSVGKKPLAYNPLYGPARAATVALVESAAKTLSRDGILLYAIGPNFFNNPTYFPT------SDWE
1mxfA           VVNLCDATDLPLPGF--CVYTAKHALGGLTRAAALELAPRHIRVNAVAPG--------------------
1a4uA           IINICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLV-------------
2qq5A           IV-VISSPGSLQYMFNVPYGVGXXXXXXXXXXXXHELRRHGVSCVSLWPGIVQTELLSSA----------
2dknB           AIELAEQQGQTHL----AYAGSKYAVTCLARRNVVDWAGRGVRLNVVAPG--------------VAPLGR
1mxhA           VVNLCDAMTDLPLPGFCVYTMAKHALGGLTRAAALELAPRHIRVNAVAPG--------------------
3ctmF           LIITSSISGIVNIPQLQAYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTDI-----------TDF
3ctmD           LIITSSISGIVNIPQLQAYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTDI-----------TDF
3ctmB           LIITSSISGIVNIPQLQAYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTDI-----------TDF
1fk8A           -----------------AYAGSKNALTVAVRKRAAAWGEAGVRLNTIAPGATETPFVP------------
1mg5A           IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
3ctmH           LIITSSISGIVNIPQLQAYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTDI-----------TDF
3guyH           VVMIMSTAAQQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATE---------------
3guyG           VVMIMSTAAQQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATE---------------
3guyD           VVMIMSTAAQQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATE---------------
3guyC           VVMIMSTAAQQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATE---------------
3guyB           VVMIMSTAAQQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPG--------------------
2p91A           IVTLSYYGAEKVVPHYNVMGIAKAALESTVRYLAYDIAKHGHRINAISAGPVKT------LAAITGFHLL
3guyA           VVMIMSTAAQQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPG--------------------
1z6zE           VVNISSLCALQPFKGWALYCAGKAARDMLFQVLALE--EPNVRVLNYAPGPLDTDLARETSVDPDMRKGL
1z6zD           VVNISSLCALQPFKGWALYCAGKAARDMLFQVLALE--EPNVRVLNYAPGPLDTDLARETSVDPDMRKGL
1z6zB           VVNISSLCALQPFKGWALYCAGKAARDMLFQVLALE--EPNVRVLNYAPGPLDTDLARETSVDPDMRKGL
1z6zA           VVNISSLCALQPFKGWALYCAGKAARDMLFQVLALE--EPNVRVLNYAPGPLDTDLARETSVDPDMRKGL
1qsgG           ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRT---------LAASGIK
1qsgA           ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRT---------LAASGIK
1qg6A           ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRT---------LAASGIK
1c14A           ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRT---------LAASGIK
3e9nA           VIYINNTI----------YAASKHALRGLADAFRKEEANNGIRVSTVSPGPTRPEI--------------
2fhsB           ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRT--IKDF----------
1lxcA           ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRT-LFRKMLAHCEAVT--
2p91B           IVTLSYYGAEKVVPHYNVMGIAKAALESTVRYLAYDIAKHGHRINAISAGPVKT----------LAATGF
1i30A           ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPI-----------------R
1dfiA           ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRTLML-------------
2jjyB           SMMKNRNASMVALTYIGAEKAAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLMV-------------
1enoA           -------------GYGGGMSSAKAALESDTRVLAFEAGRKNIRVNTISAGPLGSRAAK-AIGFIDTMIEY
3e9nD           VIYINNTI----------YAASKHALRGLADAFRKEEANNGIRVSTVSPGIEPKEI--------------
1d7oA           -------------GYGGGMSSAKAALESDTRVLAFEAGRKNIRVNTISAGPLGSRAAK-AIGFIDTMIEY
1cwuA           -------------GYGGGMSSAKAALESDTRVLAFEAGRKNIRVNTISAGPLGSRAAK-AIGFIDTMIEY
2qioA           ---------------------AKASLEASVKYLANDLGQHGIRVNAISAGP-----IRTLSAKGVGDFN-
1n5dA           VVNVSSTEGLVGLGWSSTYGVTKIGVSVLSRIYARKLAGDKILLNACCPGWVRTDM--------------
2jjyA           SMMKNRNASMVALTYIGAEKAAKASLEATVRYTALALGEDGIKVNAVSAGPIKKMLDYNAMVS-------
3e9nC           VIYINNTI----------YAASKHALRGLADAFRKEEANNGIRVSTVSPG--------------------
3f1kA           LVFTSSSVGRQGRANWGAYAASKFATEG--QVLADEYQQR-LRVNCINPGGTRT----------------
3ek2B           LPMLSDDASLLTLSYLGAERAAKAALEASVRYLAVSLGAKGVRVNAISAGPIKFGKILDFV---------
3ek2C           LPMLSDDASLLTLSYLGAERAAKAALEASVRYLAVSLGAKGVRVNAISAGPIKTSFGK--ILDFV-----
3e9qB           LVFTSSSVGRQGRANWGAYAASKFATEG--QVLADEYQQR-LRVNCINPGGTRT----------------
3e9qA           LVFTSSSVGRQGRANWGAYAASKFATEG--QVLADEYQQR-LRVNCINPGGTRT----------------
3e9nH           VIYINGN---------TIYAASKHALRGLADAFRKEEANNGIRVSTVSPGIEPKEI--------------
3e9nF           VIYINGN---------TIYAASKHALRGLADAFRKEEANNGIRVSTVSPGIEPKEI--------------
3e9nE           VIYINGN---------TIYAASKHALRGLADAFRKEEANNGIRVSTVSPGIEPKEI--------------
2jjyC           SMMKNRNASMVALTYIGAEKAAKASLEATVRYTALALGEDGIKVNAVSAGPIDYN---------------


                         .         .         .         +         .         .         .:280
query           SEEQARAELAARNPQRRLVRPDEVADAVAWLCQPSASAITGQAVPVAGGEVMAG
1x7hB           STEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
1x7gA           STEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
1w4zA           STEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
2rhrA           STEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
2rh4B           STEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
2rh4A           STEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
1xr3B           STEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
2yz7A           DEAAARELLAEKQPSLQFVTPEQLGGAAVFLSSAAADQMTGTTLSLDGG-----
1w4zB           --EEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
2rhrB           HTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
3csdB           HTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
1x7gB           ASVREFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
2ztlA           DQETAARELSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
2q2vA           PLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2ztmA           DQETAARELSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
2q2wA           DPLQAQHDLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2q2qB           AQHDL---LAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2q2wC           DPLQAQHDLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2q2qA           DPLQAQHDLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2q2vD           DDRQAQHDLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2q2qE           ALQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2q2vB           DPLQAQHDLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2q2wD           ---QAQHDLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2q2vC           -DDRLQAQLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2q2qG           QHDL----LAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2q2qC           -----HDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2ztvC           -ETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
2ztvD           QETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
2q2qF           --------LAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2ztmC           SEKQ---------PSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
2q2qH           ---QAQHDLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGG-----
2ztvB           EKTAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
2ztmD           ----ARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
2ztuC           QETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
2p68A           LSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGG-----
2ztuD           -ETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
3ezlA           --------IVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGG-----
2ztmB           ----ARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
1uznA           LDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-----
2ztuB           --------LSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
1x1tA           ----VRTLLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
2ztuA           --------LSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGG-----
2uvdA           LDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM--
2ph3A           LPQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGG-----
2zk7B           RIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGG-----
2dteA           RIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGG-----
2p68B           YKEQI--------PLGRFGSPEEVANVVLFLCSELASYITGEVI----------
2d1yC           DPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGG-----
1iy8A           ---KAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSAA-
1gegE           PLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMV---
1gegA           PLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMV---
1q7bB           SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM--
1q7bA           SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM--
1uznB           -------------PAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-----
1q7cA           SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM--
3ftpA           PQEQQTA-LKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFMS-
2d1yD           DWEDLHA-------LRRLGKPEEVAEAVLFLASEKASFITGAILPVDGG-----
2d1yB           DWEDLHA-------LRRLGKPEEVAEAVLFLASEKASFITGAILPVDGG-----
2d1yA           ----ARRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGG-----
1uzlB           -------------PAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-----
2cfcA           DQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDG------
1uzlA           LDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-----
3ftpC           ---EQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFMS-
3gk3D           -----EAKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHMS-
3gk3B           -----EAKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHMS-
2zk7A           RIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGG-----
1uzmA           LDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-----
3ftpD           ---EQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFMS-
2ntnA           LDQQGALQFI---PAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-----
1hdcA           RQGEGN---YPNTPMGRVGEPGEIAGAVVKLLSDTSSYVTGAELAVDGG-----
3gvcC           ---GARSMIA--RLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAA-
3gvcB           ---GARSMIA--RLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAA-
1x1eA           QNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGG-----
3gk3A           -----AAKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHMS-
2ekpA           QNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGG-----
3gk3C           ------AKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHMS-
1i01E           SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-----
2nm0A           -----RANIVSQVPLGRYARPEEIAATVRFLASDDASYITGAVIPVDGG-----
3gvcA           ----ARSMIA--RLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAA-
2ph3B           LPQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGG-----
2ekqD           -------PITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGG-----
3gvcD           ---GARSMIA--RLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAA-
1yxmD           SFFEGSFQ---KIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGG-----
1edoA           LGEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGG-----
1yxmA           SFFEGSFQ---KIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGG-----
1nffA           G---------------RAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTV---
1i01B           SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-----
3gafA           TPEIERAML-KHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV---
1zemA           QYFSTDPKVVAQQPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG-----
3gafD           TPEIERAML-KHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV---
2c07A           ISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGG-----
1k2wA           PRGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWMS-
1i01A           SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-----
3gafF           TPEIERAML-KHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV---
1i01F           SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-----
1yxmB           SFFEGSFQ---KIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGG-----
2ntnB           ---------LQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-----
2hq1A           LPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGG-----
3gafG           TPEIERAML-KHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV---
3gafC           TPEIERAML-KHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV---
1i01C           ----ARAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-----
3gafB           -PEIERAML-KHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV---
3f9iA           --EKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLM--
1uzmB           -------------PAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-----
2pd6D           --------ITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG-----
2pd6C           --------ITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG-----
2pd6B           --------ITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG-----
1i01G           SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-----
1fmcA           --PEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGV---
1ahhA           --PEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGV---
2z1nB           ------LSMASRIPMGRVGKPEELASVVAFLASEKASFITGAVIPVDGG-----
1o5iA           --EEKKKQVESQIPMRRMAKPEEIASVVAFLCSEKASYLTGQTIVVDGG-----
3ennB           SNEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM--
1i01H           --ALQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-----
3gafH           --------MLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV---
3gafE           TPEIERAML-KHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV---
3emkA           AMEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM--
1nfrA           G---------------RAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTV---
3ennD           -------------PMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM--
3ennC           -------------PMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM--
2a4kA           LPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGG-----
1i01D           SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-----
3emkD           -EEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM--
3ennA           -------------PMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM--
3f9iB           LNEKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLM--
1zjyA           EEAMSQ---RTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGG-----
1nxqA           EEAMSQ---RTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGG-----
1yxmC           -------------PAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGG-----
3emkB           -------------PMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM--
1ulsB           VPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI--
1ulsA           VPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI--
3cxtA           -------------PAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGG-----
2z1nA           -----------RIPMGRVGKPEELASVVAFLASEKASFITGAVIPVDGG-----
3emkC           --EKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM--
2pd6A           -------KITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG-----
2japC           ITHTATKEMEQRISQIRKLQAQDIAEAVRY------------------------
2japA           ITHTATKEMEQRISQIRKLQAQDIAEAVRY------------------------
3grpA           LNEKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGG-----
3cxrA           ELHPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGG-----
1ulsC           -PEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI--
1ja9A           PQEKIDEGLANMNPLKRIGYPADIGRAVSALCQEESEWINGQVIKLTGGGI---
3i4fA           ATIQEARQL-------RSGTGEDIARTISFLCEDDSDMITGTIIEVTG------
3i4fD           ATIQEARQLIGRSG-----TGEDIARTISFLCEDDSDMITGTIIEVTG------
2b4qA           -DPQALEADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGG-----
3grpB           ----------AMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM--
2ewmA           ------------------------------------------------------
1ae1B           HQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGG-----
3i4fC           ATIQEARQL-------RSGTGEDIARTISFLCEDDSDMITGTIIEVTG------
2ewmB           ------------------------------------------------------
2bgkA           VEELAH---QAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGG-----
2gdzA           ------------------------------------------------------
2ae2A           EQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGG-----
1xkqB           ASQKFYNFMASHKPIGAAGKPEHIANIILFLADRNLSYILGQSIVADGG-----
1xkqA           ASQKFYNFMASHKPIGAAGKPEHIANIILFLADRNLSYILGQSIVADGG-----
3grpC           -------------PMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGG-----
2ew8B           ------------------------------------------------------
2ew8A           ------------------------------------------------------
1cydA           ADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAG-----
3imfB           ADEEAKRTIQS-VPLGRLGTPEEIAGLAYYLCSDEAAYING-------------
2et6A           -----HAETAMKN----LYHADQVAPLLVYLGTDDV-PVTGETFEIGGG-----
1w6uA           FEK----EMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGE----
1xhlA           ASDKLYSFIGSRKPVGHCGKPEEIANIIVFLADRNLSSIIGQSIVADGGSTL--
1w6uC           FEK----EMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGE----
1yb1A           PEE---------------------------------------------------
1w6uB           FEK----EMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGE----
3grpD           -----------MIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGG-----
3iccA           DPKQYATTISAFN---RLGEVEDIADTAAFLASPDSRWVTGQLIDVSGGSCL--
2ae1A           EQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGG-----
2ehdA           ------------------------------------------------------
2b4qB           -DPQALEADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGG-----
1ae1A           -------------PMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGG-----
1yb1B           PEE---------------------------------------------------
3i3oF           -DEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIVNG
3i3oE           -DEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIVNG
3i3oC           -DEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIVNG
3i3oB           -DEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIVNG
3i3oA           -DEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIVNG
2ag5C           NPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGG-----
2ag5B           NPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGG-----
2ag5A           NPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGG-----
3imfA           AEAKRTIQSV---PLGRLGTPEEIAGLAYYLCSDEAAYING-------------
2jahC           ITHTATKEYEQRISQIRKLQAQDIAEAVRY------------------------
2jahA           ITHTATKEYEQRISQIRKLQAQDIAEAVRY------------------------
1w6uD           ----FEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGE----
2zatA           RKEYMKESLRI----RRLGNPEDCAGIVSFLCSEDASYI---------------
2ehdB           ------------------------------------------------------
1vl8B           SDPEKLDYMLKRIPLGRTGVPEDLKGVAVFLASEEAKYVTGQIIFVDGG-----
1vl8A           SDPEKLDYMLKRIPLGRTGVPEDLKGVAVFLASEEAKYVTGQIIFVDGG-----
1g6kA           ------------------------------------------------------
1rwbA           ------------------------------------------------------
3i3oH           ------SQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIVNG
3edmB           SE--------------------DVAGLVAFLASDDAAYVTGACYDINGG-----
3edmA           SE--------------------DVAGLVAFLASDDAAYVTGACYDINGG-----
1geeA           ------------------------------------------------------
1gcoA           ------------------------------------------------------
3imfC           -----RAKRTIQSPLGRLGTPEEIAGLAYYLCSDEAAYING-------------
1zbqA           ----------------EALKPEYVAPLVLWLCHES-------------------
1uayA           -PEKAKASLAAQVPPPRLGRPEEYAALVLHILE--NPMLNGEVVRLDGALRMA-
3edmD           ------------------------------------------------------
3edmC           ------------------------------------------------------
2c7vB           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2c7vA           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3ijrH           -DEKKVSQFGSNVPQRP-GQPYELAPAYVYLASSDSSYVTGQ-IHVNGGVIVNG
3ijrF           -DEKKVSQFGSNVPQRP-GQPYELAPAYVYLASSDSSYVTGQ-IHVNGGVIVNG
3ijrE           -DEKKVSQFGSNVPQRP-GQPYELAPAYVYLASSDSSYVTGQ-IHVNGGVIVNG
3ijrB           -DEKKVSQFGSNVPQRP-GQPYELAPAYVYLASSDSSYVTGQ-IHVNGGVIVNG
3ijrA           -DEKKVSQFGSNVPQRP-GQPYELAPAYVYLASSDSSYVTGQ-IHVNGGVIVNG
2wd7C           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
1uayB           -PEKAKASLAAQVPPPRLGRPEEYAALVLHILE--NPMLNGEVVRLDGALRMA-
3bmnD           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmeB           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmiB           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2c7vD           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmqA           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmnC           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmeA           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2wd7B           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmoC           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmjD           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2vz0A           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3i3oG           -------PIGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIVNG
3bmoD           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmnA           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmkC           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
1pr9A           SDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG-----
3bmnB           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmqC           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmfD           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmfA           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2vz0B           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3g1tA           ------------------------------------------------------
1spxA           ---STMATMKECVPAGVMGQPQDIAEVIAFLARKTSSYIIGHQLVVDGG-----
3bmoB           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmoA           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmfB           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmdB           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2c7vC           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3d3wA           SDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG-----
3bmeC           KVPLGRREASA----------EQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmfC           DKWRRKVPLG-----RREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
1ybvA           NEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM--
1g0oC           NEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM--
1g0oA           NEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM--
3e03C           --------AACRRP--------EIADAAHAVLTREAAGFHGQ------------
3e03B           --------AACRRP--------EIADAAHAVLTREAAGFHGQ------------
1dohB           NEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM--
1dohA           NEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM--
2bd0A           ------------------------------------------------------
1u7tA           ------------------------------------------------------
1p33D           EDYRRKVPLYQRNSS-----AEEVSDVVIFLCSPKAKYITGTCIKVDGG-----
2o23B           ------------------------------------------------------
1fdvB           ------------------------------------------------------
1xg5C           LHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPA------------------
2o23A           ------------------------------------------------------
1xu9B           PKEECALEI---------------------------------------------
1xu9A           PKEECALEI---------------------------------------------
1xu7D           PKEECALEI---------------------------------------------
1xu7B           PKEECALEI---------------------------------------------
1xu7A           PKEECALEI---------------------------------------------
1so8A           ------------------------------------------------------
2rbeD           PKEECALEI---------------------------------------------
2rbeC           PKEECALEI---------------------------------------------
2rbeB           PKEECALEI---------------------------------------------
2rbeA           PKEECALEI---------------------------------------------
2irwC           PKEECALEI---------------------------------------------
2irwA           PKEECALEI---------------------------------------------
1iolA           ------------------------------------------------------
2iltA           PKEECALEI---------------------------------------------
3hfgA           PKEECALEI---------------------------------------------
3gz4B           ------------------------------------------------------
3gz4A           ------------------------------------------------------
3ey4C           PKEECALEI---------------------------------------------
3ey4A           PKEECALEI---------------------------------------------
3e03A           ------------------------------------------------------
3d5qB           PKEECALEI---------------------------------------------
3d4nB           PKEECALEI---------------------------------------------
3ch6E           PKEECALEI---------------------------------------------
3ch6D           PKEECALEI---------------------------------------------
3ch6B           PKEECALEI---------------------------------------------
3ch6A           PKEECALEI---------------------------------------------
3bzuB           PKEECALEI---------------------------------------------
3bzuA           PKEECALEI---------------------------------------------
3byzA           PKEECALEI---------------------------------------------
2belD           PKEECALEI---------------------------------------------
2belB           PKEECALEI---------------------------------------------
2belA           PKEECALEI---------------------------------------------
2yw9B           YDRVAQTA-----PLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG
1qyxA           ------------------------------------------------------
1qyvA           ------------------------------------------------------
1fduD           ------------------------------------------------------
1fduA           ------------------------------------------------------
1p33C           EDYRRKVPLYQRNSS-----AEEVSDVVIFLCSPKAKYITGTCIKVDGG-----
1p33B           EDYRRKVPLYQRNSS-----AEEVSDVVIFLCSPKAKYITGTCIKVDGG-----
1jtvA           ------------------------------------------------------
1fdwA           ------------------------------------------------------
1fduC           ------------------------------------------------------
1fduB           ------------------------------------------------------
1fdsA           ------------------------------------------------------
3deyX           ------------------------------------------------------
3bzuD           PKEECALEI---------------------------------------------
1bhsA           ------------------------------------------------------
1a27A           ------------------------------------------------------
1p33A           EDYRRKVPLYQRNSS-----AEEVSDVVIFLCSPKAKYITGTCIKVDGG-----
1e6wC           LGDPAEVQMVIENP----------------------------------------
1ydeP           IREGMLAQ-----PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG-----
1ydeM           IREGMLAQ-----PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG-----
1ydeI           IREGMLAQ-----PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG-----
1ydeH           IREGMLAQ-----PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG-----
1ydeG           IREGMLAQ-----PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG-----
1ydeF           IREGMLAQ-----PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG-----
1ydeD           IREGMLAQ-----PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG-----
1ydeA           IREGMLAQ-----PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG-----
3f5qB           ------------------------------------------------------
3f5qA           ------------------------------------------------------
3f1lB           ------------------------------------------------------
3f1lA           ------------------------------------------------------
3d3eB           EE----------------------------------------------------
3d3eA           EE----------------------------------------------------
1w73A           FEKEI-----GRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGE----
3gy0A           ------------------------------------------------------
3f5sB           ------------------------------------------------------
3f5sA           ------------------------------------------------------
1w0cC           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
3hfgB           KEECA-------------------------------------------------
3d4nD           KEECA-------------------------------------------------
1xq1A           --------------------PEEVSSLVAFLCMPAASYITGQTICVDGGLTVNG
1w73C           FEKEI-----GRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGE----
3d4nC           EE----------------------------------------------------
3czrA           KEECA-------------------------------------------------
1h5qA           MDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLI--
1gz6A           RTETVPEDLV------EALKPEYVAPLVLWLCHES-------------------
3gegA           -------------PAGKVGTPKDISNMVLFLCQ--QDFITGETIIVDGG-----
1e6wA           LGDPAEVQMVIENP----------------------------------------
1e3wA           LGDPAEVQMVIENP----------------------------------------
2dknA           YGESTRRFVA---PLGRGSEPREVAEAIAFLLGPQASFIHGSVLFVDGG-----
1xu9C           QEESLWTTLLIRNPSRKIL-----------------------------------
3hfgC           QEESLWTTLLIRNPSRKIL-----------------------------------
1g0nB           ADEYAAVQW---SPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM--
1e6wD           ------------------------------------------------------
1e6wB           ------------------------------------------------------
1uluB           DR------VAQTAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAG-----
3d4nA           KEECA-------------------------------------------------
2yw9A           -------------PLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG
1xg5A           ---QFAFKLHDKDPEKECLKPEDVAEAVIYVLSTPA------------------
1e3sA           ------------------------------------------------------
2bf7B           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
3hfgD           QEESLWTTLLIRNPSRKIL-----------------------------------
3gedB           -------------PAGKVGTPKDISNMVLFLCQ--QDFITGETIIVDGG-----
3gedA           -------------PAGKVGTPKDISNMVLFLCQ--QDFITGETIIVDGG-----
3frjA           MQAAPKEECALEIIKGGALRQEEVYDSSLW------------------------
1e92B           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
1e7wA           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
3d5qA           QEESLWTTLLIRNPSRKIL-----------------------------------
3bzuC           QEESLWTTLLIRNPSRKIL-----------------------------------
2bfmC           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2yw9D           -------------PLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG
1xu9D           QEESLWTTLLIRNPSRKIL-----------------------------------
2qhxA           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
3d5qD           QEESLWTTLLIRNPSRKIL-----------------------------------
3d5qC           QEESLWTTLLIRNPSRKIL-----------------------------------
2bf7C           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2belC           ------------------------------------------------------
1xg5B           ------------------------------------------------------
1w0cA           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2a4kB           ---QAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGG-----
2yw9H           -------------PLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG
1ydeN           PRASIREGMLAQ-PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG-----
1ydeB           PRASIREGMLAQ-PLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG-----
1e92D           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2bfpB           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2bfaA           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2bf7A           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
1bdbA           ------------------------------------------------------
1w0cF           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
1gz6C           ----------------EALKPEYVAPLVLWLCHES-------------------
1e92C           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
3dijA           -------------PAGKVGTPKDISNMVLFLCQ--QDFITGETIIVDGG-----
2bfpD           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2bfmB           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2bfaB           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
1w73D           ----------GRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGE----
1w0cE           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
1w0cB           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2p8kB           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
3ctmA           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
2bfoA           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2yw9C           -------------PLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG
1w0cH           DSSAA-----------------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2p8kG           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2p8kD           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2p8kA           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
1gz6B           ------------------------------------------------------
1e92A           S----KVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2yw9E           -------------PLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG
1w0cG           EGHRSKVPLYQRDSSAA-----EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2qhxC           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
1e7wB           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2bfoC           DSSAA-----------------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
1uluA           --------VAQTAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAG-----
2p8kC           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
3diiA           -------------PAGKVGTPKDISNMVLFLCQ--QDFITGETIIVDGG-----
2yw9F           -------RVAQTAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG
1w73B           ---PIKEKEIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGE----
2qhxD           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
1uluC           -------------PLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAG-----
1y5mA           PKEECALEI---------------------------------------------
1uluD           VAQTA--------PLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAG-----
2p8kH           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
3ctmE           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
2bfaC           -PLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
2bf7D           -PLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
3ctmG           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
2bfaD           VPLYQRDSSAA-----------EVSDVVIFLCSSKAKYITGTCVKVDGG-----
3ctmC           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
1hxhA           -------EMVLHDPKGRAYMPERIAQLVLFLASDESSVMSG-------------
2fwmX           -------------------RPQEIANTILFLASDLASHITLQDIVVDGGSTL--
1pwxA           TNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGG-----
1zmoA           NNPELRERVDRDVPLGRLGRPDEMGALITFLASRRAAPIVGQFFAFTGG-----
1mxfA           ------------------------------------------------------
1a4uA           ------------------------------------------------------
2qq5A           ------------------------------------------------------
2dknB           GSE-----------------PREVAEAIAFLLGPQASFIHGSVLFVDGG-----
1mxhA           ------------------------------------------------------
3ctmF           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
3ctmD           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
3ctmB           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
1fk8A           -------------PMGRRAEPSEMASVIAFLMSPAASYVHGAQIVIDGG-----
1mg5A           ------------------------------------------------------
3ctmH           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
3guyH           ------------------------------------------------------
3guyG           ------------------------------------------------------
3guyD           ------------------------------------------------------
3guyC           ------------------------------------------------------
3guyB           ------------------------------------------------------
2p91A           MEHTTKV-----NPFGKPITIEDVGDTAVFLCSDWARAITGEVVHVDNGYHIMG
3guyA           ------------------------------------------------------
1z6zE           QELKAKGKL---------------------------------------------
1z6zD           QELKAKGKL---------------------------------------------
1z6zB           QELKAKGKL---------------------------------------------
1z6zA           QELKAKGKL---------------------------------------------
1qsgG           DFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGG-----
1qsgA           DFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGG-----
1qg6A           DFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGG-----
1c14A           DFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGG-----
3e9nA           ------------------------------------------------------
2fhsB           --RKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGG-----
1lxcA           -------------PIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGG-----
2p91B           --HLLMEHTTKVNPFGKPITIEDVGDTAVFLCSDWARAITGEVVHVDNGYHIMG
1i30A           TFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGG-----
1dfiA           ------AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGG-----
2jjyB           ------------SPLK