[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF09298.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "2ywfA.bssp"
#ERROR : Can't open dsspfile "2ywhA.bssp"
#ERROR : Can't open dsspfile "2yweA.bssp"
#ERROR : Can't open dsspfile "2ywgA.bssp"
#ERROR : Can't open dsspfile "2e1rA.bssp"
#ERROR : Can't open dsspfile "1zm4A.bssp"
#ERROR : Can't open dsspfile "1u2rA.bssp"
#ERROR : Can't open dsspfile "2p8xT.bssp"
#ERROR : Can't open dsspfile "2p8wT.bssp"
#ERROR : Can't open dsspfile "2npfA.bssp"
#ERROR : Can't open dsspfile "1n0uA.bssp"
#ERROR : Can't open dsspfile "1n0vC.bssp"
#ERROR : Can't open dsspfile "2bv3A.bssp"
#ERROR : Can't open dsspfile "2npfB.bssp"
#ERROR : Can't open dsspfile "2bm0A.bssp"
#ERROR : Can't open dsspfile "2bm1A.bssp"
#ERROR : Can't open dsspfile "2j7kA.bssp"
#ERROR : Can't open dsspfile "1darA.bssp"
#ERROR : Can't open dsspfile "2efgA.bssp"
#ERROR : Can't open dsspfile "2om7L.bssp"
#ERROR : Can't open dsspfile "1fnmA.bssp"
#ERROR : Can't open dsspfile "1eloA.bssp"
#ERROR : Can't open dsspfile "1wb1C.bssp"
#ERROR : Can't open dsspfile "1ijeA.bssp"
#ERROR : Can't open dsspfile "1g7cA.bssp"
#ERROR : Can't open dsspfile "1f60A.bssp"
#ERROR : Can't open dsspfile "2b7cA.bssp"
#ERROR : Can't open dsspfile "1zo1I.bssp"
#ERROR : Can't open dsspfile "2h5eA.bssp"
#ERROR : Can't open dsspfile "1wb3B.bssp"
#ERROR : Can't open dsspfile "1wb1B.bssp"
#ERROR : Can't open dsspfile "2h5eB.bssp"
#ERROR : Can't open dsspfile "1wb2A.bssp"
#ERROR : Can't open dsspfile "1wb1A.bssp"
#ERROR : Can't open dsspfile "1skqA.bssp"
#ERROR : Can't open dsspfile "1jnyA.bssp"
#ERROR : Can't open dsspfile "1wb3A.bssp"
#ERROR : Can't open dsspfile "1jnyB.bssp"
#ERROR : Can't open dsspfile "2dcuA.bssp"
#ERROR : Can't open dsspfile "1kk3A.bssp"
#ERROR : Can't open dsspfile "1kk2A.bssp"
#ERROR : Can't open dsspfile "1kk1A.bssp"
#ERROR : Can't open dsspfile "1kjzA.bssp"
#ERROR : Can't open dsspfile "1tuiA.bssp"
#ERROR : Can't open dsspfile "1ob5A.bssp"
#ERROR : Can't open dsspfile "1exmA.bssp"
#ERROR : Can't open dsspfile "1eftA.bssp"
#ERROR : Can't open dsspfile "2c78A.bssp"
#ERROR : Can't open dsspfile "2c77A.bssp"
#ERROR : Can't open dsspfile "1b23P.bssp"
#ERROR : Can't open dsspfile "2d74A.bssp"
#ERROR : Can't open dsspfile "1d2eA.bssp"
#ERROR : Can't open dsspfile "1mj1A.bssp"
#ERROR : Can't open dsspfile "1ha3A.bssp"
#ERROR : Can't open dsspfile "1zunB.bssp"
#ERROR : Can't open dsspfile "1kk0A.bssp"
#ERROR : Can't open dsspfile "1ob2A.bssp"
#ERROR : Can't open dsspfile "2fx3A.bssp"
#ERROR : Can't open dsspfile "3fihZ.bssp"
#ERROR : Can't open dsspfile "1efcA.bssp"
#ERROR : Can't open dsspfile "1dg1G.bssp"
#ERROR : Can't open dsspfile "1d8tB.bssp"
#ERROR : Can't open dsspfile "1d8tA.bssp"
#ERROR : Can't open dsspfile "2dy1A.bssp"
#ERROR : Can't open dsspfile "1g7tA.bssp"
#ERROR : Can't open dsspfile "1g7sA.bssp"
#ERROR : Can't open dsspfile "1s0uA.bssp"
#ERROR : Can't open dsspfile "1ha3B.bssp"
#ERROR : Can't open dsspfile "3ficZ.bssp"
#ERROR : Can't open dsspfile "1aipE.bssp"
#ERROR : Can't open dsspfile "1aipA.bssp"
#ERROR : Can't open dsspfile "2qn6A.bssp"
#ERROR : Can't open dsspfile "2plfA.bssp"
#ERROR : Can't open dsspfile "2ahoA.bssp"
#ERROR : Can't open dsspfile "1wb1D.bssp"
#ERROR : Can't open dsspfile "3cw2B.bssp"
#ERROR : Can't open dsspfile "2bvnA.bssp"
#ERROR : Can't open dsspfile "1u0lA.bssp"
#ERROR : Can't open dsspfile "3gftA.bssp"
#ERROR : Can't open dsspfile "2bvnB.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "621pA.bssp"
#ERROR : Can't open dsspfile "3doeA.bssp"
#ERROR : Can't open dsspfile "2j0vA.bssp"
#ERROR : Can't open dsspfile "2hdnB.bssp"
#ERROR : Can't open dsspfile "1etuA.bssp"
#ERROR : Can't open dsspfile "1efuA.bssp"
#ERROR : Can't open dsspfile "2pmxA.bssp"
#ERROR : Can't open dsspfile "1ksgA.bssp"
#ERROR : Can't open dsspfile "2j0vB.bssp"

## Summary of PDB Search
:597
      0.0  65%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA
      0.0  64%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA
    e-147  50%  2ywfA  [x.x.x] GTP-BINDING PROTEIN LEPA
    e-145  49%  2ywhA  [x.x.x] GTP-BINDING PROTEIN LEPA
    e-142  49%  2yweA  [x.x.x] GTP-BINDING PROTEIN LEPA
    e-133  51%  2ywgA  [x.x.x] GTP-BINDING PROTEIN LEPA
    1e-23  43%  2e1rA  [x.x.x] ELONGATION FACTOR 2
    5e-22  39%  1zm4A  [x.x.x] ELONGATION FACTOR 2
    5e-22  39%  1u2rA  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    5e-22  39%  2p8xT  [x.x.x] ELONGATION FACTOR 2
    5e-22  39%  2p8wT  [x.x.x] ELONGATION FACTOR 2
    5e-22  39%  2npfA  [x.x.x] ELONGATION FACTOR 2
    5e-22  39%  1n0uA  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    6e-22  41%  1n0vC  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    1e-18  34%  2bv3A  [x.x.x] ELONGATION FACTOR G
    3e-17  38%  2npfB  [x.x.x] ELONGATION FACTOR 2
    2e-16  33%  2bm0A  [x.x.x] ELONGATION FACTOR G
    5e-16  34%  2bm1A  [x.x.x] ELONGATION FACTOR G
    8e-16  34%  2j7kA  [x.x.x] ELONGATION FACTOR G
    8e-16  38%  1darA  [x.x.x] ELONGATION FACTOR G
    1e-15  38%  2efgA  [c.37.1 - b.43.3 - d.14.1 - d.58.11] PROTEIN (ELONGATION
    2e-15  34%  2om7L  [x.x.x] ELONGATION FACTOR G
    2e-15  32%  1fnmA  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    2e-15  34%  1eloA  [c.37.1 - b.43.3 - d.14.1 - d.58.11 (1ktvA)] ELONGATION
    8e-14  30%  1wb1C  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    1e-13  37%  1ijeA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    1e-13  37%  1g7cA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    1e-13  37%  1f60A  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR EEF1A
    1e-13  37%  2b7cA  [x.x.x] ELONGATION FACTOR 1-ALPHA
    4e-13  29%  1zo1I  [x.x.x] TRANSLATION INITIATION FACTOR 2
    1e-12  33%  2h5eA  [x.x.x] PEPTIDE CHAIN RELEASE FACTOR RF-3
    1e-12  32%  1wb3B  [c.37.1 - b.43.3 - b.44.1] TRANSLATION ELONGATION FACTOR SELB
    1e-12  31%  1wb1B  [c.37.1 - b.43.3 - b.44.1] TRANSLATION ELONGATION FACTOR SELB
    1e-12  34%  2h5eB  [x.x.x] PEPTIDE CHAIN RELEASE FACTOR RF-3
    6e-11  31%  1wb2A  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    1e-10  31%  1wb1A  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    1e-10  27%  1skqA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    1e-10  27%  1jnyA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    2e-10  31%  1wb3A  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    2e-10  30%  1jnyB  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    2e-10  30%  2dcuA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    4e-10  31%  1kk3A  [c.37.1 - b.43.3 - b.44.1] EIF2GAMMA
    4e-10  31%  1kk2A  [c.37.1 - b.43.3 - b.44.1] EIF2GAMMA
    4e-10  31%  1kk1A  [c.37.1 - b.43.3 - b.44.1] EIF2GAMMA
    9e-10  30%  1kjzA  [c.37.1 - b.43.3 - b.44.1] EIF2GAMMA
    2e-09  33%  1tuiA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    2e-09  33%  1ob5A  [x.x.x] ELONGATION FACTOR TU
    2e-09  33%  1exmA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU (EF-TU)
    2e-09  33%  1eftA  [x.x.x] ELONGATION FACTOR TU
    2e-09  33%  2c78A  [x.x.x] ELONGATION FACTOR TU-A
    2e-09  33%  2c77A  [x.x.x] ELONGATION FACTOR TU-B
    2e-09  33%  1b23P  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    3e-09  24%  2d74A  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    3e-09  34%  1d2eA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU (EF-TU)
    2e-08  30%  1mj1A  [i.1.1] ELONGATION FACTOR TU
    6e-08  31%  1ha3A  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    1e-07  30%  1zunB  [x.x.x] SULFATE ADENYLATE TRANSFERASE, SUBUNIT
    4e-07  33%  1kk0A  [c.37.1 - b.43.3 - b.44.1] EIF2GAMMA
    7e-07  30%  1ob2A  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    7e-07  30%  2fx3A  [x.x.x] ELONGATION FACTOR TU
    7e-07  30%  3fihZ  [x.x.x] ELONGATION FACTOR TU
    7e-07  30%  1efcA  [c.37.1 - b.43.3 - b.44.1] PROTEIN (ELONGATION FACTOR)
    7e-07  30%  1dg1G  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    7e-07  30%  1d8tB  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    7e-07  30%  1d8tA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    9e-07  25%  2dy1A  [x.x.x] ELONGATION FACTOR G
    1e-06  33%  1g7tA  [c.37.1 - b.43.3 - c.20.1 - b.43.3] TRANSLATION INITIATION
    1e-06  33%  1g7sA  [c.37.1 - b.43.3 - c.20.1 - b.43.3] TRANSLATION INITIATION
    2e-06  27%  1s0uA  [c.37.1 - b.43.3 - b.44.1] TRANSLATION INITIATION FACTOR 2
    2e-06  34%  1ha3B  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    2e-06  34%  3ficZ  [x.x.x] ELONGATION FACTOR TU-A
    2e-06  34%  1aipE  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    2e-06  34%  1aipA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    3e-06  23%  2qn6A  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    8e-06  27%  2plfA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    8e-06  24%  2ahoA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    1e-05  30%  1wb1D  [c.37.1 - b.43.3 - b.44.1] TRANSLATION ELONGATION FACTOR SELB
    1e-05  23%  3cw2B  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT GAMMA
    1e-05  35%  2bvnA  [x.x.x] ELONGATION FACTOR TU
    7e-05  34%  1u0lA  [b.40.4 - c.37.1] PROBABLE GTPASE ENGC
    9e-05  30%  3gftA  [x.x.x] GTPASE KRAS
    1e-04  33%  2bvnB  [x.x.x] ELONGATION FACTOR TU
    3e-04  29%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-04  30%  621pA  [x.x.x] H-RAS P21 PROTEIN
    4e-04  26%  3doeA  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 2
    6e-04  38%  2j0vA  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC7
    6e-04  33%  2hdnB  [x.x.x] ELONGATION FACTOR EF-TU
    6e-04  33%  1etuA  [x.x.x] ELONGATION FACTOR TU
    6e-04  33%  1efuA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    7e-04  29%  2pmxA  [x.x.x] K-RAS
    7e-04  27%  1ksgA  [c.37.1] ARF-LIKE PROTEIN 2
    0.001  33%  2j0vB  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC7
:597

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDHIRNFSIIAHIDHGKSTLADRIIQRCGGLSDREMEAQVLDSMDIEKERGITIKAQTAALSYKARDGQV
3degC           MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMDLERERGITIKAQSVTLDYKASDGET
3cb4D           MKNIRNFSIIAHI----STLSDRIIQICGG--------------------------QSVTLDYKASDGET
2ywfA           --NVRNFCIIAHVDHGKSTLADRLLEYTGAI-------------------GITVKMQAVRMFYKAKDGNT
2ywhA           --NVRNFCIIAHVDHGKSTLADRLLEYTGA-----------------------VKMQAVRMFYKAKDGNT
2yweA           --NVRNFCIIAH--HGKSTLADRLLEYTGA-----------------------VKMQAVRMFYKAKDGNT
2ywgA           --NVRNFCIIAHVDHGKSTLADRLLEYTGAVKQ-------------------------AVRFYKAKDGNT
2e1rA           --NVRNMSVIAHVDHGKSTLTDSLVQRAGIIS-------------AAKERGITIKSTAISLYSEMSDGNS
1zm4A           --NVRNMSVIAHVDHGKSTLTDSLVQRAGGITIKSTAISLYSEMSDEDVKEIKQKT----------DGNS
1u2rA           --NVRNMSVIAHVDHGKSTLTDSLVQRAGGITIKSTAISLYSEMSDEDVKEIKQKT----------DGNS
2p8xT           --NVRNMSVIAHVDHGKSTLTDSLVQRAGGITIKSTAISLYSEMSDEDVKEIKQKT----------DGNS
2p8wT           --NVRNMSVIAHVDHGKSTLTDSLVQRAGGITIKSTAISLYSEMSDEDVKEIKQKT----------DGNS
2npfA           --NVRNMSVIAHVDHGKSTLTDSLVQRAGGITIKSTAISLYSEMSDEDVKEIKQKT----------DGNS
1n0uA           --NVRNMSVIAHVDHGKSTLTDSLVQRAGGITIKSTAISLYSEMSDEDVKEIKQKT----------DGNS
1n0vC           --NVRNMSVIAHVDHGKSTLTDSLVQRAGIIS---------------AAKGITIKSTAISLYSEMSDGNS
2bv3A           LKRLRNIGIAAHIDAGKTTTTERILYYTGRIH----------------KRGITITAAVTTCFWKD-----
2npfB           --NVRNMSVIAHVDHGKSTLTDSLVQRAGGITIKSTAISLYSEMSDEDVKEIKQKT----------DGNS
2bm0A           LKRLRNIGIAAHIDAGKTTTTERILYYTGRI-----------------HKIATITAAVTTCFWKD-----
2bm1A           LKRLRNIVIAAHIDAGKTTTTERILYYTGRI----------------------ITAAVTTCFWKD-----
2j7kA           LKRLRNIGIAAHIDAGKTTTTERILYYTGR---------------------IHITAAVTTCFWKD-----
1darA           LKRLRNIGIAAHIDAGKTTTTERILYYTG-------------------------RAAVTTCFWKD-----
2efgA           LKRLRNIGIAAHIDAGKTTTTERILYYTGRIA--------------------------AVTTCFWKD---
2om7L           LKRLRNIGIAAHIDAGKTTTTERILYYTGRI---------------------------AVTTCFWKD---
1fnmA           LKRLRNIGIAAHIDAGKTTTTERILYYTGRI---------------------------AVTTCFWKD---
1eloA           LKRLRNIGIAAHIDAGKTTTTERILYYTGRI---------------------------AVTTCFWKD---
1wb1C           -----NLGIFGHIDHGKTTLS-KVLTEIASTSAH-------DKLPESQKRGITID-----IGFSAFKLEN
1ijeA           -----NVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEAWVLDKLKAERERGITID-----IALWKFETPK
1g7cA           -----NVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEAWVLDKLKAERERGITID-----IALWKFETPK
1f60A           -----NVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEAWVLDKLKAERERGITID-----IALWKFETPK
2b7cA           -----NVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEAWVLDKLKAERERGITID-----IALWKFETPK
1zo1I           -------TIMGHVDHGKTSLLEYIRSTKVASGEAGGITQHIGAYHVETENGM------------------
2h5eA           ----RTFAIISHPDAGKTTITEKVL--------------------------LFGQITTSVMQFPYHDCLV
1wb3B           -----NLGIFGHIDHGKTTLSKV-------LTEIAPESQ---------KRGITID-----IGFSAFKLEN
1wb1B           -----NLGIFGHIDHGKTTLSKVLTEIASPESQK---------------RGITID-----IGFSAFKLEN
2h5eB           ----RTFAIISHPDAGKTTITEKVL---------------------------LFGQTTSVMQFPYHDCLV
1wb2A           -----NLGIFGHIDHGKTTLSKVLTEIASGFSAFKLEN--------------------------------
1wb1A           -----NLGIFGHIDHGKTTLS-KVLTEIAGFSAFKLEN--------------------------------
1skqA           -----NLIVIGHVDHGKSTLVGRLLMDRGFI-DXXXXXXXXXXXXXXXXXXXXFAFLLDRLKEEMRETKK
1jnyA           -----NLIVIGHVDHGKSTLVGRLLMDRGFI-DXXXXXXXXXXXXXXXXXXXXFAFLLDRLKEEMRETKK
1wb3A           -----NLGIFGHIDHGKTTLSKVLTEIAIGFSAFKLEN--------------------------------
1jnyB           -----NLIVIGHVDHGKSTLVGRLLMDRGFIDXXXXXAFLLDRMRFETKK--------------------
2dcuA           -----NIGMVGHVDHGKTTLTKAL---TGVWTDTHSE---------ELRRGITIKSTSPICPYCGHETEI
1kk3A           -----NIGMVGHVDHGKTTLTKAL---TGVWTDSE-----------ELRRGITIKSTSPVCPYCGHETEV
1kk2A           -----NIGMVGHVDHGKTTLTKAL---TGVWTDSE-----------ELRRGITIKSTSPVCPYCGHETEV
1kk1A           -----NIGMVGHVDHGKTTLTKAL---TGVWTDSE-----------ELRRGITIKSTSPVCPYCGHETEV
1kjzA           -----NIGMVGHVDHGKTTLTKAL---TGVWTDHSEELR----------RGITIKSTSPVCPYCGHETEV
1tuiA           -----NVGTIGHVDHGKXXXXXXXXXXXXX---ENPNVEVKDYGDIDKARGITIN--TAHVEYETAKRHY
1ob5A           -----NVGTIGHVDHGKXXXXXXXXXXXXX---ENPNVEVKDYGDIDKARGITIN--TAHVEYETAKRHY
1exmA           -----NVGTIGHVDHGKXXXXXXXXXXXXX---ENPNVEVKDYGDIDKARGITIN--TAHVEYETAKRHY
1eftA           -----NVGTIGHVDHGKXXXXXXXXXXXXX---ENPNVEVKDYGDIDKARGITIN--TAHVEYETAKRHY
2c78A           -----NVGTIGHVDHGKXXXXXXXXXXXXX---ENPNVEVKDYGDIDKARGITIN--TAHVEYETAKRHY
2c77A           -----NVGTIGHVDHGKXXXXXXXXXXXXX---ENPNVEVKDYGDIDKARGITIN--TAHVEYETAKRHY
1b23P           -----NVGTIGHVDHGKXXXXXXXXXXXXX---ENPNVEVKDYGDIDKARGITIN--TAHVEYETAKRHY
2d74A           -----NIGMVGHVDHGKTTLTKALTGVWTDTLRRGITIKIFADAEIRRCSNCGRYSTSPICPYCGHETEI
1d2eA           -----NVGTIGHVDHGXXXXXXXXXXXXGGAKFKKYEE--IDNAPEERARGITINAAHVEYSTAAR----
1mj1A           -----NVGTIGHVDHGKXXXXXXXXXXXXX-ENRNVEVKDYGDIDKARERGITIN--TAHVEYETAKRHY
1ha3A           -----NVGTIGHVDHGKXXXXXXXXXXXXX---ENPNVEVKDYGDIDKTAHV--EYETAKRHYSH-----
1zunB           ------FLTCGNVDDGKSTLIGRLLH----------DSKIGDDLALLVDG---LQAITIDVAYRYFSTAK
1kk0A           ---------VGHVDHGKTTLTKAL---TGVWTDHSEELR----------RGITIKSTSPVCPYCGHETEV
1ob2A           -----NVGTIGHVDHGXXXXXXXXXXXXXXXYGGAARADQIDNAPEEKARGITINT-----SHVEYDTPT
2fx3A           -----NVGTIGHVDHGXXXXXXXXXXXXXXXYGGAARADQIDNAPEEKARGITINT-----SHVEYDTPT
3fihZ           -----NVGTIGHVDHGXXXXXXXXXXXXXXXYGGAARADQIDNAPEEKARGITINT-----SHVEYDTPT
1efcA           -----NVGTIGHVDHGXXXXXXXXXXXXXXXYGGAARADQIDNAPEEKARGITINT-----SHVEYDTPT
1dg1G           -----NVGTIGHVDHGXXXXXXXXXXXXXXXYGGAARADQIDNAPEEKARGITINT-----SHVEYDTPT
1d8tB           -----NVGTIGHVDHGXXXXXXXXXXXXXXXYGGAARADQIDNAPEEKARGITINT-----SHVEYDTPT
1d8tA           -----NVGTIGHVDHGXXXXXXXXXXXXXXXYGGAARADQIDNAPEEKARGITINT-----SHVEYDTPT
2dy1A           ---IRTVALVGHAGSGKTTLTEALLYKTGAKXXXXXXXXXXXXXDYTPEAKLTVRTGVAPLLFRG-----
1g7tA           -------SVLGHVDHGKTTLLDRITQHIGAT---EIPMDVIEGICGDFLKKFSIRETLPGLFF-------
1g7sA           -------SVLGHVDHGKTTLLDRITQHIGAT---EIPMDVIEGICGDFLKKFSIRETLPGLFF-------
1s0uA           -----NIGMVGHVDHGKTSLTDRGISIRLGYADCEIRKCPQCGTYTTKPRCPNCLAETEFLR--------
1ha3B           ----------------------------------------------------------------------
3ficZ           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2qn6A           -----NIGVVGHVDHGKTTLV-QAITGIWTLGYAETNIGVCES--CKKPEAYVTEPSCKSCGSDDEPKFL
2plfA           -----NIGVVGHVDHGKTTLVQAIT---GIWTSKHSE---------ELKRGMTIKLGYAETNISCKKPEA
2ahoA           -----NIGVVGHVDHGKTTLVQAIIWTSGKLGYAETNIGVCES--CKKPEAYVTEPSCKSCGSDDEPKFL
1wb1D           -----NLGIFGHIDHGKTTLSKVLTEIASTFSAFKLEN--------------------------------
3cw2B           -----NIGVVGHVDHGKTTLVQAITGIWTSLGYAETNIGVCESC--KKPEAYVTEPSCKSCGSDDEPKFL
2bvnA           ----------------------------------------------EKARGITINT-----SHVEYDTPT
1u0lA           ----------------------------------------------------------------------
3gftA           ------------------------------------------------------------------DGET
2bvnB           -------------------------------------------------RGITINT-----SHVEYDTPT
3a1wA           --------------------------------------------------GVTVEKKEGVFTYKG-----
621pA           ------------------------------------------------------------------DGET
3doeA           ---------------------------------------------------------TLGFNIKTLEHRG
2j0vA           ----------------------------------------------------------------AVDGQI
2hdnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2pmxA           ------------------------------------------------------------------DGET
1ksgA           ---------------------------------------------------------TLGFNIKTLEHRG
2j0vB           ----------------------------------------------------------------AVDGQI


                         .         .         *         .         .         .         .:140
query           YNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAIELGVEVVPVLNKIDLPQADP
3degC           YQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADP
3cb4D           YQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADP
2ywfA           YKLHLIDTPGHVDFSYEVSRALAACEGALLLIDASQGIEAQTVANFWKAVEQDLVIIPVINKIDLPSADV
2ywhA           YKLHLIDTPGHVDFSYEVSRALAACEGALLLIDASQGIEAQTVANFWKAVEQDLVIIPVINKIDLPSADV
2yweA           YKLHLIDTPGHVDFSYEVSRALAACEGALLLIDASQGIEAQTVANFWKAVEQDLVIIPVINKIDLPSADV
2ywgA           YKLHLIDTPGHVDFSYEVSRALAACEGALLLIDASQGIEAQTVANFWKAVEQDLVIIPVINKIDLPSADV
2e1rA           FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVD------
1zm4A           FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVD------
1u2rA           FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVD------
2p8xT           FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVD------
2p8wT           FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVD------
2npfA           FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVD------
1n0uA           FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVD------
1n0vC           FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVD------
2bv3A           HRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADL
2npfB           FLINLID-----DFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVD------
2bm0A           HRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADL
2bm1A           HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADL
2j7kA           HRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADL
1darA           HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADL
2efgA           HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADL
2om7L           HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADL
1fnmA           HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADL
1eloA           HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADL
1wb1C           YRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEE
1ijeA           YQVTVIDAPGHRDFIKNMITGTSQADCAILIIEAGISKDGQTREHALLAFTLGVQLIVAVNKMDSVKWDE
1g7cA           YQVTVIDAPGHRDFIKNMITGTSQADCAILIIEAGISKDGQTREHALLAFTLGVQLIVAVNKMDSVKWDE
1f60A           YQVTVIDAPGHRDFIKNMITGTSQADCAILIIEAGISKDGQTREHALLAFTLGVQLIVAVNKMDSVKWDE
2b7cA           YQVTVIDAPGHRDFIKNMITGTSQADCAILIIEAGISKDGQTREHALLAFTLGVQLIVAVNKMDSVKWDE
1zo1I           --ITFLDTPGHAAFTSMRARGAQATDIVVLVVAADDGVMPQTIEAIQHXXXXXXXXXXXXNKIDKPEADP
2h5eA           ---NLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDP
1wb3B           YRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEE
1wb1B           YRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEE
2h5eB           ---NLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDP
1wb2A           YRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEE
1wb1A           YRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEE
1skqA           YFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKGVEGQTREHIILAKTMGLQLIVAVNKMDLPPYDE
1jnyA           YFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKGVEGQTREHIILAKTMGLQLIVAVNKMDLPPYDE
1wb3A           YRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEE
1jnyB           YFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKGVEGQTREHIILAKTMGLQLIVAVNKMDLPPYDE
2dcuA           RRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIQKNIIIAQNKIELVDKEK
1kk3A           RRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIQKNIIIAQNKIELVDKEK
1kk2A           RRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIQKNIIIAQNKIELVDKEK
1kk1A           RRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIQKNIIIAQNKIELVDKEK
1kjzA           RRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIQKNIIIAQNKIELVDKEK
1tuiA           SH---VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
1ob5A           SH---VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
1exmA           SH---VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
1eftA           SH---VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
2c78A           SH---VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
2c77A           SH---VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
1b23P           SH---VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
2d74A           RRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIQKNIIIAQNKIELVDKEK
1d2eA           -HYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEVVVYVNKADAVQ---
1mj1A           SH---VDCRGHADYIKNMITGAAQMDGAILVVSAADGRMRQTREHILLARQVGVRIVVFMNKVDMVDD--
1ha3A           -----VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
1zunB           RKFIIADTPGHEQYTRNATGA-STCDLAIILVDARYGVQTQTRRHSYIASLLGIKIVVAINK--------
1kk0A           RRVSFIDAPGHEALTTLAGASL---DGAILVIAANEPCRPQTREHLALQIIGQKNIIIAQNKIELVDKEK
1ob2A           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
2fx3A           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
3fihZ           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
1efcA           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
1dg1G           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
1d8tB           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
1d8tA           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
2dy1A           HRVFLLDAPGYGDFVGEIRGXXXXXXXXXXXXXXXXGVQVGTERAWTVAERLGLPRMVVVTKLD------
1g7tA           -----IDTPGHEAFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYRTPFVVAANKID------
1g7sA           -----IDTPGHEAFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYRTPFVVAANKID------
1s0uA           -RVSFVDSPGHETLMATMLSGASLMDGAILVIAANEPCPQPQTKEHLMALELGIDIIIVQNKIDL--VDE
1ha3B           -----VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
3ficZ           -----VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
1aipE           -----VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
1aipA           -----VDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMVD-DP
2qn6A           RRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIGVKLIIVQNKVDVVSKEE
2plfA           YRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIGVKLIIVQNKVDVVSKEE
2ahoA           RRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIGVKLIIVQNKVDVVSKEE
1wb1D           YRITLVD-----DLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEE
3cw2B           RRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIGVKLIIVQNKVDVVSKEE
2bvnA           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
1u0lA           -----------------------------------------------------LETVMVINKMDLYDEDD
3gftA           CLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRDVPMVLVGNKCDLPRTVD
2bvnB           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
3a1wA           YTINLIDLPGTYSLGYS-SIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTDE
621pA           CLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRDVPMVLVGNKCDLARTVE
3doeA           FKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSA---DRQRMQDCQRELQAGATLLIFANKQDLPGALS
2j0vA           VNLGLWDTAGQEDYSRPLS-----YRGADIFVLAFSLISKASYENVLRRFAPNVPIVLVGTKLDLRDADH
2hdnB           -----VDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
1etuA           -----VDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
1efuA           -----VDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK--------
2pmxA           CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRDVPMVLVGNKCDLPRTVD
1ksgA           FKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSA---DRQRMQDCQRELQAGATLLIFANKQDLPGALS
2j0vB           VNLGLWDTAGQEDYSRLRPLSYRGADIFVLAFSLISKASYENVLKKWRRFAPNVPIVLVGTKLDLRDADH


                         +         .         .         .         .         *         .:210
query           ANAIQEIEDVIGIDAQDATPCSAKTGQGVEDVIEALIAKVPPPKGDAAAPLQALIIDSWFDNYXXXXXXX
3degC           ERVAEEIEDIVGIDATDAVRCSAKTGVGVQDVLERLVRXXXXXXXXXXXXLQALIIDSWFDNYLGVVSLI
3cb4D           ERVAEEIEDIVGIDATDAVRCSAKTGVGVQDVLERLVRXXXXXXXXXXXXLQALIIDSWFDNYLGVVSLI
2ywfA           DRVKKQIEEVLGLDPEEAILASAKXXXXXXXXXXXXVNRIPPPKGDPQKPLKALIFDSYYDPYRGAVAFV
2ywhA           DRVKKQIEEVLGLDPEEAILASAKXXXXXXXXXXXXVNRIPPPKGDPQKPLKALIFDSYYDPYRGAVAFV
2yweA           DRVKKQIEEVLGLDPEEAILASAKXXXXXXXXXXXXVNRIPPPKGDPQKPLKALIFDSYYDPYRGAVAFV
2ywgA           DRVKKQIEEVLGLDPEEAILASAKXXXXXXXXXXXXVNRIPPPKGDPQKPLKALIFDSYYDPYRGAVAFV
2e1rA           -RALLELQ----VSKEDLYQTFARTVESVNVIVSTYADEV------------------------------
1zm4A           -RALLELQ----VSKEDLYQTFARTVESVNVIVSTYADEV------------------------------
1u2rA           -RALLELQ----VSKEDLYQTFARTVESVNVIVSTYADEV------------------------------
2p8xT           -RALLELQ----VSKEDLYQTFARTVESVNVIVSTYADEV------------------------------
2p8wT           -RALLELQ----VSKEDLYQTFARTVESVNVIVSTYADEV------------------------------
2npfA           -RALLELQ----VSKEDLYQTFARTVESVNVIVSTYADEV------------------------------
1n0uA           -RALLELQ----VSKEDLYQTFARTVESVNVIVSTYADEV------------------------------
1n0vC           -RALLELQ----VSKEDLYQTFARTVESVNVIVSTYADEV------------------------------
2bv3A           WLVIRTMQERLG-----ARPVVMQLPIGREDTFSGII---------------------------------
2npfB           -RALLELQ----VSKEDLYQTFARTVESVNVIVSTYADEV------------------------------
2bm0A           WLVIRTMQERLG-----ARPVVMQLPIGREDTFSGII---------------------------------
2bm1A           WLVIRTMQERLG-----ARPVVMQLPIGREDTFSGII---------------------------------
2j7kA           WLVIRTMQERLG-----ARPVVMQLPIGREDTFSGII---------------------------------
1darA           WLVIRTMQERLG-----ARPVVMQLPIGREDTFSGII---------------------------------
2efgA           WLVIRTMQERLG-----ARPVVMQLPIGREDTFSGII---------------------------------
2om7L           WLVIRTMQERLG-----ARPVVMQLPIGREDTFSGII---------------------------------
1fnmA           WLVIRTMQERLG-----ARPVVMQLPIGREDTFSGII---------------------------------
1eloA           WLVIRTMQERLG-----ARPVVMQLPIGREDTFSGII---------------------------------
1wb1C           IKRTEMIQSTHNLKNSSIIPISAKTGFGVDELKNLII---------------------------------
1ijeA           SR-FQEI---------------------------------------------------------------
1g7cA           SR-FQEI---------------------------------------------------------------
1f60A           SR-FQEI---------------------------------------------------------------
2b7cA           SR-FQEI---------------------------------------------------------------
1zo1I           DRVKNELSQ-YGILPEEFVHVSAKAGTGIDELLDAILAEVLELKAVRKGMASGAVIESFLDKGRGPVATV
2h5eA           MELLDEVENELKIGCAPIT---------------------------------------------------
1wb3B           IKRTEMIQSTHNLKNSSIIPISAKTGFGVDELKNLII---------------------------------
1wb1B           IKRTEMIQSTHNLKNSSIIPISAKTGFGVDELKNLII---------------------------------
2h5eB           MELLDEVENELKIGCAPIT---------------------------------------------------
1wb2A           IKRTEMIQSTHNLKNSSIIPISAKTGFGVDELKNLII---------------------------------
1wb1A           IKRTEMIQSTHNLKNSSIIPISAKTGFGVDELKNLII---------------------------------
1skqA           KRYKEIVDQVYGFNTNKVVPVVAPSGDNITPTLEEYLDQLELPPKPVDKPLRIPIQDVYSISGVGTVPVG
1jnyA           KRYKEIVDQVYGFNTNKVVPVVAPSGDNITPTLEEYLDQLELPPKPVDKPLRIPIQDVYSISGVGTVPVG
1wb3A           IKRTEMIQSTHNLKNSSIIPISAKTGFGVDELKNLII---------------------------------
1jnyB           KRYKEIVDQVYGFNTNKVVPVVAPSGDNITPTLEEYLDQLELPPKPVDKPLRIPIQDVYSISGVGTVPVG
2dcuA           ANYRQIKEFIKGTVAENAIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSF-----------
1kk3A           ANYRQIKEFIEGTVAENAIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSF-----------
1kk2A           ANYRQIKEFIEGTVAENAIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSF-----------
1kk1A           ANYRQIKEFIEGTVAENAIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSF-----------
1kjzA           ANYRQIKEFIEGTVAENAIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSF-----------
1tuiA           -----ELLDLVEMEVRD-----------------------------------------------------
1ob5A           -----ELLDLVEMEVRD-----------------------------------------------------
1exmA           -----ELLDLVEMEVRD-----------------------------------------------------
1eftA           -----ELLDLVEMEVRD-----------------------------------------------------
2c78A           -----ELLDLVEMEVRD-----------------------------------------------------
2c77A           -----ELLDLVEMEVRD-----------------------------------------------------
1b23P           -----ELLDLVEMEVRD-----------------------------------------------------
2d74A           ANYRQIKEFIKGTVAENAIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSF-----------
1d2eA           ----------------------------------------------------------------------
1mj1A           ----RELLDLVEMEVRD-----------------------------------------------------
1ha3A           -----ELLDLVEMEVRD-----------------------------------------------------
1zunB           ----------------------------------------------------------------------
1kk0A           ANYRQIKEFIEGTVAENAIPISALHGANIDVLVKAIEDFIPTPKRDPNKP--------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
1s0uA           KQAEENYEQIKEFVKGTXXXXXXXXXXXXDVLLKAIQDFIPTPKRDPDA---------------------
1ha3B           -----ELLDLVEMEVRD-----------------------------------------------------
3ficZ           -----ELLDLVEMEVRD-----------------------------------------------------
1aipE           -----ELLDLVEMEVRD-----------------------------------------------------
1aipA           -----ELLDLVEMEVRD-----------------------------------------------------
2qn6A           ARQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSF-----------
2plfA           ARQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSF-----------
2ahoA           ARQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSF-----------
1wb1D           IKRTEMIMKSINLKNSSIIPISAKTGFGVDELKNLII---------------------------------
3cw2B           ARQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSF-----------
2bvnA           ----------------------------------------------------------------------
1u0lA           LRKVRELEEIYS-GLYPIVKTSAKTGMGIEELKEYLKGKISTMAG-------------------------
3gftA           TKQAQDLARSYGIPFIET---SAKTRQGVDDAFYTLVREI------------------------------
2bvnB           ----------------------------------------------------------------------
3a1wA           AKKIDELQKHLGI---PVVFTSSVTGEGLEELKEKIV---------------------------------
621pA           SRQAQDLARSYGIPYIET---SAKTRQGVEDAFYTLVREI------------------------------
3doeA           SNAIREVLELDSIRSHHIQGCSAVTGENLLPGIDWLL---------------------------------
2j0vA           TNVIEELRKQIGAAAY--IECSSKTQQNVKAVFDTAIKVVLQP---------------------------
2hdnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2pmxA           TKQAQDLARSYGIPFIET---SAKTRQGVDDAFYTLVREI------------------------------
1ksgA           CNAIQEALELDSIRSHHIQGCSAVTGEDLLPGIDWLL---------------------------------
2j0vB           TNVIEELRKQIGAAAY--IECSSKTQQNVKAVFDTAIKVVLQP---------------------------


                         .         .         .         +         .         .         .:280
query           XXXNGTLRPKDKVLLMATGAQHLVEQVGVFSPKSIQRDELTAGQVGFVIAGIKELKAAKVGDTITTMTRR
3degC           RIKNGTLRKGDKVKVMSTGQTYNADRLGIFTPKQVDRTELKCGEVGWLVCAIKDIHGAPVGDTLTLARNP
3cb4D           RIKNGTLRKGDKVKVMSTGQTYNADRLGIFTPKQVDRTELKCGEVGWLVCAIKDIHGAPVGDTLTLARNP
2ywfA           RIFDGEVKPGDKIMLMSTGKEYEVTEVGAQTPKMTKFDKLSAGDVGYIAASIKDVRDIRIGDTITHAKNP
2ywhA           RIFDGEVKPGDKIMLMSTGKEYEVTEVGAQTPKMTKFDKLSAGDVGYIAASIKDVRDIRIGDTITHAKNP
2yweA           RIFDGEVKPGDKIMLMSTGKEYEVTEVGAQTPKMTKFDKLSAGDVGYIAASIKDVRDIRIGDTITHAKNP
2ywgA           RIFDGEVKPGDKIL--STGKEYEVTEVGAQTPKT-KFDKLSAGDVGYIAASIKDVRDIRIGDTITHAKNP
2e1rA           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2npfB           ----------------------------------------------------------------------
2bm0A           ----------------------------------------------------------------------
2bm1A           ----------------------------------------------------------------------
2j7kA           ----------------------------------------------------------------------
1darA           ----------------------------------------------------------------------
2efgA           ----------------------------------------------------------------------
2om7L           ----------------------------------------------------------------------
1fnmA           ----------------------------------------------------------------------
1eloA           ----------------------------------------------------------------------
1wb1C           ----------------------------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1zo1I           LVREGTLHKGDIVL--------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
1wb1B           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
1skqA           RVESGVLKVGDKIVFMPAGK---VGEVRSIETHHTKMDKAEPGNIGFNVRGV-EKKDIKRGDVV------
1jnyA           RVESGVLKVGDKIVFMPAGK---VGEVRSIETHHTKMDKAEPGNIGFNVRGV-EKKDIKRGDVV------
1wb3A           ----------------------------------------------------------------------
1jnyB           RVESGVLKVGDKIVFMPAGK---VGEVRSIETHHTKMDKAEPGNIGFNVRGV-EKKDIKRGDVV------
2dcuA           ----------------------------------------------------------------------
1kk3A           ----------------------------------------------------------------------
1kk2A           ----------------------------------------------------------------------
1kk1A           ----------------------------------------------------------------------
1kjzA           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1ha3A           ----------------------------------------------------------------------
1zunB           ----------------------------------------------------------------------
1kk0A           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
1s0uA           ----------------------------------------------------------------------
1ha3B           ----------------------------------------------------------------------
3ficZ           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2qn6A           ----------------------------------------------------------------------
2plfA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1wb1D           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
3gftA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
2j0vA           ----------------------------------------------------------------------
2hdnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2pmxA           ----------------------------------------------------------------------
1ksgA           ----------------------------------------------------------------------
2j0vB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AEAPLPGFKEVKPQVFAGLYPVESNQYEALRESLEKLRLNDASLQFEPEVSQAXXXXXXXXXXXXXHMEI
3degC           AEKALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPESSSAXXXXXXXXXXXXXHMEI
3cb4D           AEKALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPESSSAXXXXXXXXXXXXXHMEI
2ywfA           TKEPVPGFQPAKPMVYAGIYPAEDTTYEELRDALEKYAINDAAIVYEPESSPALGMGFRVGFLGLLHMEI
2ywhA           TKEPVPGFQPAKPMVYAGIYPAEDTTYEELRDALEKYAINDAAIVYEPESSPALGMGFRVGFLGLLHMEI
2yweA           TKEPVPGFQPAKPMVYAGIYPAEDTTYEELRDALEKYAINDAAIVYEPESSPALGMGFRVGFLGLLHMEI
2ywgA           TKEPVPGFQPAKP-VYAGIYPAEDTTYEELRDALEKYAINDAAIVYEPESSPAXXXXXXXXXXXXH--EI
2e1rA           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2npfB           ----------------------------------------------------------------------
2bm0A           ----------------------------------------------------------------------
2bm1A           ----------------------------------------------------------------------
2j7kA           ----------------------------------------------------------------------
1darA           ----------------------------------------------------------------------
2efgA           ----------------------------------------------------------------------
2om7L           ----------------------------------------------------------------------
1fnmA           ------------------------------------------------------------------YIPA
1eloA           ----------------------------------------------------------------------
1wb1C           ----------------------------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1zo1I           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
1wb1B           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
1skqA           ----------------------------------------------------------------------
1jnyA           ----------------------------------------------------------------------
1wb3A           ----------------------------------------------------------------------
1jnyB           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1kk3A           ----------------------------------------------------------------------
1kk2A           ----------------------------------------------------------------------
1kk1A           ----------------------------------------------------------------------
1kjzA           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1ha3A           ----------------------------------------------------------------------
1zunB           ----------------------------------------------------------------------
1kk0A           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
1s0uA           ----------------------------------------------------------------------
1ha3B           ----------------------------------------------------------------------
3ficZ           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2qn6A           ----------------------------------------------------------------------
2plfA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1wb1D           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
3gftA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
2j0vA           ----------------------------------------------------------------------
2hdnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2pmxA           ----------------------------------------------------------------------
1ksgA           ----------------------------------------------------------------------
2j0vB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VQERLEREFDMDLITTAPTVVYQVQQRDGTVLTVENPAKMPDPSKIEAILEPIVTVNLYMPQDYVGSVMT
3degC           IQERLEREYDLDLITTAPTVVYEVETTSREVIYVDSPSKLPAVNNIYELREPIAECHMLLPQAYLGNVIT
3cb4D           IQERLEREYDLDLITTAPTVVYEVETTSREVIYVDSPSKLPAVNNIYELREPIAECHMLLPQAYLGNVIT
2ywfA           VQERLEREYGVKIITTAPNVIYRVKKKTDEVIEVRNPMDFPDAGLIEYVEEPFVLVTIITPKEYVGPIIQ
2ywhA           VQERLEREYGVKIITTAPNVIYRVKKKTDEVIEVRNPMDFPDAGLIEYVEEPFVLVTIITPKEYVGPIIQ
2yweA           VQERLEREYGVKIITTAPNVIYRVKKKTDEVIEVRNPMDFPDAGLIEYVEEPFVLVTIITPKEYVGPIIQ
2ywgA           VQERLEREYGVKIITTAPNVIYRVKKKTDEVIEVRNPDFPDNAGLIEYVEEPFVLVTIITPKEYVGPIIQ
2e1rA           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
2bv3A           -------------------------------MAIKEAVQKGDP----VILEPIMRVEVTTPEEYMGDVIG
2npfB           ----------------------------------------------------------------------
2bm0A           -------------------------------MAIKEAVQKGDP----VILEPIMRVEVTTPEEYMGDVIG
2bm1A           -------------------------------MAIKEAVQKGDP----VILEPIMRVEVTTPEEYMGDVIG
2j7kA           -------------------------------MAIKEAVQKGDP----VILEPIMRVEVTTPEEYMGDVIG
1darA           ----------------------------------------------------------------------
2efgA           ----------------------------------------------------------------------
2om7L           -------------------------------MAIKEAVQKGDP----VILEPIMRVEVTTPEEYMGDVIG
1fnmA           VQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYAEVDSSEKIAGSMAIKVILEPIMRVEVTTPEEYMGDVIG
1eloA           -------------------------------MAIKEAVQKGDP----VILEPIMRVEVTTPEEYMGDVIG
1wb1C           ----------------------------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1zo1I           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
1wb1B           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
1skqA           ----------------------------------------------------------------------
1jnyA           ----------------------------------------------------------------------
1wb3A           ----------------------------------------------------------------------
1jnyB           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1kk3A           ----------------------------------------------------------------------
1kk2A           ----------------------------------------------------------------------
1kk1A           ----------------------------------------------------------------------
1kjzA           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1ha3A           ----------------------------------------------------------------------
1zunB           ----------------------------------------------------------------------
1kk0A           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2dy1A           ------------------------------------------------LLEPIYRLKVLAPQERVGDVLS
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
1s0uA           ----------------------------------------------------------------------
1ha3B           ----------------------------------------------------------------------
3ficZ           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2qn6A           ----------------------------------------------------------------------
2plfA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1wb1D           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
3gftA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
2j0vA           ----------------------------------------------------------------------
2hdnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2pmxA           ----------------------------------------------------------------------
1ksgA           ----------------------------------------------------------------------
2j0vB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LCTQKRGAQINMSYHGKQVQLTYEIPMAEIVMDFFDRLKSVSRGYASMDYEFKEYRQSDVVKVDILINSD
3degC           LCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQASDMVRVDVLINGE
3cb4D           LCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQASDMVRVDVLINGE
2ywfA           LCQEKRGIQKNMTYDPNTVYLEYEMPLSEIIVDFHDKIKSISRGFASYDYEFIGYRPSDLIKLTVLINKK
2ywhA           LCQEKRGIQKNMTYDPNTVYLEYEMPLSEIIVDFHDKIKSISRGFASYDYEFIGYRPSDLIKLTVLINKK
2yweA           LCQEKRGIQKNMTYDPNTVYLEYEMPLSEIIVDFHDKIKSISRGFASYDYEFIGYRPSDLIKLTVLINKK
2ywgA           LCQEKRGIQKNTYLDPNTVYLEYE-PLSEIIVDFHDKIKSISRGFASYDYEFIGYRPSDLIKLTVLINKK
2e1rA           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
2bv3A           DLNARRGQILGMEPRGNAQVIRAFVPLAE-MFGYATDLRSKTQGRGSFVMFFDHYQE-------------
2npfB           ----------------------------------------------------------------------
2bm0A           DLNARRGQILGMEPRGNAQVIRAFVPLAE-MFGYATDLRSKTQGRGSFVMFFDHYQE-------------
2bm1A           DLNARRGQILGMEPRGNAQVIRAFVPLAE-MFGYATDLRSKTQGRGSFVMFFDHYQE-------------
2j7kA           DLNARRGQILGMEPRGNAQVIRAFVPLAE-MFGYATDLRSKTQGRGSFVMFFDHYQE-------------
1darA           ----------------------------------------------------------------------
2efgA           ----------------------------------------------------------------------
2om7L           DLNARRGQILGMEPRGNAQVIRAFVPLAE-MFGYATDLRSKTQGRGSFVMFFDHYQE-------------
1fnmA           DLNARRGQILGMEPRGNAQVIRAFVPLAE-MFGYATDLRSKTQGRGSFVMFFDHYQE-------------
1eloA           DLNARRGQILGMEPRGNAQVIRAFVPLAE-MFGYATDLRSKTQGRGSFVMFFDHYQE-------------
1wb1C           ----------------------------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1zo1I           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
1wb1B           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
1skqA           ----------------------------------------------------------------------
1jnyA           ----------------------------------------------------------------------
1wb3A           ----------------------------------------------------------------------
1jnyB           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1kk3A           ----------------------------------------------------------------------
1kk2A           ----------------------------------------------------------------------
1kk1A           ----------------------------------------------------------------------
1kjzA           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1ha3A           ----------------------------------------------------------------------
1zunB           ----------------------------------------------------------------------
1kk0A           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2dy1A           DLQARRGRILGMEQEGALSVVHAEVPLAE-VLEYYKALPGLTGGAGAYTLEFSHYAE-------------
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
1s0uA           ----------------------------------------------------------------------
1ha3B           ----------------------------------------------------------------------
3ficZ           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2qn6A           ----------------------------------------------------------------------
2plfA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1wb1D           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
3gftA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
2j0vA           ----------------------------------------------------------------------
2hdnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2pmxA           ----------------------------------------------------------------------
1ksgA           ----------------------------------------------------------------------
2j0vB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KVDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARENVKALRKNVLAKCYGxxxxx
3degC           RVDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQL---------------
3cb4D           RVDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYG-----
2ywfA           PVDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLR--------------
2ywhA           PVDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLR--------------
2yweA           PVDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLR--------------
2ywgA           PVDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLR--------------
2e1rA           ----------------------------------------------------------------------
1zm4A           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
2npfB           ----------------------------------------------------------------------
2bm0A           ----------------------------------------------------------------------
2bm1A           ----------------------------------------------------------------------
2j7kA           ----------------------------------------------------------------------
1darA           ----------------------------------------------------------------------
2efgA           ----------------------------------------------------------------------
2om7L           ----------------------------------------------------------------------
1fnmA           ----------------------------------------------------------------------
1eloA           ----------------------------------------------------------------------
1wb1C           ----------------------------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1zo1I           ----------------------------------------------------------------------
2h5eA           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
1wb1B           ----------------------------------------------------------------------
2h5eB           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
1skqA           ----------------------------------------------------------------------
1jnyA           ----------------------------------------------------------------------
1wb3A           ----------------------------------------------------------------------
1jnyB           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
1kk3A           ----------------------------------------------------------------------
1kk2A           ----------------------------------------------------------------------
1kk1A           ----------------------------------------------------------------------
1kjzA           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1ha3A           ----------------------------------------------------------------------
1zunB           ----------------------------------------------------------------------
1kk0A           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
1g7tA           ----------------------------------------------------------------------
1g7sA           ----------------------------------------------------------------------
1s0uA           ----------------------------------------------------------------------
1ha3B           ----------------------------------------------------------------------
3ficZ           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
2qn6A           ----------------------------------------------------------------------
2plfA           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
1wb1D           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1u0lA           ----------------------------------------------------------------------
3gftA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
2j0vA           ----------------------------------------------------------------------
2hdnB           ----------------------------------------------------------------------
1etuA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2pmxA           ----------------------------------------------------------------------
1ksgA           ----------------------------------------------------------------------
2j0vB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3degC           -------------------------------------
3cb4D           -------------------------------------
2ywfA           -------------------------------------
2ywhA           -------------------------------------
2yweA           -------------------------------------
2ywgA           -------------------------------------
2e1rA           -------------------------------------
1zm4A           -------------------------------------
1u2rA           -------------------------------------
2p8xT           -------------------------------------
2p8wT           -------------------------------------
2npfA           -------------------------------------
1n0uA           -------------------------------------
1n0vC           -------------------------------------
2bv3A           -------------------------------------
2npfB           -------------------------------------
2bm0A           -------------------------------------
2bm1A           -------------------------------------
2j7kA           -------------------------------------
1darA           -------------------------------------
2efgA           -------------------------------------
2om7L           -------------------------------------
1fnmA           -------------------------------------
1eloA           -------------------------------------
1wb1C           -------------------------------------
1ijeA           -------------------------------------
1g7cA           -------------------------------------
1f60A           -------------------------------------
2b7cA           -------------------------------------
1zo1I           -------------------------------------
2h5eA           -------------------------------------
1wb3B           -------------------------------------
1wb1B           -------------------------------------
2h5eB           -------------------------------------
1wb2A           -------------------------------------
1wb1A           -------------------------------------
1skqA           -------------------------------------
1jnyA           -------------------------------------
1wb3A           -------------------------------------
1jnyB           -------------------------------------
2dcuA           -------------------------------------
1kk3A           -------------------------------------
1kk2A           -------------------------------------
1kk1A           -------------------------------------
1kjzA           -------------------------------------
1tuiA           -------------------------------------
1ob5A           -------------------------------------
1exmA           -------------------------------------
1eftA           -------------------------------------
2c78A           -------------------------------------
2c77A           -------------------------------------
1b23P           -------------------------------------
2d74A           -------------------------------------
1d2eA           -------------------------------------
1mj1A           -------------------------------------
1ha3A           -------------------------------------
1zunB           -------------------------------------
1kk0A           -------------------------------------
1ob2A           -------------------------------------
2fx3A           -------------------------------------
3fihZ           -------------------------------------
1efcA           -------------------------------------
1dg1G           -------------------------------------
1d8tB           -------------------------------------
1d8tA           -------------------------------------
2dy1A           -------------------------------------
1g7tA           -------------------------------------
1g7sA           -------------------------------------
1s0uA           -------------------------------------
1ha3B           -------------------------------------
3ficZ           -------------------------------------
1aipE           -------------------------------------
1aipA           -------------------------------------
2qn6A           -------------------------------------
2plfA           -------------------------------------
2ahoA           -------------------------------------
1wb1D           -------------------------------------
3cw2B           -------------------------------------
2bvnA           -------------------------------------
1u0lA           -------------------------------------
3gftA           -------------------------------------
2bvnB           -------------------------------------
3a1wA           -------------------------------------
621pA           -------------------------------------
3doeA           -------------------------------------
2j0vA           -------------------------------------
2hdnB           -------------------------------------
1etuA           -------------------------------------
1efuA           -------------------------------------
2pmxA           -------------------------------------
1ksgA           -------------------------------------
2j0vB           -------------------------------------