[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF09441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2i4iA.bssp"
#ERROR : Can't open dsspfile "2db3A.bssp"
#ERROR : Can't open dsspfile "1s2mA.bssp"
#ERROR : Can't open dsspfile "2j0sA.bssp"
#ERROR : Can't open dsspfile "2j0qA.bssp"
#ERROR : Can't open dsspfile "2hyiC.bssp"
#ERROR : Can't open dsspfile "2hxyA.bssp"
#ERROR : Can't open dsspfile "2z0mA.bssp"
#ERROR : Can't open dsspfile "2j0uA.bssp"
#ERROR : Can't open dsspfile "2zu6C.bssp"
#ERROR : Can't open dsspfile "2vsoA.bssp"
#ERROR : Can't open dsspfile "2zu6A.bssp"
#ERROR : Can't open dsspfile "1xtkA.bssp"
#ERROR : Can't open dsspfile "2zu6D.bssp"
#ERROR : Can't open dsspfile "1xtiA.bssp"
#ERROR : Can't open dsspfile "3fhtB.bssp"
#ERROR : Can't open dsspfile "3g0hA.bssp"
#ERROR : Can't open dsspfile "3fhtA.bssp"
#ERROR : Can't open dsspfile "2gxsB.bssp"
#ERROR : Can't open dsspfile "2gxqA.bssp"
#ERROR : Can't open dsspfile "3eiqA.bssp"
#ERROR : Can't open dsspfile "1hv8A.bssp"
#ERROR : Can't open dsspfile "3eiqD.bssp"
#ERROR : Can't open dsspfile "2j0uB.bssp"
#ERROR : Can't open dsspfile "1xtjA.bssp"
#ERROR : Can't open dsspfile "3ewsB.bssp"
#ERROR : Can't open dsspfile "1fuuB.bssp"
#ERROR : Can't open dsspfile "3ewsA.bssp"
#ERROR : Can't open dsspfile "3i5xA.bssp"
#ERROR : Can't open dsspfile "3berA.bssp"
#ERROR : Can't open dsspfile "3fe2A.bssp"
#ERROR : Can't open dsspfile "1wrbA.bssp"
#ERROR : Can't open dsspfile "1wrbB.bssp"
#ERROR : Can't open dsspfile "2zu6F.bssp"
#ERROR : Can't open dsspfile "2pl3A.bssp"
#ERROR : Can't open dsspfile "1vecA.bssp"
#ERROR : Can't open dsspfile "3fhoB.bssp"
#ERROR : Can't open dsspfile "3fhoA.bssp"
#ERROR : Can't open dsspfile "1t6nA.bssp"
#ERROR : Can't open dsspfile "3eaqA.bssp"
#ERROR : Can't open dsspfile "3i32A.bssp"
#ERROR : Can't open dsspfile "2hjvB.bssp"
#ERROR : Can't open dsspfile "2hjvA.bssp"
#ERROR : Can't open dsspfile "2oxcA.bssp"
#ERROR : Can't open dsspfile "1qvaA.bssp"
#ERROR : Can't open dsspfile "1fukA.bssp"
#ERROR : Can't open dsspfile "2kbfA.bssp"
#ERROR : Can't open dsspfile "2waxC.bssp"
#ERROR : Can't open dsspfile "2jgnC.bssp"
#ERROR : Can't open dsspfile "2jgnB.bssp"
#ERROR : Can't open dsspfile "3dkpA.bssp"
#ERROR : Can't open dsspfile "1qdeA.bssp"
#ERROR : Can't open dsspfile "3easA.bssp"
#ERROR : Can't open dsspfile "3earA.bssp"
#ERROR : Can't open dsspfile "3eaqB.bssp"
#ERROR : Can't open dsspfile "3gfpA.bssp"
#ERROR : Can't open dsspfile "1q0uB.bssp"
#ERROR : Can't open dsspfile "2p6nB.bssp"
#ERROR : Can't open dsspfile "2p6nA.bssp"
#ERROR : Can't open dsspfile "3borA.bssp"
#ERROR : Can't open dsspfile "2waxA.bssp"
#ERROR : Can't open dsspfile "1q0uA.bssp"
#ERROR : Can't open dsspfile "2kbeA.bssp"
#ERROR : Can't open dsspfile "3fmpB.bssp"
#ERROR : Can't open dsspfile "3fmoB.bssp"
#ERROR : Can't open dsspfile "3fhcB.bssp"
#ERROR : Can't open dsspfile "2rb4A.bssp"
#ERROR : Can't open dsspfile "2g2jA.bssp"
#ERROR : Can't open dsspfile "2rb4B.bssp"
#ERROR : Can't open dsspfile "2jgnA.bssp"
#ERROR : Can't open dsspfile "2wayA.bssp"
#ERROR : Can't open dsspfile "2wayC.bssp"
#ERROR : Can't open dsspfile "1oyyA.bssp"
#ERROR : Can't open dsspfile "1t5iA.bssp"
#ERROR : Can't open dsspfile "1oywA.bssp"
#ERROR : Can't open dsspfile "2g9nB.bssp"
#ERROR : Can't open dsspfile "1fuuA.bssp"
#ERROR : Can't open dsspfile "2g9nA.bssp"
#ERROR : Can't open dsspfile "2v1xA.bssp"
#ERROR : Can't open dsspfile "1wp9B.bssp"
#ERROR : Can't open dsspfile "1wp9A.bssp"
#ERROR : Can't open dsspfile "1gm5A.bssp"
#ERROR : Can't open dsspfile "1wp9C.bssp"
#ERROR : Can't open dsspfile "1t5lA.bssp"
#ERROR : Can't open dsspfile "1d9zA.bssp"
#ERROR : Can't open dsspfile "1d9xA.bssp"
#ERROR : Can't open dsspfile "2eyqB.bssp"
#ERROR : Can't open dsspfile "2eyqA.bssp"
#ERROR : Can't open dsspfile "1wp9D.bssp"
#ERROR : Can't open dsspfile "2nmvA.bssp"
#ERROR : Can't open dsspfile "2d7dA.bssp"
#ERROR : Can't open dsspfile "1d2mA.bssp"
#ERROR : Can't open dsspfile "1c4oA.bssp"
#ERROR : Can't open dsspfile "2fdcA.bssp"
#ERROR : Can't open dsspfile "2fzlA.bssp"
#ERROR : Can't open dsspfile "2fwrD.bssp"
#ERROR : Can't open dsspfile "2fwrC.bssp"
#ERROR : Can't open dsspfile "2fwrB.bssp"
#ERROR : Can't open dsspfile "2fwrA.bssp"
#ERROR : Can't open dsspfile "2fdcB.bssp"
#ERROR : Can't open dsspfile "2p6rA.bssp"

## Summary of PDB Search
:634
    4e-63  44%  2i4iA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX3X
    7e-63  38%  2db3A  [x.x.x] ATP-DEPENDENT RNA HELICASE VASA
    3e-60  36%  1s2mA  [x.x.x] PUTATIVE ATP-DEPENDENT RNA HELICASE DHH1
    4e-57  34%  2j0sA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX48
    4e-57  34%  2j0qA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX48
    4e-57  34%  2hyiC  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX48
    4e-57  34%  2hxyA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX48
    5e-57  44%  2z0mA  [x.x.x] 337AA LONG HYPOTHETICAL ATP-DEPENDENT RNA
    4e-55  35%  2j0uA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX48
    7e-51  38%  2zu6C  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    2e-49  34%  2vsoA  [x.x.x] ATP-DEPENDENT RNA HELICASE EIF4A
    3e-47  36%  2zu6A  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    6e-46  31%  1xtkA  [c.37.1 - c.37.1] PROBABLE ATP-DEPENDENT RNA HELICASE P47
    2e-45  36%  2zu6D  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    2e-45  31%  1xtiA  [c.37.1 - c.37.1] PROBABLE ATP-DEPENDENT RNA HELICASE P47
    4e-45  35%  3fhtB  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX19B
    1e-44  34%  3g0hA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX19B
    1e-44  34%  3fhtA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX19B
    6e-44  48%  2gxsB  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    6e-44  48%  2gxqA  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    2e-43  34%  3eiqA  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    4e-43  37%  1hv8A  [c.37.1 - c.37.1] PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669
    4e-43  32%  3eiqD  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    9e-43  33%  2j0uB  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX48
    1e-42  31%  1xtjA  [c.37.1 - c.37.1] PROBABLE ATP-DEPENDENT RNA HELICASE P47
    4e-42  34%  3ewsB  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX19B
    3e-41  35%  1fuuB  [c.37.1 - c.37.1] YEAST INITIATION FACTOR 4A
    3e-41  34%  3ewsA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX19B
    3e-39  31%  3i5xA  [x.x.x] ATP-DEPENDENT RNA HELICASE MSS116
    1e-36  40%  3berA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX47
    4e-35  43%  3fe2A  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX5
    1e-34  43%  1wrbA  [x.x.x] DJVLGB
    3e-34  43%  1wrbB  [x.x.x] DJVLGB
    3e-32  41%  2zu6F  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    5e-32  41%  2pl3A  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX10
    2e-28  32%  1vecA  [c.37.1] ATP-DEPENDENT RNA HELICASE P54
    4e-28  34%  3fhoB  [x.x.x] ATP-DEPENDENT RNA HELICASE DBP5
    6e-28  35%  3fhoA  [x.x.x] ATP-DEPENDENT RNA HELICASE DBP5
    2e-27  33%  1t6nA  [c.37.1] PROBABLE ATP-DEPENDENT RNA HELICASE
    5e-27  55%  3eaqA  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    4e-25  52%  3i32A  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    5e-25  45%  2hjvB  [x.x.x] ATP-DEPENDENT RNA HELICASE DBPA
    5e-25  45%  2hjvA  [x.x.x] ATP-DEPENDENT RNA HELICASE DBPA
    8e-25  33%  2oxcA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX20
    3e-24  35%  1qvaA  [c.37.1] INITIATION FACTOR 4A
    3e-24  40%  1fukA  [c.37.1] EUKARYOTIC INITIATION FACTOR 4A
    3e-23  46%  2kbfA  [x.x.x] ATP-DEPENDENT RNA HELICASE DBP5
    3e-23  41%  2waxC  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX6
    4e-23  50%  2jgnC  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX3X
    6e-23  44%  2jgnB  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX3X
    8e-23  39%  3dkpA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX52
    1e-22  35%  1qdeA  [c.37.1] TRANSLATION INITIATION FACTOR 4A
    2e-22  52%  3easA  [x.x.x] HERA
    2e-22  52%  3earA  [x.x.x] HERA
    2e-22  52%  3eaqB  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    4e-22  46%  3gfpA  [x.x.x] DEAD BOX PROTEIN 5
    6e-22  39%  1q0uB  [c.37.1] BSTDEAD
    8e-22  46%  2p6nB  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX41
    8e-22  46%  2p6nA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX41
    1e-21  33%  3borA  [x.x.x] HUMAN INITIATION FACTOR 4A-II
    1e-21  41%  2waxA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX6
    2e-21  39%  1q0uA  [c.37.1] BSTDEAD
    2e-21  31%  2kbeA  [x.x.x] ATP-DEPENDENT RNA HELICASE DBP5
    5e-19  33%  3fmpB  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX19B
    5e-19  33%  3fmoB  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX19B
    5e-19  33%  3fhcB  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX19B
    1e-18  35%  2rb4A  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX25
    1e-18  35%  2g2jA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX25
    3e-18  35%  2rb4B  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX25
    4e-18  42%  2jgnA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX3X
    2e-17  40%  2wayA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX6
    1e-16  41%  2wayC  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX6
    4e-16  31%  1oyyA  [c.37.1 - c.37.1 - a.4.5] ATP-DEPENDENT DNA HELICASE
    1e-15  32%  1t5iA  [c.37.1] C_TERMINAL DOMAIN OF A PROBABLE ATP-DEPENDENT
    2e-15  32%  1oywA  [c.37.1 - c.37.1 - a.4.5] ATP-DEPENDENT DNA HELICASE
    2e-15  35%  2g9nB  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    2e-15  34%  1fuuA  [c.37.1] YEAST INITIATION FACTOR 4A
    6e-15  37%  2g9nA  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    1e-10  26%  2v1xA  [x.x.x] ATP-DEPENDENT DNA HELICASE Q1
    1e-08  35%  1wp9B  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    1e-08  35%  1wp9A  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    2e-08  24%  1gm5A  [a.24.21 - b.40.4 - c.37.1 - c.37.1] RECG
    7e-08  35%  1wp9C  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    9e-08  29%  1t5lA  [c.37.1 - c.37.1] UVRABC SYSTEM PROTEIN B
    9e-08  29%  1d9zA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    9e-08  29%  1d9xA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    2e-07  28%  2eyqB  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    2e-07  28%  2eyqA  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    3e-07  35%  1wp9D  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    3e-07  28%  2nmvA  [x.x.x] UVRABC SYSTEM PROTEIN B
    3e-07  28%  2d7dA  [x.x.x] UVRABC SYSTEM PROTEIN B
    3e-06  30%  1d2mA  [c.37.1 - c.37.1] EXCINUCLEASE ABC SUBUNIT B
    3e-06  30%  1c4oA  [c.37.1 - c.37.1] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB
    4e-06  31%  2fdcA  [x.x.x] UVRABC SYSTEM PROTEIN B
    8e-06  27%  2fzlA  [x.x.x] DNA REPAIR PROTEIN RAD25, XPB
    8e-06  27%  2fwrD  [x.x.x] DNA REPAIR PROTEIN RAD25
    8e-06  27%  2fwrC  [x.x.x] DNA REPAIR PROTEIN RAD25
    8e-06  27%  2fwrB  [x.x.x] DNA REPAIR PROTEIN RAD25
    8e-06  27%  2fwrA  [x.x.x] DNA REPAIR PROTEIN RAD25
    8e-06  31%  2fdcB  [x.x.x] UVRABC SYSTEM PROTEIN B
    2e-05  35%  2p6rA  [x.x.x] AFUHEL308 HELICASE
:634

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxDKLDAMLNADAAPAVEASENGFAKLGLDAAILRALAEANYN
2i4iA           --------------------------------------------------FSDVEMGEIIMGNIELTRYT
2db3A           --------------------------------------------------FTSADLRDIIIDNVNKSGYK
1s2mA           ------------------------------------------------NTFEDFYLKRELLMGIFEAGFE
2j0sA           --------------------------------------------------FDTMGLREDLLRGIYAYGFE
2j0qA           --------------------------------------------------FDTMGLREDLLRGIYAYGFE
2hyiC           --------------------------------------------------FDTMGLREDLLRGIYAYGFE
2hxyA           --------------------------------------------------FDTMGLREDLLRGIYAYGFE
2z0mA           -------------------------------------------------------MNEKIEQAIREMGFK
2j0uA           --------------------------------------------------FDTMGLREDLLRGIYAYGFE
2zu6C           ------------------------------------------------DSFDDMNLSESLLRGI----YA
2vsoA           --------------------------------------------------FDDMELDENLLRGVFGYGFE
2zu6A           ------------------------------------------------------------MEGVIESNWN
1xtkA           -------------------------------------------------GFRDFLLKPELLRAIVDCGFE
2zu6D           ------------------------------------------------------------MEGVIESNWN
1xtiA           -------------------------------------------------GFRDFLLKPELLRAIVDCGFE
3fhtB           ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
3g0hA           ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
3fhtA           ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
2gxsB           --------------------------------------------------FKDFPLKPEILEALHGRGLT
2gxqA           --------------------------------------------------FKDFPLKPEILEALHGRGLT
3eiqA           ------------------------------------------------DSFDDMNLSESLLRGIYAYGFE
1hv8A           -----------------------------------------------EYNFNELNLSDNILNAIRNKGFE
3eiqD           ------------------------------------------------DSFDDMNLSESLLRGIYAYGFE
2j0uB           --------------------------------------------------FDTMGLREDLLRGIYAYGFE
1xtjA           ------------------------------------------------SGFRDFLLKPELLRAIVDCGFE
3ewsB           ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
1fuuB           -------------------------------------------------------LDENLLRGVFGYGFE
3ewsA           ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
3i5xA           -------------------------------------------------------LDKEIHKAITRMEFP
3berA           -----------------------------------------PIVEEEETKFKDLGVTDVLCEACDQLGWT
3fe2A           --------------------------------------------------FYEANFPANVMDVIARQNFT
1wrbA           -----------------------------DSIPVSVTGPDYSATNVIEN-FDELKLDPTIRNNILLASYQ
1wrbB           ------------------------------------------ATNVIEN-FDELKLDPTIRNNILLASYQ
2zu6F           ----------------------------------------------------------------------
2pl3A           --------------------------------------------------FSDFPLSKKTLKGLQEAQYR
1vecA           ------------------------------------------------NEFEDYCLKRELLMGIFEMGWE
3fhoB           ----------------------------------------------------------------------
3fhoA           ----------------------------------------------------------------------
1t6nA           ------------------------------------------------SGFRDFLLKPELLRAIVDCGFE
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------
2oxcA           --------------------------------------------------FESLLLSRPVLEGLRAAGFE
1qvaA           --------------------------------------------------FDDMELDEQLLRGVFGYGFE
1fukA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
2waxC           ----------------------------------------------------------------------
2jgnC           ----------------------------------------------------------------------
2jgnB           ----------------------------------------------------------------------
3dkpA           -------------------------------------------------------INSRLLQNILDAGFQ
1qdeA           --------------------------------------------------FDDMELDENLLRGVFGYGFE
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------AETQFTRFPFQPFIIEAIKTLRFY
2p6nB           ----------------------------------------------------------------------
2p6nA           ----------------------------------------------------------------------
3borA           ------------------------------------------------DNFDDMNLKESLLRGIYAYGFE
2waxA           ----------------------------------------------------------------------
1q0uA           --------------------------------------------------FTRFPFQPFIIEAIKTLRFY
2kbeA           ----------------------------------------------SAKSFDELGLAPELLKGIYAMKFQ
3fmpB           ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
3fmoB           ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
3fhcB           ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
2rb4A           ----------------------------------------------------------------------
2g2jA           ----------------------------------------------------------------------
2rb4B           ----------------------------------------------------------------------
2jgnA           ----------------------------------------------------------------------
2wayA           ----------------------------------------------------------------------
2wayC           ----------------------------------------------------------------------
1oyyA           -----------------------------------------------------LNLESGAKQVLQETGYQ
1t5iA           ----------------------------------------------------------------------
1oywA           -----------------------------------------------------LNLESGAKQVLQETGYQ
2g9nB           ------------------------------------------------DSFDDMNLSESLLRGIYAYGFE
1fuuA           -------------------------------------------------------LDENLLRGVFGYGFE
2g9nA           ------------------------------------------------DSFDDMNLSESLLRGIYAYGFE
2v1xA           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2fzlA           ----------------------------------------------------------------------
2fwrD           ----------------------------------------------------------------------
2fwrC           ----------------------------------------------------------------------
2fwrB           ----------------------------------------------------------------------
2fwrA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2p6rA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TPTPVQAQAIPAFLAGRDLLVSSQTGSGKTAAFMLPAIQRISEKPATHRPTEPAKRMKGKRPRPSPAQPS
2i4iA           RPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIY----SDGPGEALRAMKGRRKQ----YPI
2db3A           IPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPH----------------ELELGRPQ
1s2mA           KPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKV---------------------KPKLNKIQ
2j0sA           KPSXXXXXXXXXXXXGRDVIAQSQSGTGKTATFSISVLQCLDIQVR---------------------ETQ
2j0qA           KPSXXXXXXXXXXXXGRDVIAQSQSGTGKTATFSISVLQCLDIQVR---------------------ETQ
2hyiC           KPSXXXXXXXXXXXXGRDVIAQSQSGTGKTATFSISVLQCLDIQVR---------------------ETQ
2hxyA           KPSXXXXXXXXXXXXGRDVIAQSQSGTGKTATFSISVLQCLDIQVR---------------------ETQ
2z0mA           NFTEVQSKTIPLMLQGKNVVVRAKTGSGKTAAYAIPILE---------------LGMKS-----------
2j0uA           KPSXXXXXXXXXXXXGRDVIAQSQSGTGKTATFSVSVLQCLDIQVR---------------------ETQ
2zu6C           KPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQI-ELDLTQA---------------------
2vsoA           EPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDT---------------------SVKAPQ
2zu6A           -------EAILPCIKGYDVIAQAQSGTGKTATFAISILQQIEDLKATQA---------------------
1xtkA           HPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLE---------------------PVTGQVS
2zu6D           E---IVQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIEDLKATQA---------------------
1xtiA           HPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLE---------------------PVTGQVS
3fhtB           RPSKIQENALPLMLAEQNLIAQSQSGTGKTAAFVLAMLSQV----------EPANKY-----------PQ
3g0hA           RPSKIQENALPLMLAEQNLIAQSQSGTGKTAAFVLAMLSQV----------EPANKY-----------PQ
3fhtA           RPSKIQENALPLMLAEQNLIAQSQSGTGKTAAFVLAMLSQV----------EPANKY-----------PQ
2gxsB           TPTPIQAAALPLALEGKDLIGQARTGTGKTLAFALPIAERLA--PSQER---------GRKPRA------
2gxqA           TPTPIQAAALPLALEGKDLIGQARTGTGKTLAFALPIAERLA--PSQER---------GRKPRA------
3eiqA           KPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIEDLKATQA---------------------
1hv8A           KPTDIQ-KVIPLFLNDENIVAQARTGSGKTASFAIPLIELVNENNGIEA---------------------
3eiqD           KPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIEDLKATQA---------------------
2j0uB           KPSXXXXXXXXXXXXGRDVIAQSQSGTGKTATFSVSVLQCLDIQVR---------------------ETQ
1xtjA           HPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQL---------------------EPVTGQVS
3ewsB           RPSKIQENALPLMLPPQNLIAQSQSGTGKTAAFVLAMLSQV----------EPANKY-----------PQ
1fuuB           EPSAIQQRAIP-IIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSV--------------KAPQA------
3ewsA           RPSKIQENALPLMLAEQNLIAQSQSGTGKTAAFVLAMLSQV----------EPANKY-----------PQ
3i5xA           GLTPVQQKTIKPILSSEDVIARAKTGTGKTFAFLIPIFQHLINTKFD-----------------SQYMVK
3berA           KPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLE---------------------TPQRLF
3fe2A           EPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPI----------------
1wrbA           RPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPII--------NHLVCQDLK----------TAYPK
1wrbB           RPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLVCQDLYSK----------------TAYPK
2zu6F           ----------------------------------------------------------------------
2pl3A           LVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQWT-----------------STDGLG
1vecA           KPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQA--------------------
3fhoB           ----IQEKALPLLLSNRNMIGQSQSGTGKTAAFALTMLSRVDA---------------------SVPKPQ
3fhoA           ----IQEKALPLLLSNRNMIGQSQSGTGKTAAFALTMLSRVDA---------------------SVPKPQ
1t6nA           HPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQL---------------------EPVTGQVS
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------
2oxcA           RPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSVLENLST----------------------Q
1qvaA           EPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDT---------------------SVKAPQ
1fukA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
2waxC           ----------------------------------------------------------------------
2jgnC           ----------------------------------------------------------------------
2jgnB           ----------------------------------------------------------------------
3dkpA           MPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL-KQPAN----------KGFR---------
1qdeA           EPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDT---------------------SVKAPQ
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
1q0uB           KPTEIQERIIPGALRGESV-GQSQTGTGKTHAYLLP-IEKI---------------------KPERAEVQ
2p6nB           ----------------------------------------------------------------------
2p6nA           ----------------------------------------------------------------------
3borA           KPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFK---------------------ETQ
2waxA           ----------------------------------------------------------------------
1q0uA           KPTEIQERIIPGALRGESV-GQSQTGTGKTHAYLLP-IEKI---------------------KPERAEVQ
2kbeA           KPSKIQERALPLLLHNRNMIAQSQSGTGKTAAFSLTMLTRVN---------------------PEDASPQ
3fmpB           RPSKIQENALPLMLAEQNLIAQSQSGTGKTAAFVLAMLSQV----------EPANK-----------YPQ
3fmoB           RPSKIQENALPLMLAEQNLIAQSQSGTGKTAAFVLAMLSQV----------EPANK-----------YPQ
3fhcB           RPSKIQENALPLMLAEQNLIAQSQSGTGKTAAFVLAMLSQV----------EPANK-----------YPQ
2rb4A           ----------------------------------------------------------------------
2g2jA           ----------------------------------------------------------------------
2rb4B           ----------------------------------------------------------------------
2jgnA           ----------------------------------------------------------------------
2wayA           ----------------------------------------------------------------------
2wayC           ----------------------------------------------------------------------
1oyyA           QFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALL-LNGLTVVVSPLISLMKDQVDQLQANGVAAA
1t5iA           ----------------------------------------------------------------------
1oywA           QFRPGQEEIIDTVLSGRDCLVVP-TGGGKSLCYQIPALL-LNGLTVVVSPLISLKDQVDQLQANGVAA-A
2g9nB           -PSAIQQRAILPCI-GYDVIAQAQSGTG-TATFAISILQQIELDLATQA---------------------
1fuuA           EPSAIQQRAIP-IIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSV--------------KAPQ-------
2g9nA           -PSAIQQRAILPCI-GYDVIAQAQSGTG-TATFAISILQQIELDLATQA---------------------
2v1xA           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2eyqB           --TPDQAQAINAVLSAMDRLVCGDVGFGKTEVAMRAAFLAVDN------------------------HKQ
2eyqA           --TPDQAQAINAVLSAMDRLVCGDVGFGKTEVAMRAAFLAVDN------------------------HKQ
1wp9D           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2fzlA           ----------------------------------------------------------------------
2fwrD           ----------------------------------------------------------------------
2fwrC           ----------------------------------------------------------------------
2fwrB           ----------------------------------------------------------------------
2fwrA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2p6rA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LLVLTPTRELALQVTEAAAKYGRHLRRIVCASILGGMPYPKQLAMLARMPDILVATPGRLLDHIEAGRID
2i4iA           SLVLAPTRELAVQIYEEARKFSYRSRVRPCV-VYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIG
2db3A           VVIVSPTRELAIQIFNEARKFAFE-SYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFIT
1s2mA           ALIMVPTRELALQTSQVVRTLGKHCG-ISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVAD
2j0sA           ALILAPTRELAVQIQKGLLALGDYMN-VQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLR
2j0qA           ALILAPTRELAVQIQKGLLALGDYMN-VQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLR
2hyiC           ALILAPTRELAVQIQKGLLALGDYMN-VQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLR
2hxyA           ALILAPTRELAVQIQKGLLALGDYMN-VQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLR
2z0mA           -LVVTPTRELTRQVASHIRDIGRYMDTKV-AEVYGGMPYKAQINRV-RNADIVVATPGRLLDLWSKGVID
2j0uA           ALILAPTRELAVQVQKGLLALGDYMN-VQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLR
2zu6C           -LVLAPTRELAQQIQKVVMALG-------CHACIGGTNVRAEVQKLQEAPHIIVGTPGRVFDMLNRRYLS
2vsoA           ALMLAPTRELALQIQKVVMALAFHMDIKVHACI--GL----------RDAQIVVGTPGRVFDNIQRRRFR
2zu6A           -LVLAPTRELAQQIQKVVMALGDYM-GASCHACIGGTNVRAEVQKLMEAPHIIVGTPGRVFDMLNRRYLS
1xtkA           VLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKCPHIVVGTPGRILALARNKSLN
2zu6D           -LVLAPTRELAQQIQKVVMALGDYM-GASCHACIGGTNVRAEVQKLMEAPHIIVGTPGRVFDMLNRRYLS
1xtiA           VLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKCPHIVVGTPGRILALARNKSLN
3fhtB           CLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKISEQ---------IVIGTPGTVLDWCSKLKID
3g0hA           CLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQ---IVIGTPGTVLDWCSKLKID
3fhtA           CLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQ---IVIGTPGTVLDWCSKLKID
2gxsB           -LVLTPTRELALQVASELTAVAPHLKVV---AVYGGTGYGKQKEALLRGADAVVATPGRALDYLRQGVLD
2gxqA           -LVLTPTRELALQVASELTAVAPHLKVV---AVYGGTGYGKQKEALLRGADAVVATPGRALDYLRQGVLD
3eiqA           -LVLAPTRELAQQIQKVVMALGDYM-GASCHACIGGTNVRAEVQKLMEAPHIIVGTPGRVFDMLNRRYLS
1hv8A           -IILTPTRELAIQVADEIESLKGN-KNLKIAKIYGGKAIYPQIKAL-KNANIVVGTPGRILDHINRGTLN
3eiqD           -LVLAPTRELAQQIQKVVMALGDYM-GASCHACIGGTNVRAEVQKLMEAPHIIVGTPGRVFDMLNRRYLS
2j0uB           ALILAPTRELAVQVQKGLLALGDYMN-VQSHACIG-----EDIRKLDYGQHVVAGTPGRVFDMIRRRSLR
1xtjA           VLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKCPHIVVGTPGRILALARNKSLN
3ewsB           CLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQ---IVIGTPGTVLDWCSKF-ID
1fuuB           --LLAPTRELALQIQKVVALAFHDIKVHAC---IGGTSFVEDAEGL-RDAQIVVGTPGRVFDNIQRRRFR
3ewsA           CLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQ---IVIGTPGTVLDWCSKLKID
3i5xA           AVIVAPTRDLALQIEAEVKKYG--LKKYACVSLVGGTDFRAAMNKMNKLPNIVIATPGRLIDVLEKSNKF
3berA           ALVLTPTRELAFQISEQFEALGSSI-GVQSAVIVGGIDSMSQSLALAKKPHIIIATPGRLIDHLENTKFN
3fe2A           CLVLAPTRELXXXXXXXXXEYCRACR-LKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTN
1wrbA           CLILAPTRELAIQILSESQKFSLNTPLRSCV-VYGGADTHSQIREVQMGCHLLVATPGRLVDFIEKNKIS
1wrbB           CLILAPTRELAIQILSESQKFSLNTPLRSCV-VYGGADTHSQIREVQMGCHLLVATPGRLVDFIEKNKIS
2zu6F           -LVLAPTRELAQQIQKVVMALGD------CHACIGGTNVRAEVQKLQEAPHIIVGTPGRVFDMLNRRYLS
2pl3A           VLIISPTRELAYQTFEVLRKVGKN-HDFSAGLIIGGL---KHEAERINNINILVCTPGRLLQHMETVSFH
1vecA           -MVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAK
3fhoB           AICLAPSRELARQIMDVVTEMGK---------------YTEVKTAFKIDAQIVIGTPGTVMDLMKRRQLD
3fhoA           AICLAPSRELARQIMDVVTEMGK---------------YTEVKTAFKIDAQIVIGTPGTVMDLMKRRQLD
1t6nA           VLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKCPHIVVGTPGRILALARNKSLN
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------
2oxcA           ILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKC-HIAVGSPGRIKQLIELDYLN
1qvaA           ALMLAPTRELALQIQKVVMALAFHMDIKVHACI-GGTSFVEDAEGL-RDAQIVVGTPGRVFDNIQRRRFR
1fukA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
2waxC           ----------------------------------------------------------------------
2jgnC           ----------------------------------------------------------------------
2jgnB           ----------------------------------------------------------------------
3dkpA           ALIISPTRELASQIHRELIKIGFRIHMIHKAAVAAKKFGPKS----SKKFDILVTTPNRLIYLLDPPGID
1qdeA           ALMLAPTRELALQIQKVVMALAFHMDIKVHACI--GL----------RDAQIVVGTPGRVFDNIQRRRFR
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
1q0uB           AVITAPTRELATQIYHETLKITKFCPRIVARCLIGGTDKQKALEKLNVQPHIVIGTPGRINDFIREQALD
2p6nB           ----------------------------------------------------------------------
2p6nA           ----------------------------------------------------------------------
3borA           ALVLAPTRELAQQIQKVILALGDYMGA-TCHACIGEAPH------------IVVGTPGRVFDMLNRRYLS
2waxA           ----------------------------------------------------------------------
1q0uA           AVITAPTRELATQIYHETLKITKFCPRIVARCLIGGTDKQKALEKLNVQPHIVIGTPGRINDFIREQALD
2kbeA           AICLAPSRELARQTLEVVQEMGKFTK--ITSQLIVPDSFEKNKQINAQ---VIVGTPGTVLDLMRRKLMQ
3fmpB           CLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKI---SEQIVIGTPGTVLDWCSKLKID
3fmoB           CLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKI---SEQIVIGTPGTVLDWCSKLKID
3fhcB           CLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKI---SEQIVIGTPGTVLDWCSKLKID
2rb4A           ----------------------------------------------------------------------
2g2jA           ----------------------------------------------------------------------
2rb4B           ----------------------------------------------------------------------
2jgnA           ----------------------------------------------------------------------
2wayA           ----------------------------------------------------------------------
2wayC           ----------------------------------------------------------------------
1oyyA           CLNSTQTREQQLEVMTGCRT--------------------GQIRLLYIAPERLMLD--NFLEHLAHWNPV
1t5iA           ----------------------------------------------------------------------
1oywA           CLNSTQTREQQLEVTGCRTGQIR----------------------------LLYIAPERLLDNFLEHLAH
2g9nB           -LVLAPTRELAQQIQVVMA-LGDYMGAS-CHACIGGTNVRAEVQLQMEAPHIIVGTPGRVFDML--NRRY
1fuuA           -ALLAPTRELALQIQKVVALAFHDIKVHAC---IGGTSFVEDAEGL-RDAQIVVGTPGRVFDNIQRRRFR
2g9nA           -LVLAPTRELAQQIQVVMA-LGDYMGAS-CHACIGNVRAEVQLQMEA--PHIIVGTPGRVFDMLN--RRY
2v1xA           ----------------------------------------------------------------------
1wp9B           VLMLAPTKPLVLQHAESFRRFNLPPEKIVA---LTGEKSPEERSKAWARAKVIVATPQTIENDLLAGRIS
1wp9A           VLMLAPTKPLVLQHAESFRRFNLPPEKIVA---LTGEKSPEERSKAWARAKVIVATPQTIENDLLAGRIS
1gm5A           ---MVPTSILAIQTVESFSKFNIHVALLIGATTPSEKEKIKSGLRNGQI-DVVIGTHALIQEDVH-----
1wp9C           VLMLAPTKPLVLQHAESFRRFNLPPEKIVA---LTGEKSPEERSKAWARAKVIVATPQTIENDLLAGRIS
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2eyqB           VAVLVPTTLLAQQ------HYDNFRDRFA--------NWPVRIEMISRFRSAKEQT--QILAEVAEGKID
2eyqA           VAVLVPTTLLAQQ------HYDNFRDRFA--------NWPVRIEMISRFRSAKEQT--QILAEVAEGKID
1wp9D           VLMLAPTKPLVLQHAESFRRFNLPPEKIVA---LTGEKSPEERSKAWARAKVIVATPQTIENDLLAGRIS
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2fzlA           ----------------------------------------------------------------------
2fwrD           ----------------------------------------------------------------------
2fwrC           ----------------------------------------------------------------------
2fwrB           ----------------------------------------------------------------------
2fwrA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2p6rA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LSALEMLVFDEADRMLDMGFADDIDAIVAATPASRQTLMFSATLDARIAQLASRQLRDPQRIEIAAARAD
2i4iA           LDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPRHTMMFSATFPKEIQMLA----RDFLDEYIFLAVGT
2db3A           FEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGA
1s2mA           LSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLME-ELT
2j0sA           TRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELT
2j0qA           TRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELT
2hyiC           TRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELT
2hxyA           TRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELT
2z0mA           LSSFEIVIIDEADLMFEMGFIDDIKIILAQTSNRKITGLFSATIPEEIRKVVKDFITNYEEIEACIGLA-
2j0uA           TRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILV---KRD
2zu6C           PKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKERQF
2vsoA           TDKIKMFILDEADEMLSSGFKEQIYQIFXXXXXXXXXXXXSATMPNDVLEVTTKFMRNPVRILVKKDELT
2zu6A           PKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELT
1xtkA           LKHIKHFILDEADKMLELDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKL
2zu6D           PKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILV---KKE
1xtiA           LKHIKHFILDECDKMLELDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKL
3fhtB           PKKIKVFVLDEADVMITQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEET
3g0hA           PKKIKVFVLDEADVMITQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEET
3fhtA           PKKIKVFVLDEADVMITQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEET
2gxsB           LSRVEVAVLDEADEMLSMGFEEEVEALLSATPPSRQTLLFSATLPSWAKRLAERYMKNPVLINV------
2gxqA           LSRVEVAVLDEADEMLSMGFEEEVEALLSATPPSRQTLLFSATLPSWAKRLAERYMKNPVLINV------
3eiqA           PKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELT
1hv8A           LKNVKYFILDEADEL--NGFIKDVEKILNACNKDKRILLFSAT---------------PREINLAKKYGD
3eiqD           PKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELT
2j0uB           TRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEVLEMTNKFMTDPIRILVKRDELT
1xtjA           LKHIKHFILDECDKMLELDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKL
3ewsB           PKKIKVFVLDEADVMITQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEET
1fuuB           TDKIKFIL-DEADE-LSSGFKEQIYQIFXXXXXXXXXXXXSATPNDVLE--VTTKFRNPVRILVKKDELT
3ewsA           PKKIKVFVLDEADVMITQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEET
3i5xA           FRFVDYKVLDEADRLLEIGFRDDLETISSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKN
3berA           LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSS----
3fe2A           LRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGA----
1wrbA           LEFCKYIVLDEADRMLDMGFEPQIRKIIMPSGINRQTLMFSATFPKEIQKLAA-----------------
1wrbB           LEFCKYIVLDEADRMLDMGFEPQIRKIIMPSGINRQTLMFSATFPKEIQKLAA-----------------
2zu6F           PKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVLL-SATMPSDVLEVTKKFMRDP------GIRQF
2pl3A           ATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLARLSLKNPEYV--------
1vecA           VDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLEKPYEI--------
3fhoB           ARDIKVFVLDEADNMLDQ-LGDQSMRIKHLLPRNTQIVLFSATFSERVEKYAERFAPNANEIRLKT----
3fhoA           ARDIKVFVLDEADNMLDQ-LGDQSMRIKHLLPRNTQIVLFSATFSERVEKYAERFAPNANEIRLKT----
1t6nA           LKHIKHFILDECDKMLELDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEI--------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------
2oxcA           PGSIRLFILDEADKLLEEGFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRL------
1qvaA           TDKIKMFILDEADEMLSSGFKEQIYQIFXXXXXXXXXXXXSATMPNDVLEVTTKFMRNPVRI--------
1fukA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
2waxC           ----------------------------------------------------------------------
2jgnC           ----------------------------------------------------------------------
2jgnB           ----------------------------------------------------------------------
3dkpA           LASVEWLVVDESDKLFDGGFRDQLASILACTSHKVRRAMFSATFAYDVEQWCKLNLDNVISVSIGA----
1qdeA           TDKIKMFILDEADEMLSSGFKEQIYQIFXXXXXXXXXXXXSATMPNDVLEVTTKFMRNPVRI--------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
1q0uB           VHTAHILVVDEAD-LLD-GFITDVDQI-AARPKDLQ-LVFSATIPEKL----------------------
2p6nB           ----------------------------------------------------------------------
2p6nA           ----------------------------------------------------------------------
3borA           PKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRI--------
2waxA           ----------------------------------------------------------------------
1q0uA           VHTAHILVVDEAD-LLD-GFITDVDQI-AARPKDLQ-LVFSATIPEKL----------------------
2kbeA           LQKIKIFVLDEADNMLDQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLEL------
3fmpB           PKKIKVFVLDEADVMITQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKL------
3fmoB           PKKIKVFVLDEADVMITQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKL------
3fhcB           PKKIKVFVLDEADVMITQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKL------
2rb4A           ----------------------------------------------------------------------
2g2jA           ----------------------------------------------------------------------
2rb4B           ----------------------------------------------------------------------
2jgnA           ----------------------------------------------------------------------
2wayA           ----------------------------------------------------------------------
2wayC           ----------------------------------------------------------------------
1oyyA           LLAV-----DEAHCISQWGH--DFRPEYAALGQLRQTLPFTATADDTTRQDIVRLLNDPL---IQISSFD
1t5iA           ----------------------------------------------------------------------
1oywA           WNPV-LLAVDEAHCISQWGH--DFRPEYAALGQLRQTLPFAATADDTTRQDIVRLLNDPL---IQISSFD
2g9nB           LSPYIMFVLDEADEMLSRGFDQIYD--IFQLNSNTQVVLLSATMPSDVLEVTF--MRDPIRI--------
1fuuA           TDKIK-FILDEADE-LSSGFKEQIYQIFXXXXXXXXXXXXSATPNDVLE--VTTKFRNPVRI--------
2g9nA           LSPYIMFVLDEADEMLSRGFDQIYD--IFQLNSNTQVVLLSATMPSDVLEVTF--MRDPIRI--------
2v1xA           ----------------------------------------------------------------------
1wp9B           LEDVSLIVFDEAHR--------------------------------------------------------
1wp9A           LEDVSLIVFDEAHR--------------------------------------------------------
1gm5A           FKNLGLVIIDEQHRLMNKGKMVDT-LVMSATPIPRSALAFYGDLDVTVIDEMP-----PGRKEVQTMLVP
1wp9C           LEDVSLIVFDEAHR--------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2eyqB           IKDLGLLIVDEEHR-----FGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIATPPAR--
2eyqA           IKDLGLLIVDEEHR-----FGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIATPPAR--
1wp9D           LEDVSLIVFDEAHR--------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2fzlA           ----------------------------------------------------------------------
2fwrD           ----------------------------------------------------------------------
2fwrC           ----------------------------------------------------------------------
2fwrB           ----------------------------------------------------------------------
2fwrA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2p6rA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HSNIEQRLHFTDDMSHKERLLDHLLRDASLKQAIVFTATKRDADSLAERLSDTGFSAGALHGDMTQGARN
2i4iA           SENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDRE
2db3A           CSDVKQTIYEVNKYAKRSKLIEILSEQAD--GTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQRE
1s2mA           LKGITQYYAFVEERQ-KLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERN
2j0sA           LEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERE
2j0qA           LEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERE
2hyiC           LEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERE
2hxyA           LEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERE
2z0mA           --NVEHKVHVKDDWRSKVQ----ALRENKDKGVIVFVRTRNRVAKLV-RLFD---NAIELRGDLPQSVRN
2j0uA           ELTLEGIKQFFVAVEREEWKFDTLCDLYDITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERE
2zu6C           YINVERE-------EWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERD
2vsoA           LEGIKQFYVNVXXXXXXXXCLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERD
2zu6A           LEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHRDV------
1xtkA           TLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERL
2zu6D           ELTLEGIRQFYINVEREEWKLDTLLYETLTIQAVIFINTRRKVDWLTEKMHARDFTVSAMHG------RD
1xtiA           TLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERL
3fhtB           LDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRA
3g0hA           LDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRA
3fhtA           LDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRA
2gxsB           ----------------------------------------------------------------------
2gxqA           ----------------------------------------------------------------------
3eiqA           LEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAM---MDQKERD
1hv8A           YSFIKAKINANIEQSYVEEALCRLLKNKEF-YGLVFCKTKRDTKELAS-LRDIGFKAGAIHGDLSQSQRE
3eiqD           LEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAM--DMDQKERD
2j0uB           LEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMRET----------VSQKERE
1xtjA           TLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERL
3ewsB           LDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRA
1fuuB           LEGIKQFYVNVXXXXXXXXCLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERD
3ewsA           LDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRA
3i5xA           HERIDQSVVISEKFANSEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEDLPILEFHGKITQNKRT
3berA           ----------------------------------------------------------------------
3fe2A           ----------------------------------------------------------------------
1wrbA           ----------------------------------------------------------------------
1wrbB           ----------------------------------------------------------------------
2zu6F           YINVE------------EWKLDTLLYETTI-QAVIFINTRRKVDWLTEKMHARDFTVSAMH----QKERD
2pl3A           ----------------------------------------------------------------------
1vecA           ----------------------------------------------------------------------
3fhoB           EEGIKQLYMDCQSEEHKYNVLVELY--GTIGQSIIFCKKKDTAEEIARRMTADGHTVACL-----TAQRD
3fhoA           EEGIKQL--YMDCEEHKYNVLVELY---GIGQSIIFCKKKDTAEEIARRMTADGHTVACL-----TAQRD
1t6nA           ----------------------------------------------------------------------
3eaqA           -------------------VLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERE
3i32A           -------------------VLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDMSQGERE
2hjvB           ---------------NKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRF
2hjvA           ---------------NKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRF
2oxcA           ----------------------------------------------------------------------
1qvaA           ----------------------------------------------------------------------
1fukA           --------------------LTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERD
2kbfA           ----------------------------TIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERD
2waxC           ----------------KVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRN
2jgnC           ----------------------------------VFVETKKGADSLEDFLYHEGYACTSIHGDRS---RE
2jgnB           --NITQKVVWVEESDKRSFLLDLLNATGSL--TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDRE
3dkpA           ----------------------------------------------------------------------
1qdeA           ----------------------------------------------------------------------
3easA           -------------------VLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERE
3earA           -------------------VLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERE
3eaqB           -------------------VLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERE
3gfpA           ----------------------------TIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERD
1q0uB           ----------------------------------------------------------------------
2p6nB           ---------------------------------LIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERT
2p6nA           ---------------------------------LIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERT
3borA           ----------------------------------------------------------------------
2waxA           ----------------KVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRN
1q0uA           ----------------------------------------------------------------------
2kbeA           ----------------------------------------------------------------------
3fmpB           ----------------------------------------------------------------------
3fmoB           ----------------------------------------------------------------------
3fhcB           ----------------------------------------------------------------------
2rb4A           -NNIRQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELTVEQRA
2g2jA           -NNIRQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELTVEQRA
2rb4B           -NNIRQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELTVEQRA
2jgnA           --NITQKVVWVEESDKRSFLLD-LLNATKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHEE-------
2wayA           ----------------KVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRN
2wayC           ----------------KVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRN
1oyyA           RPNIRYML------MEKFKPLDQLMREQRGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRA
1t5iA           --------------NEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERL
1oywA           RPNIRYLEKF--------KPLDQLVQEQRGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRA
2g9nB           ----------------------------------------------------------------------
1fuuA           ----------------------------------------------------------------------
2g9nA           ----------------------------------------------------------------------
2v1xA           ------------------------------QSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKT
1wp9B           ----------------KEIIREQLQRKQNSK-IIVFTNYRETAKKIVNELVKDGIKAKRFVG--SQREQK
1wp9A           ----------------KEIIREQLQRKQNSK-IIVFTNYRETAKKIVNELVKDGIKAKRFVGQASQREQK
1gm5A           MDRVNEVYEF---------VRQEVMRGG---QAFIVYPLIKSAVEMYEYLSKEVFKLGLMHGRLSQEEKD
1wp9C           ----------------KEIIREQLQRKQNSK-IIVFTNYRETAKKIVNELVKDGIKAKRF----VQREQK
1t5lA           ------------------------------ERTLVTTLTKKMAEDLTDYLKEAGIKVAYLHSEIKTLERI
1d9zA           ------------------------------ERTLVTTLTKKMAEDLTDYLKEAGIKVAYLHSEIKTLERI
1d9xA           ------------------------------ERTLVTTLTKKMAEDLTDYLKEAGIKVAYLHSEIKTLERI
2eyqB           RLAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENQKAAERLAELVPEARIAIG--HGQMRERELE
2eyqA           RLAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENQKAAERLAELVPEARIAIG--HGQMRERELE
1wp9D           ----------------KEIIREQLQRKQNSK-IIVFTNYRETAKKIVNELVKDGIKAKRFR------EQK
2nmvA           ------------------------------ERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERI
2d7dA           ------------------------------ERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERI
1d2mA           ---------------------------------LVTVLTVRMAEELTSFLVEHGIRARYLHHELDAFKRQ
1c4oA           ---------------------------------LVTVLTVRMAEELTSFLVEHGIRARYLHHELDAFKRQ
2fdcA           ------------------------------ERTLVTTLTKKMAEDLTDYLKEAGIKVAYLH------ERI
2fzlA           ----EEARRIAFNSKNKIRKLREILERHRKDKIIIFTRH----NELVYRISKV-FLIPAITHRTSREERE
2fwrD           ----EEARRIAFNSKNKIRKLREILERHRKDKIIIFTRH----NELVYRISKV-FLIPAITHRTSREERE
2fwrC           ----EEARRIAFNSKNKIRKLREILERHRKDKIIIFTRH----NELVYRISKV-FLIPAITHRTSREERE
2fwrB           ----EEARRIAFNSKNKIRKLREILERHRKDKIIIFTRH----NELVYRISKV-FLIPAITHRTSREERE
2fwrA           ----EEARRIAFNSKNKIRKLREILERHRKDKIIIFTRH----NELVYRISKV-FLIPAITHRTSREERE
2fdcB           ------------------------------ERTLVTTLTKKMAEDLTDYLKEAGIKVAYLHIEIIRD---
2p6rA           ------------------------------------------------------------HAGLLNGQRR


                         .         .         .         .         *         .         .:420
query           RTLTALRRGNLRVLVATDVAARGIDVPDITHVVNFDLPKQAEDYVHRIGRTGRAGRSGVAINLVNHGDMF
2i4iA           EALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGR--NLGLATSFFN-----
2db3A           QALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRA----------
1s2mA           KVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRF
2j0sA           SIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIR
2j0qA           SIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIR
2hyiC           SIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIR
2hxyA           SIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIR
2z0mA           RNIDAFREGEYDMLITTDVASRGLDIPLVEKVINFDAPQDLRTYIHRIGRTGRMGRKGEAITFI------
2j0uA           SIMKEFRSGASRVLISTDVWAR--DVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAVNFVKNDDIR
2zu6C           VIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIG-----GRKGVAINMVTEEDKR
2vsoA           TIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRI------GRKGVAINFVTNEDVG
2zu6A           -IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGK-GVAINMVTEEDKR
1xtkA           SRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVS-----
2zu6D           VIMREFRSGS-SVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRI---GRGGRKGVAINMVTEEDKR
1xtiA           SRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVS-----
3fhtB           AVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPPDNETYLHRIGRTGRFGKRGLAVNMVSKHSMN
3g0hA           AVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPPDNETYLHRIGRTGRFGKRGLAVNMVSKHSMN
3fhtA           AVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPPDNETYLHRIGRTGRFGKRGLAVNMVSKHSMN
2gxsB           ----------------------------------------------------------------------
2gxqA           ----------------------------------------------------------------------
3eiqA           VIMREFRSG---VLITTDLLA--IDVQQVSLVINYDLPTNRENYIHRIGR-------GVAINMVTEEDKR
1hv8A           KVIRLFKQKKIRILIATDV-SRGIDVNDLNCVINYHLPQNPESY-HXXXXXXXXXXXXXXXSIINRREYK
3eiqD           VIMREF------VLITTDLLARGIDVQQVSLVINYDLPTNRENYIHXXXXXXXXXXXXVAINMVTEEDKR
2j0uB           SIMKEFRSGASRVLIST--------VPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAVNFVKNDDIR
1xtjA           SRYQQFKDFQRRILVATN-----LDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVS-----
3ewsB           AVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPPDNETYLHRIGR----GKRGLAVNMVSKHSMN
1fuuB           -TIKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGK----GVAINFVTNEDVG
3ewsA           AVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPPDNETYLHRIGR----GKRGLAVNMVSKHSMN
3i5xA           SLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELP
3berA           ----------------------------------------------------------------------
3fe2A           ----------------------------------------------------------------------
1wrbA           ----------------------------------------------------------------------
1wrbB           ----------------------------------------------------------------------
2zu6F           VIMREFR-GSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRI---------GVAINMVTEEDK-
2pl3A           ----------------------------------------------------------------------
1vecA           ----------------------------------------------------------------------
3fhoB           AIMDSFRVGTSKVLVTTN-----IDVSQVNLVVNLDDP---QTYLHRIGRTG----VGVSINFVH--DKK
3fhoA           AIMDSFRVGTSKVLVTTN-----IDVSQVNLVVNLDDP---QTYLHRIGRTG-----GVSINFVH--DKK
1t6nA           ----------------------------------------------------------------------
3eaqA           RVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTGRAG---------------
3i32A           RVMGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRMPDRAEAYQHRSGRTG------------------
2hjvB           DVMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFV------
2hjvA           DVMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFV------
2oxcA           ----------------------------------------------------------------------
1qvaA           ----------------------------------------------------------------------
1fukA           TIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGG-----GVAINFVTNEDVG
2kbfA           RLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANTYIHRIGRTGRFGRKGVAISFVHDKNSF
2waxC           RVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIG-SGRFGHLGLAINLITYDDRF
2jgnC           EALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFN-----
2jgnB           EALHQFRSGKSPILVATAVA-----ISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFN-----
3dkpA           ----------------------------------------------------------------------
1qdeA           ----------------------------------------------------------------------
3easA           RVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQH------------------------
3earA           RVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQH------------------------
3eaqB           RVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQH------------------------
3gfpA           RLIDDFREGRSKVLITTNVLARGIDIPTVS-VVNYDLPTLANTYIHRIGRTGRFGRKGVAISFVHDKNSF
1q0uB           ----------------------------------------------------------------------
2p6nB           KAIEAFREGKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGCS--TGIATTFIN-----
2p6nA           KAIEAFREGKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGCTGIATTFIN--------
3borA           ----------------------------------------------------------------------
2waxA           RVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRS-----LGLAINLITYDDRF
1q0uA           ----------------------------------------------------------------------
2kbeA           ----------------------------------------------------------------------
3fmpB           ----------------------------------------------------------------------
3fmoB           ----------------------------------------------------------------------
3fhcB           ----------------------------------------------------------------------
2rb4A           SIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPPDYETYLHRIGRT----KKGLAFNMIEVDELP
2g2jA           SIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPPDYETYLHRIGRT-----KGLAFNMIEVDELP
2rb4B           SIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPPDYETYLHRIGRT-----KGLAFNMIEVDELP
2jgnA           -ALHQFRSGKSPILVAT------ADISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFN-----
2wayA           RVFHDFRNGLCRNLVCTD-----LDIQAVNVVINFDFPKLAETYLHRIG-------LGLAINLITYDDRF
2wayC           RVFHDFRNGLCRNLVCTDLQA-------VNVVINFDFPKLAETYLHRIG-------LGLAINLITYDDRF
1oyyA           DVQEKFQRDDLQIVVATVA----INKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMA
1t5iA           SRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVS-----
1oywA           DVQEKFQRDDLQIVVAT-VAFGGINKPNVRFVVHFDIPRNIESYYQ---ETGRAGRDGLPAEALFYDPAD
2g9nB           ----------------------------------------------------------------------
1fuuA           ----------------------------------------------------------------------
2g9nA           ----------------------------------------------------------------------
2v1xA           TVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGFGDIF
1wp9B           LILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQRRGRTGR-----------------
1wp9A           LILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQRRGRTGR-----------------
1gm5A           RVMLEFAEGRYDILVSTTVIEVGIDVPRANVMVIENPERFGLAQLHQLGRVGRGGQEAYCFLVVGDVGEE
1wp9C           LILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQRRGRTGR-----------------
1t5lA           EIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGRSLIQTIGRAAR-----------------
1d9zA           EIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGRSLIQTIGRAAR-----------------
1d9xA           EIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGRSLIQTIGRAAR-----------------
2eyqB           RVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLGRVGRSHHQAYAWLLTPH----
2eyqA           RVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLGRVGRSHHQAYAWLLTPH----
1wp9D           LILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQRRGRTGR-----------------
2nmvA           EIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGRSLIQTIGRAAR-----------------
2d7dA           EIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGRSLIQTIGRAAR-----------------
1d2mA           ALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKEGRSLIQTIGRAARNARGEVWLYADRVSEAM
1c4oA           ALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKEGRSLIQTIGRAARNARGEVWLYADRVSEAM
2fdcA           EIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGRSLIQTIGRAAR-----------------
2fzlA           EILEGFRTGRFRAIVSSQVLDEGIDVPDANVGVIMSGSGSAREYIQRLGRPSKGKKEAVLYELISRG---
2fwrD           EILEGFRTGRFRAIVSSQVLDEGIDVPDANVGVIMSGSGSAREYIQRLGRPSKGKKEAVLYELISRG---
2fwrC           EILEGFRTGRFRAIVSSQVLDEGIDVPDANVGVIMSGSGSAREYIQRLGRPSKGKKEAVLYELISRG---
2fwrB           EILEGFRTGRFRAIVSSQVLDEGIDVPDANVGVIMSGSGSAREYIQRLGRPSKGKKEAVLYELISRG---
2fwrA           EILEGFRTGRFRAIVSSQVLDEGIDVPDANVGVIMSGSGSAREYIQRLGRPSKGKKEAVLYELISRG---
2fdcB           -----LRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGRSLIQTIGRAAR-----------------
2p6rA           VVEDAFRRGNIKVVVATPTLAAGVNLPARRVIVGYSKRIKVSEYKQMAGRAGRPGERGEAIIIVGKRD--


                         .         .         +         .         .         .         .:490
query           QWRRIERFTNNRIDASVIEGFEPRRSPKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i4iA           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1s2mA           NLYKIEQELGTEIAA-------------------------------------------------------
2j0sA           ILRDIEQYYSTQID--------------------------------------------------------
2j0qA           ILRDIEQYYSTQID--------------------------------------------------------
2hyiC           ILRDIEQYYSTQID--------------------------------------------------------
2hxyA           ILRDIEQYYSTQID--------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
2j0uA           VLRDIEQYYSTQID--------------------------------------------------------
2zu6C           TLRDIETFYNTSIE--------------------------------------------------------
2vsoA           AMRELEKFYSTQIE--------------------------------------------------------
2zu6A           TLRDIETFYNTSIE--------------------------------------------------------
1xtkA           ----------------------------------------------------------------------
2zu6D           TLRDIETFYNTSIE--------------------------------------------------------
1xtiA           ----------------------------------------------------------------------
3fhtB           ILNRIQEHFNKKIE--------------------------------------------------------
3g0hA           ILNRIQEHFNKKIE--------------------------------------------------------
3fhtA           ILNRIQEHFNKKIE--------------------------------------------------------
2gxsB           ----------------------------------------------------------------------
2gxqA           ----------------------------------------------------------------------
3eiqA           TLRDIETFYNTSIE--------------------------------------------------------
1hv8A           KLRYIER---------------------------------------------------------------
3eiqD           TLRDIETFYNTSIE--------------------------------------------------------
2j0uB           VLRDIEQYYSTQID--------------------------------------------------------
1xtjA           ----------------------------------------------------------------------
3ewsB           ILNRIQEHFNKKIE--------------------------------------------------------
1fuuB           A-RELEKFYSTQIE--------------------------------------------------------
3ewsA           ILNRIQEHFNKKIE--------------------------------------------------------
3i5xA           FVRELEDAKN--IVIAKQEKYEPSEEIK------------------------------------------
3berA           ----------------------------------------------------------------------
3fe2A           ----------------------------------------------------------------------
1wrbA           ----------------------------------------------------------------------
1wrbB           ----------------------------------------------------------------------
2zu6F           --RDIETFYN------------------------------------------------------------
2pl3A           ----------------------------------------------------------------------
1vecA           ----------------------------------------------------------------------
3fhoB           SWEEM-----------------------------------------------------------------
3fhoA           SWEEM-----------------------------------------------------------------
1t6nA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------
2oxcA           ----------------------------------------------------------------------
1qvaA           ----------------------------------------------------------------------
1fukA           AMRELEKFYSTQIE--------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
2waxC           NLKSIE----------------------------------------------------------------
2jgnC           ----------------------------------------------------------------------
2jgnB           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
1qdeA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
2p6nB           ----------------------------------------------------------------------
2p6nA           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
2waxA           NLKSIE----------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------
2kbeA           ----------------------------------------------------------------------
3fmpB           ----------------------------------------------------------------------
3fmoB           ----------------------------------------------------------------------
3fhcB           ----------------------------------------------------------------------
2rb4A           SLMKIQDHFNSSI---------------------------------------------------------
2g2jA           SLMKIQDHFNSSI---------------------------------------------------------
2rb4B           SLMKIQDHFNSSI---------------------------------------------------------
2jgnA           ----------------------------------------------------------------------
2wayA           NLKSIE----------------------------------------------------------------
2wayC           NLKSIE----------------------------------------------------------------
1oyyA           WLRR------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
1oywA           AWLR------------------------------------------------------------------
2g9nB           ----------------------------------------------------------------------
1fuuA           ----------------------------------------------------------------------
2g9nA           ----------------------------------------------------------------------
2v1xA           R---------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
1gm5A           AMERLRFFTLNTDGFKIAEYDLKTRGP-------------------------------------------
1wp9C           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
1d2mA           Q-RAIEE-TNRR----------------------------------------------------------
1c4oA           Q-RAIEE-TNRR----------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2fzlA           ----------------------------------------------------------------------
2fwrD           ----------------------------------------------------------------------
2fwrC           ----------------------------------------------------------------------
2fwrB           ----------------------------------------------------------------------
2fwrA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2p6rA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i4iA           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1s2mA           ----------------------------------------------------------------------
2j0sA           ----------------------------------------------------------------------
2j0qA           ----------------------------------------------------------------------
2hyiC           ----------------------------------------------------------------------
2hxyA           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
2j0uA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------
2vsoA           ----------------------------------------------------------------------
2zu6A           ----------------------------------------------------------------------
1xtkA           ----------------------------------------------------------------------
2zu6D           ----------------------------------------------------------------------
1xtiA           ----------------------------------------------------------------------
3fhtB           ----------------------------------------------------------------------
3g0hA           ----------------------------------------------------------------------
3fhtA           ----------------------------------------------------------------------
2gxsB           ----------------------------------------------------------------------
2gxqA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
1hv8A           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2j0uB           ----------------------------------------------------------------------
1xtjA           ----------------------------------------------------------------------
3ewsB           ----------------------------------------------------------------------
1fuuB           ----------------------------------------------------------------------
3ewsA           ----------------------------------------------------------------------
3i5xA           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3fe2A           ----------------------------------------------------------------------
1wrbA           ----------------------------------------------------------------------
1wrbB           ----------------------------------------------------------------------
2zu6F           ----------------------------------------------------------------------
2pl3A           ----------------------------------------------------------------------
1vecA           ----------------------------------------------------------------------
3fhoB           ----------------------------------------------------------------------
3fhoA           ----------------------------------------------------------------------
1t6nA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------
2oxcA           ----------------------------------------------------------------------
1qvaA           ----------------------------------------------------------------------
1fukA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
2waxC           ----------------------------------------------------------------------
2jgnC           ----------------------------------------------------------------------
2jgnB           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
1qdeA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
2p6nB           ----------------------------------------------------------------------
2p6nA           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
2waxA           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------
2kbeA           ----------------------------------------------------------------------
3fmpB           ----------------------------------------------------------------------
3fmoB           ----------------------------------------------------------------------
3fhcB           ----------------------------------------------------------------------
2rb4A           ----------------------------------------------------------------------
2g2jA           ----------------------------------------------------------------------
2rb4B           ----------------------------------------------------------------------
2jgnA           ----------------------------------------------------------------------
2wayA           ----------------------------------------------------------------------
2wayC           ----------------------------------------------------------------------
1oyyA           ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
1oywA           ----------------------------------------------------------------------
2g9nB           ----------------------------------------------------------------------
1fuuA           ----------------------------------------------------------------------
2g9nA           ----------------------------------------------------------------------
2v1xA           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2fzlA           ----------------------------------------------------------------------
2fwrD           ----------------------------------------------------------------------
2fwrC           ----------------------------------------------------------------------
2fwrB           ----------------------------------------------------------------------
2fwrA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2p6rA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i4iA           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1s2mA           ----------------------------------------------------------------------
2j0sA           ----------------------------------------------------------------------
2j0qA           ----------------------------------------------------------------------
2hyiC           ----------------------------------------------------------------------
2hxyA           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
2j0uA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------
2vsoA           ----------------------------------------------------------------------
2zu6A           ----------------------------------------------------------------------
1xtkA           ----------------------------------------------------------------------
2zu6D           ----------------------------------------------------------------------
1xtiA           ----------------------------------------------------------------------
3fhtB           ----------------------------------------------------------------------
3g0hA           ----------------------------------------------------------------------
3fhtA           ----------------------------------------------------------------------
2gxsB           ----------------------------------------------------------------------
2gxqA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
1hv8A           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2j0uB           ----------------------------------------------------------------------
1xtjA           ----------------------------------------------------------------------
3ewsB           ----------------------------------------------------------------------
1fuuB           ----------------------------------------------------------------------
3ewsA           ----------------------------------------------------------------------
3i5xA           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3fe2A           ----------------------------------------------------------------------
1wrbA           ----------------------------------------------------------------------
1wrbB           ----------------------------------------------------------------------
2zu6F           ----------------------------------------------------------------------
2pl3A           ----------------------------------------------------------------------
1vecA           ----------------------------------------------------------------------
3fhoB           ----------------------------------------------------------------------
3fhoA           ----------------------------------------------------------------------
1t6nA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------
2oxcA           ----------------------------------------------------------------------
1qvaA           ----------------------------------------------------------------------
1fukA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
2waxC           ----------------------------------------------------------------------
2jgnC           ----------------------------------------------------------------------
2jgnB           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
1qdeA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
2p6nB           ----------------------------------------------------------------------
2p6nA           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
2waxA           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------
2kbeA           ----------------------------------------------------------------------
3fmpB           ----------------------------------------------------------------------
3fmoB           ----------------------------------------------------------------------
3fhcB           ----------------------------------------------------------------------
2rb4A           ----------------------------------------------------------------------
2g2jA           ----------------------------------------------------------------------
2rb4B           ----------------------------------------------------------------------
2jgnA           ----------------------------------------------------------------------
2wayA           ----------------------------------------------------------------------
2wayC           ----------------------------------------------------------------------
1oyyA           ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
1oywA           ----------------------------------------------------------------------
2g9nB           ----------------------------------------------------------------------
1fuuA           ----------------------------------------------------------------------
2g9nA           ----------------------------------------------------------------------
2v1xA           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2fzlA           ----------------------------------------------------------------------
2fwrD           ----------------------------------------------------------------------
2fwrC           ----------------------------------------------------------------------
2fwrB           ----------------------------------------------------------------------
2fwrA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2p6rA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxx
2i4iA           ----
2db3A           ----
1s2mA           ----
2j0sA           ----
2j0qA           ----
2hyiC           ----
2hxyA           ----
2z0mA           ----
2j0uA           ----
2zu6C           ----
2vsoA           ----
2zu6A           ----
1xtkA           ----
2zu6D           ----
1xtiA           ----
3fhtB           ----
3g0hA           ----
3fhtA           ----
2gxsB           ----
2gxqA           ----
3eiqA           ----
1hv8A           ----
3eiqD           ----
2j0uB           ----
1xtjA           ----
3ewsB           ----
1fuuB           ----
3ewsA           ----
3i5xA           ----
3berA           ----
3fe2A           ----
1wrbA           ----
1wrbB           ----
2zu6F           ----
2pl3A           ----
1vecA           ----
3fhoB           ----
3fhoA           ----
1t6nA           ----
3eaqA           ----
3i32A           ----
2hjvB           ----
2hjvA           ----
2oxcA           ----
1qvaA           ----
1fukA           ----
2kbfA           ----
2waxC           ----
2jgnC           ----
2jgnB           ----
3dkpA           ----
1qdeA           ----
3easA           ----
3earA           ----
3eaqB           ----
3gfpA           ----
1q0uB           ----
2p6nB           ----
2p6nA           ----
3borA           ----
2waxA           ----
1q0uA           ----
2kbeA           ----
3fmpB           ----
3fmoB           ----
3fhcB           ----
2rb4A           ----
2g2jA           ----
2rb4B           ----
2jgnA           ----
2wayA           ----
2wayC           ----
1oyyA           ----
1t5iA           ----
1oywA           ----
2g9nB           ----
1fuuA           ----
2g9nA           ----
2v1xA           ----
1wp9B           ----
1wp9A           ----
1gm5A           ----
1wp9C           ----
1t5lA           ----
1d9zA           ----
1d9xA           ----
2eyqB           ----
2eyqA           ----
1wp9D           ----
2nmvA           ----
2d7dA           ----
1d2mA           ----
1c4oA           ----
2fdcA           ----
2fzlA           ----
2fwrD           ----
2fwrC           ----
2fwrB           ----
2fwrA           ----
2fdcB           ----
2p6rA           ----